diff --git a/hack/maven.default.index b/hack/maven.default.index
index 464b545..d3eea8f 100644
--- a/hack/maven.default.index
+++ b/hack/maven.default.index
@@ -1,14 +1,75090 @@
-# Fake maven.default.index to COPY when BUILDENV=local
-#
-# This file takes far too long to generate on alternate architectures using
-# emulation in GitHub actions.
-#
-# It is not possible to conditionally run a Dockerfile / Containerfile COPY
-# But we can use an ARG to manipulate what happens in a RUN command, so we
-# either overwrite this file in GitHub before starting the container build,
-# copy it into the container and skip generating it within the container or
-# copy it in and overwrite it within the container when building locally.
-#
-# This means no additional steps have to be added to the development workflow.
-#
-# If this message appears in a container image something went wrong.
+HTTPClient.*
+abbot.*
+academy.alex.*
+academy.compose.companion.*
+acegisecurity.*
+activation.*
+activecluster.*
+activeio.*
+activemq.*
+activesoap.*
+activespace.*
+adarwin.*
+ae.teletronics.*
+ae.teletronics.ejabberd.*
+ae.teletronics.nlp.*
+ae.teletronics.peers.*
+ae.teletronics.solr.*
+ae.teletronics.toolbox.*
+aelfred.*
+aero.champ.*
+aero.m-click.*
+aero.t2s.*
+africa.absa.*
+africa.shuwari.sbt.*
+ag.granular.*
+ai.active.*
+ai.acyclic.shapesafe.*
+ai.agnos.*
+ai.aitia.*
+ai.api.*
+ai.api.libai.speech.*
+ai.api.libai.web.*
+ai.apiverse.*
+ai.apptuit.*
+ai.apptuit.metrics.*
+ai.bareun.tagger.*
+ai.begin.*
+ai.benshi.android.sdk.*
+ai.bleckwen.*
+ai.blip.*
+ai.cardscan.*
+ai.catboost.*
+ai.causalfoundry.android.sdk.*
+ai.chronon.*
+ai.cochl.*
+ai.cookie.*
+ai.databand.*
+ai.databand.azkaban.*
+ai.deepsense.*
+ai.dev-tools.*
+ai.devrev.sdk.*
+ai.djl.*
+ai.djl.android.*
+ai.djl.audio.*
+ai.djl.aws.*
+ai.djl.dlr.*
+ai.djl.fasttext.*
+ai.djl.hadoop.*
+ai.djl.huggingface.*
+ai.djl.java.*
+ai.djl.jsr381.*
+ai.djl.ml.lightgbm.*
+ai.djl.ml.xgboost.*
+ai.djl.mxnet.*
+ai.djl.onnxruntime.*
+ai.djl.opencv.*
+ai.djl.paddlepaddle.*
+ai.djl.python.*
+ai.djl.pytorch.*
+ai.djl.sentencepiece.*
+ai.djl.serving.*
+ai.djl.spark.*
+ai.djl.spring.*
+ai.djl.tablesaw.*
+ai.djl.tensorflow.*
+ai.djl.tensorrt.*
+ai.djl.tflite.*
+ai.djl.timeseries.*
+ai.dragonfly.*
+ai.dstack.*
+ai.edgestore.*
+ai.eloquent.*
+ai.engagely.*
+ai.engageminds.*
+ai.entrolution.*
+ai.eto.*
+ai.evolv.*
+ai.expert.*
+ai.eye2you.*
+ai.faculty.*
+ai.fairytech.*
+ai.fedml.*
+ai.foremast.metrics.*
+ai.foxpay.api.*
+ai.freeplay.*
+ai.gams.*
+ai.grakn.*
+ai.grakn.kgms.*
+ai.granica.*
+ai.grant.*
+ai.h2o.*
+ai.heavy.*
+ai.houyi.*
+ai.hunters.*
+ai.hyacinth.framework.*
+ai.hypergraph.*
+ai.idylnlp.*
+ai.kaiko.*
+ai.kien.*
+ai.knowly.*
+ai.kognition.pilecv4j.*
+ai.konduit.serving.*
+ai.kontent.*
+ai.libs.*
+ai.libs.thirdparty.*
+ai.lilystyle.*
+ai.lucidtech.*
+ai.lum.*
+ai.madara.*
+ai.mantik.*
+ai.marsview.*
+ai.meson.sdk.*
+ai.meson.sdk.mediation.*
+ai.minxiao.*
+ai.mobid.*
+ai.mrs.*
+ai.mykg.*
+ai.nextbillion.*
+ai.nightfall.*
+ai.olami.*
+ai.optfor.*
+ai.optiscan.*
+ai.ost.*
+ai.passio.passiosdk.*
+ai.picovoice.*
+ai.platon.*
+ai.platon.commons.*
+ai.platon.pulsar.*
+ai.preferred.*
+ai.proba.probasdk.*
+ai.promoted.*
+ai.qianmo.*
+ai.quantnet.*
+ai.rapids.*
+ai.realengine.*
+ai.redpen.*
+ai.redpen.capture.sdk.*
+ai.rev.*
+ai.rev.speechtotext.*
+ai.rideos.api.*
+ai.rideos.sdk.*
+ai.salmonbrain.*
+ai.scikitlearn4x.*
+ai.silot.taurus.*
+ai.smartwall.*
+ai.snips.*
+ai.stainless.*
+ai.stapi.*
+ai.starlake.*
+ai.swim.*
+ai.symbl.*
+ai.systema.*
+ai.tabby.*
+ai.taskmonk.*
+ai.tecton.*
+ai.test.sdk.*
+ai.thirdwatch.*
+ai.timefold.solver.*
+ai.tock.*
+ai.toloka.*
+ai.traceable.agent.*
+ai.tripl.*
+ai.upollo.*
+ai.whylabs.*
+ai.wordbox.*
+ai.x.*
+ai.xpl.*
+ai.ylyue.*
+ai.zerek.*
+aislib.*
+al.aldi.*
+al.bluecryst.*
+altrmi.*
+am.gaut.android.toolbarbutton.*
+am.ik.access-logger.*
+am.ik.archetype.*
+am.ik.aws.*
+am.ik.beansviz.*
+am.ik.blog.*
+am.ik.categolj2.*
+am.ik.categolj3.*
+am.ik.certificate.*
+am.ik.csng.*
+am.ik.eureka.*
+am.ik.fh4j.*
+am.ik.functions.*
+am.ik.github.*
+am.ik.hazelcast.*
+am.ik.home.*
+am.ik.jqiita.*
+am.ik.json.*
+am.ik.ltsv4j.*
+am.ik.marked4j.*
+am.ik.pagination.*
+am.ik.servicebroker.*
+am.ik.spring.*
+am.ik.springmvc.*
+am.ik.template.*
+am.ik.timeflake.*
+am.ik.tsng.*
+am.ik.util.*
+am.ik.voicetext.*
+am.ik.webhook.*
+am.ik.woothee.*
+am.ik.wws.*
+am.ik.yavi.*
+andromda.*
+annogen.*
+ant-contrib.*
+ant-doxygen.*
+ant.*
+ant4eclipse.*
+antlr.*
+anttex.*
+aopalliance.*
+apache-jaxme.*
+app.alan.*
+app.artyomd.injector.*
+app.bondar.gradle.git-version.*
+app.bondar.gradle.gitversion.*
+app.cash.backfila.*
+app.cash.barber.*
+app.cash.better.dynamic.features.*
+app.cash.better.dynamic.features.agp-patch.*
+app.cash.certifikit.*
+app.cash.chronicler.*
+app.cash.contour.*
+app.cash.copper.*
+app.cash.exhaustive.*
+app.cash.inject.*
+app.cash.jooq.*
+app.cash.kfactories.*
+app.cash.licensee.*
+app.cash.lninvoice.*
+app.cash.molecule.*
+app.cash.nostrino.*
+app.cash.paging.*
+app.cash.paparazzi.*
+app.cash.paraphrase.*
+app.cash.paykit.*
+app.cash.quickjs.*
+app.cash.quiver.*
+app.cash.redwood.*
+app.cash.redwood.generator.compose.*
+app.cash.redwood.generator.compose.protocol.*
+app.cash.redwood.generator.layoutmodifiers.*
+app.cash.redwood.generator.modifiers.*
+app.cash.redwood.generator.testing.*
+app.cash.redwood.generator.widget.*
+app.cash.redwood.generator.widget.protocol.*
+app.cash.redwood.lint.*
+app.cash.redwood.schema.*
+app.cash.sqldelight.*
+app.cash.tempest.*
+app.cash.treehouse.*
+app.cash.treehouse.schema.*
+app.cash.treehouse.schema.compose.*
+app.cash.treehouse.schema.display.*
+app.cash.trifle.*
+app.cash.turbine.*
+app.cash.wisp.*
+app.cash.zipline.*
+app.chladek.*
+app.cloud7.*
+app.commerce-io.*
+app.cybrid.*
+app.dassana.*
+app.djai.codegen.*
+app.dokt.*
+app.entao.web.*
+app.fmgp.*
+app.freel.*
+app.futured.arkitekt.*
+app.futured.donut.*
+app.futured.hauler.*
+app.getxray.*
+app.habitap.*
+app.infoset.*
+app.infoset.android.*
+app.jackychu.*
+app.juky.*
+app.keve.ktlsh.*
+app.keyconnect.*
+app.keyconnect.api.*
+app.knock.api.*
+app.kntrl.*
+app.ksyuki.*
+app.ksyuki.rubylib.*
+app.kula.*
+app.microkit.*
+app.moneytree.link.*
+app.moreo.*
+app.moviebase.*
+app.msign.*
+app.myoss.cloud.*
+app.myoss.cloud.boot.*
+app.myoss.cloud.codestyle.*
+app.myoss.cloud.jdbc.*
+app.myoss.cloud.maven.plugins.*
+app.myoss.cloud.mybatis.*
+app.myoss.wechat.*
+app.nekogram.*
+app.nekogram.prism4j.*
+app.nekogram.tcp2ws.*
+app.nekogram.translator.*
+app.netmonster.*
+app.nzyme.*
+app.peac.*
+app.pickmaven.*
+app.pivo.*
+app.pivo.android.*
+app.pivo.android.basicsdk.*
+app.playerzero.sdk.*
+app.redwarp.gif.*
+app.rive.*
+app.screeb.sdk.*
+app.sdkgen.*
+app.simplifyom.sdk.*
+app.slyworks.*
+app.slyworks.navigator.*
+app.softwork.*
+app.softwork.kobol.*
+app.softwork.serviceloader.*
+app.softwork.serviceloader.versions.*
+app.starzero.navbuilder.*
+app.summation.android.*
+app.titech.*
+app.tourandot.*
+app.tozzi.*
+app.tozzi.mail.*
+app.tulz.*
+app.ubie.*
+app.wordpace.*
+aptconvert.*
+ar.com.asanteit.*
+ar.com.crypticmind.*
+ar.com.fdvs.*
+ar.com.hal9000.*
+ar.com.hjg.*
+ar.com.jmfsg.*
+ar.com.onready.*
+ar.com.siripo.*
+ar.gabrielsuarez.*
+args4j.*
+art.cutils.*
+art.rightbrain.tool.vega.*
+as.leap.*
+ashkay.*
+ashkelon.*
+asia.990121.*
+asia.ivity.*
+asia.ivity.android.*
+asia.redact.bracket.properties.*
+asia.stampy.*
+asm.*
+aspectj.*
+aspectwerkz.*
+at.ac.ait.*
+at.ac.ait.fmipp.*
+at.ac.ait.lablink.*
+at.ac.ait.lablink.clients.*
+at.ac.uibk.dps.cloud.simulator.*
+at.ait.dme.forcelayout.*
+at.asitplus.*
+at.asitplus.wallet.*
+at.austriapro.*
+at.bestsolution.*
+at.bestsolution.eclipse.*
+at.bestsolution.efxclipse.ide.*
+at.bestsolution.fx.test.*
+at.blogc.*
+at.bluesource.choicesdk.*
+at.borkowski.prefetch-simulation.*
+at.borkowski.scovillej.*
+at.borkowski.spicej.*
+at.chrl.*
+at.chrl.archetypes.*
+at.co.svc.jareto.*
+at.connyduck.*
+at.connyduck.sparkbutton.*
+at.craftworks.tools.maven.*
+at.crea-doo.flexdock.*
+at.crea-doo.homer.*
+at.crea-doo.util.*
+at.crea-doo.util.dovado.*
+at.crea-doo.util.nativeloader.*
+at.crea-doo.util.netio.*
+at.crea-doo.util.nrjavaserial.*
+at.crea-doo.util.toughswitch.*
+at.datenwort.commons.*
+at.favre.lib.*
+at.favre.lib.hood.*
+at.ff-esternberg.sybos.*
+at.florianschuster.control.*
+at.grahsl.kafka.connect.*
+at.gridgears.*
+at.gridgears.schemas.*
+at.gridtec.lambda4j.*
+at.hazm.*
+at.hugob.plugin.library.*
+at.iem.*
+at.iem.sysson.*
+at.ipsquare.*
+at.irian.typescript.*
+at.itopen.*
+at.jonastuechler.*
+at.kopyk.*
+at.logic.*
+at.logic.gapt.*
+at.makubi.maven.plugin.*
+at.matteovalentini.*
+at.meks.*
+at.mjst.*
+at.mlem.*
+at.molindo.*
+at.molindo.social.*
+at.mukprojects.*
+at.newmedialab.ldpath.*
+at.noahb.*
+at.nonblocking.*
+at.pardus.android.*
+at.porscheinformatik.tapestry.*
+at.porscheinformatik.weblate.*
+at.porscheinformatik.zanata.*
+at.quelltextlich.jacoco.*
+at.quickme.kotlinmailer.*
+at.rechnerherz.*
+at.reilaender.asciidoctorj.bootconfig2adoc.*
+at.researchstudio.sat.*
+at.rocklogic.kafka.*
+at.rodrigo.api.gateway.*
+at.rseiler.*
+at.rseiler.pom-project.*
+at.rseiler.spbee.*
+at.rueckgr.kotlin.rocketbot.*
+at.salzburgresearch.nodekeeper.*
+at.schmutterer.oss.*
+at.schmutterer.oss.gradle.*
+at.schmutterer.oss.jpatest.*
+at.schmutterer.oss.liquibase.*
+at.stderr.*
+at.stefangeyer.challonge.*
+at.stefangeyer.challonge.rest.*
+at.stefangeyer.challonge.serializer.*
+at.swimmesberger.*
+at.tripwire.gradle.wo.*
+at.twinformatics.*
+at.unbounded.*
+at.willhaben.kafka.*
+at.willhaben.willtest.*
+at.wirecube.*
+at.yawk.cowsay.*
+at.yawk.cricket.*
+at.yawk.dbus.*
+at.yawk.dropwizard-nagios.*
+at.yawk.logging.*
+at.yawk.mcomponent.*
+at.yawk.mcskin.*
+at.yawk.mdep.*
+at.yawk.numaec.*
+at.yawk.pigeonj.*
+at.yawk.reflect.*
+at.yawk.valda.*
+au.com.acegi.*
+au.com.agiledigital.*
+au.com.agilepractices.rules.engine.*
+au.com.agilepractices.rules.engine.examples.*
+au.com.alderaan.*
+au.com.anthonybruno.*
+au.com.azupay.sdk.*
+au.com.bytecode.*
+au.com.clearboxsystems.maven.plugins.nodejs.*
+au.com.codeka.*
+au.com.codeka.carrot.*
+au.com.cyberavenue.*
+au.com.cybernostics.*
+au.com.dardle.*
+au.com.datasymphony.*
+au.com.dius.*
+au.com.dius.pact.*
+au.com.dius.pact.consumer.*
+au.com.dius.pact.core.*
+au.com.dius.pact.provider.*
+au.com.domain.*
+au.com.equiem.*
+au.com.flyingkite.*
+au.com.govlawtech.*
+au.com.gridstone.*
+au.com.gridstone.debugdrawer.*
+au.com.gridstone.rxstore.*
+au.com.haystacker.*
+au.com.intelix.*
+au.com.ish.gradle.*
+au.com.moneyball.*
+au.com.mountain-pass.*
+au.com.muel.*
+au.com.nicta.*
+au.com.ninthavenue.jamaica.faces.*
+au.com.onegeek.*
+au.com.permeance.*
+au.com.redboxresearchdata.fascinator.*
+au.com.redcrew.apisdkcreator.*
+au.com.refactor.groovy.*
+au.com.refactor.texttable.*
+au.com.skytix.*
+au.com.titanclass.*
+au.com.turingg.*
+au.csiro.*
+au.csiro.aehrc.variant-spark.*
+au.csiro.pathling.*
+au.edu.uq.rcc.*
+au.gov.amsa.*
+au.gov.amsa.risky.*
+au.gov.digitalhealth.*
+au.gov.nehta.*
+au.id.ajlane.*
+au.id.ajlane.iostreams.*
+au.id.ajlane.retry.*
+au.id.ajlane.scheduler.*
+au.id.jazzy.*
+au.id.simo.*
+au.id.tmm.*
+au.id.tmm.ausgeo.*
+au.id.tmm.bfect.*
+au.id.tmm.countstv.*
+au.id.tmm.digest4s.*
+au.id.tmm.fetch.*
+au.id.tmm.github-pr-language-detection.*
+au.id.tmm.http-constants.*
+au.id.tmm.intime.*
+au.id.tmm.probability-measure.*
+au.id.tmm.probability.*
+au.id.tmm.scala-db.*
+au.id.tmm.scala-web-feed-models.*
+au.id.tmm.tmm-scala-collections.*
+au.id.tmm.tmm-scala-plotly.*
+au.id.tmm.tmm-utils.*
+au.id.villar.web.*
+au.net.causal.groovysh-windows-fix.*
+au.net.causal.maven.native-security.*
+au.net.causal.maven.plugins.*
+au.net.causal.projo.*
+au.net.causal.shoelaces.*
+au.net.causal.spring-boot-keepassxc-property-agent.*
+au.net.hivemedia.*
+au.net.ocean.*
+au.net.ocean.ext.*
+au.net.ocean.maven.plugin.*
+au.net.ocean.security.auth.gss.*
+au.net.zeus.*
+au.net.zeus.jgdms.*
+au.net.zeus.jgdms.fiddler.*
+au.net.zeus.jgdms.group.*
+au.net.zeus.jgdms.mahalo.*
+au.net.zeus.jgdms.mercury.*
+au.net.zeus.jgdms.norm.*
+au.net.zeus.jgdms.outrigger.*
+au.net.zeus.jgdms.phoenix-activation.*
+au.net.zeus.jgdms.reggie.*
+au.net.zeus.jgdms.tools.*
+au.org.ala.*
+au.org.consumerdatastandards.*
+avalon-activation.*
+avalon-apps.*
+avalon-composition.*
+avalon-cornerstone.*
+avalon-extension.*
+avalon-framework.*
+avalon-http.*
+avalon-logging.*
+avalon-logkit.*
+avalon-meta.*
+avalon-phoenix.*
+avalon-repository.*
+avalon-util.*
+avalon.*
+aws.sdk.kotlin.*
+aws.sdk.kotlin.crt.*
+aws.smithy.kotlin.*
+ax.antpick.*
+ax.antpick.training.*
+axion.*
+axis.*
+axis2.*
+azote.*
+ba.jamax.util.*
+ba.sake.*
+backport-util-concurrent.*
+backport175.*
+band.wukong.*
+barsuift.simLife.*
+batik.*
+bayern.meyer.*
+bayern.meyer.maven.plugins.*
+bayern.steinbrecher.*
+bcel.*
+bd.ac.seu.erp.*
+bd.com.ipay.sdk.*
+bd.com.shurjomukhi.*
+bd.com.shurjopay.plugin.*
+be.ac.umons.sgl.*
+be.adaxisoft.*
+be.atbash.*
+be.atbash.config.*
+be.atbash.ee.jsf.*
+be.atbash.ee.jsf.renderer-extensions.*
+be.atbash.ee.jsf.valerie.*
+be.atbash.ee.security.*
+be.atbash.ee.security.octopus.*
+be.atbash.ee.security.octopus.opinionated.*
+be.atbash.jakarta.*
+be.atbash.jakarta.config.*
+be.atbash.jakarta.json.*
+be.atbash.jakarta.utils.*
+be.atbash.json.*
+be.atbash.keys.*
+be.atbash.mp.rest-client.*
+be.atbash.runtime.*
+be.atbash.runtime.api.*
+be.atbash.test.*
+be.atbash.utils.*
+be.avhconsult.*
+be.bagofwords.*
+be.billington.android.light-sensitive-color.*
+be.billington.calendar.recurrencepicker.*
+be.bosa.commons-eid.*
+be.botkop.*
+be.breina.*
+be.broij.*
+be.brugo.*
+be.cafeba.*
+be.ceau.*
+be.cetic.*
+be.cloudway.*
+be.cyberelf.nanoxml.*
+be.cylab.*
+be.cylab.mark.*
+be.cytomine.client.*
+be.dabla.*
+be.dataminded.*
+be.dataminded.wharlord.*
+be.dnsbelgium.*
+be.dnsbelgium.data.*
+be.doeraene.*
+be.eliwan.*
+be.feelio.*
+be.fluid-it.camel.components.*
+be.fluid-it.com.squarespace.jersey2-guice.*
+be.fluid-it.guice.extensions.*
+be.fluid-it.microservice.bundle.*
+be.fluid-it.reactive-microservice.bundle.*
+be.fluid-it.reactive-microservice.bundle.mixins.*
+be.fluid-it.rest.*
+be.fluid-it.shiro.jee.*
+be.fluid-it.tools.dropwizard.*
+be.fluid-it.tools.mvn.cd.*
+be.fluid-it.tools.rundeck.plugins.*
+be.fluid-it.tools.swagger.*
+be.fluid-it.wagon.*
+be.hikage.*
+be.hikage.maven.plugins.*
+be.hobbiton.*
+be.hobbiton.jersey.*
+be.hobbiton.maven.*
+be.icandev.maven.*
+be.icteam.*
+be.ida-mediafoundry.jetpack.*
+be.idamediafoundry.sofa.*
+be.idoneus.felix.*
+be.infowhere.*
+be.intersentia.elasticsearch.*
+be.jacobsvanroy.*
+be.jatra.*
+be.jidoka.*
+be.jlr-home.gradle.*
+be.joengenduvel.java.verifiers.*
+be.jonaseveraert.utils.*
+be.kuleuven.ccis.util.*
+be.lennertsoffers.*
+be.looorent.*
+be.lukin.poeditor.*
+be.mjosoft.*
+be.mogo.generator.*
+be.mogo.iam.*
+be.mygod.*
+be.mygod.librootkotlinx.*
+be.nelcea.*
+be.nille.*
+be.nille.jwt.*
+be.novelfaces.*
+be.objectify.*
+be.olsson.*
+be.olsson.bencoder.*
+be.orbinson.aem.*
+be.ordina.*
+be.personify.*
+be.personify.iam.*
+be.pielambr.*
+be.pixxis.*
+be.redlab.jaxb.*
+be.redlab.jersey.*
+be.redlab.logback.*
+be.redlab.testhelpers.*
+be.rlab.*
+be.roam.hue.*
+be.rufer.*
+be.rufer.swisscom.sms.*
+be.selckin.swu.*
+be.selckin.util.*
+be.shouldit.*
+be.siteware.*
+be.skylark.weather.*
+be.sweetmustard.vinegar.*
+be.sysa.log-sanitizer.*
+be.sysa.quartz-job-synchronizer.*
+be.thematchbox.*
+be.thinkerit.gradle.*
+be.tomcools.*
+be.tzbob.*
+be.uantwerpen.adrem.*
+be.ugent.*
+be.ugent.brightspace.*
+be.ugent.rml.*
+be.unamur.info.*
+be.valuya.*
+be.valuya.accountingtroll.*
+be.valuya.advantaje.*
+be.valuya.bob.*
+be.valuya.cestzam.*
+be.valuya.vattools.*
+be.valuya.winbooks.*
+be.venneborg.*
+be.vito.rma.configtools.*
+be.vito.rma.resttools.*
+be.vito.rma.standalonetools.*
+be.vlaanderen.informatievlaanderen.vsds.*
+be.webtechie.*
+be.wegenenverkeer.*
+be.woutschoovaerts.*
+be.xbd.nid.verification.*
+be.yildiz-games.*
+be.zvz.*
+beehive.*
+berkano.*
+berkeleydb.*
+berlin.softwaretechnik.*
+berlin.yuna.*
+bg.devlabs.*
+bi.deep.*
+bike.donkey.*
+binky.ofc2plugin.*
+bio.ferlab.*
+bio.gamerplay.game.*
+bio.nvwa.boot.*
+bio.singa.*
+biz.aQute.*
+biz.aQute.bnd.*
+biz.aQute.bnd.builder.*
+biz.aQute.bnd.workspace.*
+biz.cgta.*
+biz.cosee.*
+biz.dfch.j.*
+biz.enef.*
+biz.eyebeam.mssc.*
+biz.freshcode.b-generation.*
+biz.futureware.mantis.*
+biz.gabrys.*
+biz.gabrys.forks.com.samaxes.maven.*
+biz.gabrys.lesscss.*
+biz.gabrys.maven.*
+biz.gabrys.maven.plugins.*
+biz.grundner.vaadin-in-spring.*
+biz.hochguertel.*
+biz.hochguertel.javaeetutorial.jaxrs.*
+biz.ivanov.wildfly.*
+biz.jovido.*
+biz.kasual.*
+biz.lermitage.oga.*
+biz.littlej.jreqs.*
+biz.lobachev.annette.*
+biz.massive-dynamics.*
+biz.metacode.calcscript.*
+biz.mofokom.*
+biz.netcentric.aem.*
+biz.netcentric.aem.ops.healthchecks.migration.*
+biz.netcentric.aem.sysenvtools.*
+biz.netcentric.aem.tools.accesscontrolvalidator.*
+biz.netcentric.cq.tools.accesscontroltool.*
+biz.netcentric.cq.tools.aemmjml.*
+biz.netcentric.filevault.validator.*
+biz.netcentric.filevault.validator.maps.*
+biz.netcentric.maven.extension.*
+biz.netcentric.ops.applyserver.*
+biz.netcentric.security.*
+biz.netcentric.vlt.upgrade.*
+biz.neumann.*
+biz.neustar.*
+biz.neustar.maven.plugins.*
+biz.ostw.*
+biz.paluch.logging.*
+biz.paluch.maven.configurator.*
+biz.paluch.redis.*
+biz.paluch.visualizr.*
+biz.seankelly.maven.*
+biz.source_code.*
+biz.turnonline.ecosystem.*
+black.door.*
+black.ninia.*
+blissed.*
+blog.greengoblet.pyrus.api.*
+blog.softwaretester.*
+blog.svenbayer.*
+blue.endless.*
+blue.starry.*
+blue.strategic.parquet.*
+boo.*
+bot.inker.acj.*
+bouncycastle.*
+boxstuff.*
+br.com.abrahao.*
+br.com.absoftware.gerabook.*
+br.com.acolita.*
+br.com.address.archetypes.*
+br.com.aniche.*
+br.com.anteros.*
+br.com.anteros.social.*
+br.com.arbo.swinginsulation.*
+br.com.armange.*
+br.com.arsmachina.*
+br.com.autonomiccs.*
+br.com.basis.*
+br.com.beardsoft.*
+br.com.behaviortest.*
+br.com.bemobi.*
+br.com.bluesoft.guardian.*
+br.com.c8tech.releng.*
+br.com.c8tech.tools.*
+br.com.caelum.*
+br.com.caelum.livraria.*
+br.com.caelum.seleniumdsl.*
+br.com.caelum.srs.*
+br.com.caelum.stella.*
+br.com.caelum.tubaina.*
+br.com.caelum.vraptor.*
+br.com.caiquejh.*
+br.com.cefis.*
+br.com.charlessilva.*
+br.com.codecode.*
+br.com.collact.*
+br.com.collei.lavi.*
+br.com.colman.*
+br.com.colman.dynamodb.*
+br.com.colman.kotest.kotless.*
+br.com.colman.simplecnpjvalidator.*
+br.com.colman.simplecpfvalidator.*
+br.com.competeaqui.*
+br.com.coopersystem.*
+br.com.crazycrowd.*
+br.com.cursiva.labs.*
+br.com.damsete.*
+br.com.damsete.arq.*
+br.com.datapoa.*
+br.com.devires.framework.boot.*
+br.com.devsrsouza.*
+br.com.devsrsouza.compose.icons.*
+br.com.devsrsouza.compose.icons.android.*
+br.com.devsrsouza.compose.icons.jetbrains.*
+br.com.digilabs.jqplot.*
+br.com.digix.*
+br.com.diogoko.*
+br.com.edilsonvilarinho.*
+br.com.educode.*
+br.com.efipay.efisdk.*
+br.com.entelgy.*
+br.com.esec.icpm.*
+br.com.esign.*
+br.com.etyllica.*
+br.com.evologica.curio.*
+br.com.faroltech.*
+br.com.faroltech.vraptor.*
+br.com.flexait.*
+br.com.flowsense.*
+br.com.gamemods.*
+br.com.geraldoferraz.*
+br.com.gerencianet.gnsdk.*
+br.com.gerencianet.mobile.*
+br.com.getmo.*
+br.com.guiabolso.*
+br.com.handtalk.*
+br.com.hunterco.*
+br.com.ideotech.*
+br.com.ifisco.*
+br.com.ignisinventum.*
+br.com.imdt.*
+br.com.infoglobo.kvalito.*
+br.com.ingenieux.*
+br.com.ingenieux.cedarhero.*
+br.com.ingenieux.cloudy.*
+br.com.ingenieux.dropwizard.*
+br.com.ingenieux.hadoop.*
+br.com.ingenieux.launchify.*
+br.com.ingenieux.maven.annomojo.*
+br.com.ingenieux.simplejpa.*
+br.com.intelipost.*
+br.com.itsme.*
+br.com.iupay.*
+br.com.jansenfelipe.*
+br.com.jarch.*
+br.com.jarch.dsfnet.*
+br.com.jbugbrasil.*
+br.com.jbugbrasil.bot.*
+br.com.jgon.*
+br.com.jhemarcos.*
+br.com.joaovarandas.*
+br.com.jslsolucoes.*
+br.com.kracker.*
+br.com.labbs.*
+br.com.ledgertec.*
+br.com.leonardoferreira.*
+br.com.leonardoz.*
+br.com.leverinfo.*
+br.com.limebrothers.lbdatatext.*
+br.com.liquidity.*
+br.com.litecode.*
+br.com.liveo.*
+br.com.livroandroid.*
+br.com.logiquesistemas.*
+br.com.luizrcs.*
+br.com.mappsistemas.*
+br.com.markenson.*
+br.com.martinlabs.*
+br.com.mblabs.*
+br.com.meslin.API-HTTPConnection.*
+br.com.miguelfontes.*
+br.com.moip.*
+br.com.moip.mpos.*
+br.com.muryllo.jmailer.*
+br.com.mvsouza.plugins.*
+br.com.neomode.formvalidation.*
+br.com.neomode.httploader.*
+br.com.neppo.jlibs.*
+br.com.newgo.*
+br.com.nitertech.*
+br.com.ntcavalcante.*
+br.com.objectos.*
+br.com.objectos.args.*
+br.com.objectos.auto.*
+br.com.objectos.cnab.*
+br.com.objectos.code.*
+br.com.objectos.comuns.*
+br.com.objectos.core.*
+br.com.objectos.css.*
+br.com.objectos.db.*
+br.com.objectos.finos.*
+br.com.objectos.flat.*
+br.com.objectos.html.*
+br.com.objectos.http.*
+br.com.objectos.io.*
+br.com.objectos.jabuticava.*
+br.com.objectos.lazy.*
+br.com.objectos.metainf.*
+br.com.objectos.orm.*
+br.com.objectos.oss-java11.*
+br.com.objectos.oss-java16.*
+br.com.objectos.oss-java17.*
+br.com.objectos.oss-java6.*
+br.com.objectos.oss-java7.*
+br.com.objectos.oss-java8.*
+br.com.objectos.parent.*
+br.com.objectos.pojo.*
+br.com.objectos.rio.*
+br.com.objectos.schema.*
+br.com.objectos.sql.*
+br.com.objectos.store.*
+br.com.objectos.testable.*
+br.com.objectos.util.*
+br.com.objectos.way.*
+br.com.off2.*
+br.com.oimenu.*
+br.com.otavio.*
+br.com.otavio.vraptor.archetypes.*
+br.com.perolasoftware.framework.*
+br.com.perolasoftware.framework.components.*
+br.com.postmon.*
+br.com.powerapps.image.compress.*
+br.com.ppm.*
+br.com.prixma.*
+br.com.progolden.*
+br.com.retta.framework-android.*
+br.com.rhfactor.*
+br.com.ripoli.xico.*
+br.com.rocketdevelopment.*
+br.com.sejaefi.efisdk.*
+br.com.senior.*
+br.com.simpli.*
+br.com.simpli.tools.*
+br.com.six2six.*
+br.com.softplan.security.zap.*
+br.com.starcode.jerichoselector.*
+br.com.starcode.parccser.*
+br.com.starcode.trex.*
+br.com.stockio.*
+br.com.summa.*
+br.com.swconsultoria.*
+br.com.tdsis.*
+br.com.tecsinapse.*
+br.com.tempest.*
+br.com.thiagomoreira.*
+br.com.thiagomoreira.b3.*
+br.com.thiagomoreira.bancodobrasil.*
+br.com.thiagomoreira.foursquare.*
+br.com.thiagomoreira.liferay.plugins.*
+br.com.thiagomoreira.liferay.plugins.bootstrap-jumbotron-app.*
+br.com.thiagomoreira.liferay.plugins.fix-virtual-host-app.*
+br.com.thiagomoreira.liferay.plugins.lorem-ipsum-button-app.*
+br.com.thiagomoreira.liferay.plugins.markdown-display-app.*
+br.com.thiagomoreira.liferay.plugins.portal-properties-prettier-app.*
+br.com.thiagomoreira.liferay.plugins.setup-brazilian-regions-app.*
+br.com.thiagomoreira.liferay.plugins.share-button-app.*
+br.com.thiagomoreira.liferay.plugins.social-button-app.*
+br.com.thiagomoreira.replicon.*
+br.com.thiagomoreira.untappd.*
+br.com.thiaguten.*
+br.com.thiaguten.persistence.*
+br.com.totalvoice.*
+br.com.triadworks.*
+br.com.trustsystems.*
+br.com.uiltonsites.*
+br.com.uol.pagseguro.*
+br.com.uol.reconf.*
+br.com.vizzatech.*
+br.com.yapay.gateway.*
+br.com.youse.forms.*
+br.com.zapsign.*
+br.com.zup.beagle.*
+br.com.zup.kotlin.*
+br.com.zup.nimbus.*
+br.dev.dig.*
+br.dev.dig.logger.*
+br.dev.dig.logger.printer.*
+br.dev.dig.storage.*
+br.dev.dig.text.mask.*
+br.edu.ufcg.splab.*
+br.entities.*
+br.eti.arthurgregorio.*
+br.eti.clairton.*
+br.eti.kinoshita.*
+br.gov.frameworkdemoiselle.*
+br.gov.frameworkdemoiselle.archetypes.*
+br.gov.frameworkdemoiselle.component.*
+br.gov.frameworkdemoiselle.component.archetypes.*
+br.gov.frameworkdemoiselle.component.behave.*
+br.gov.lexml.*
+br.gov.lexml.eta.*
+br.gov.lexml.parser.pl.*
+br.gov.serpro.*
+br.gov.serpro.fatiador.*
+br.jus.stf.digital.*
+br.jus.trf2.assijus.*
+br.jus.trf2.xjus.*
+br.jus.tst.*
+br.net.bmobile.*
+br.net.buzu.*
+br.net.eventstore.*
+br.net.maskit.*
+br.net.pin.*
+br.net.woodstock.rockframework.*
+br.org.soujava.*
+br.puc-rio.tecgraf.*
+br.pucrs.ages.*
+br.tec.tuna.*
+br.ufc.insightlab.*
+br.ufc.quixada.npi.*
+br.uff.sti.*
+br.ufmg.dcc.saotome.*
+br.ufrn.sinfo.*
+br.ufsc.bridge.*
+br.unb.erlangms.*
+br.usp.*
+br.usp.each.saeg.*
+bsf.*
+bsh.*
+build.bleep.*
+build.buf.*
+build.buf.protoc-gen-validate.*
+build.buf.prototype.*
+build.less.*
+build.max.*
+build.please.*
+builders.dsl.*
+burlap.*
+buzz.getcoco.*
+by.bone.*
+by.exonit.*
+by.exonit.redmine.client.*
+by.gdev.*
+by.legan.exiton.ExtraPasswordSwith.*
+by.legan.library.*
+by.next-way.*
+by.salin.*
+by.shostko.*
+by.skz.*
+by.stub.*
+bz.tsung.android.*
+bz.turtle.*
+c10n.*
+c3p0.*
+ca.aaronlevin.*
+ca.appsimulations.*
+ca.aqtech.*
+ca.badalsarkar.*
+ca.barrenechea.header-decor.*
+ca.bbd.*
+ca.bc.gov.open.cpf.*
+ca.bc.gov.open.cpf.plugins.*
+ca.bc.gov.tno.*
+ca.bcit.KaJiN.*
+ca.bitcoco.*
+ca.blarg.*
+ca.braunit.weatherparser.*
+ca.bwbecker.*
+ca.carleton.gcrc.*
+ca.cellularautomata.*
+ca.clinia.elasticsearch.plugin.*
+ca.coglinc.*
+ca.dataedu.*
+ca.denisab85.*
+ca.derekcormier.recipe.*
+ca.dsolutions.*
+ca.dvgi.*
+ca.eandb.jdcp.*
+ca.eandb.jmist.*
+ca.eandb.util.*
+ca.exprofesso.*
+ca.fuzzlesoft.*
+ca.gc.cyber.ops.*
+ca.gc.tbs-sct.wet-boew.*
+ca.genovese.*
+ca.gobits.bnf.*
+ca.gosyer.*
+ca.grimoire.*
+ca.grimoire.jnoise.*
+ca.grimoire.jsp.*
+ca.grimoire.maven.*
+ca.grimoire.postgresql.*
+ca.grimoire.spring.*
+ca.ibodrov.concord.*
+ca.ibodrov.concord.maven.*
+ca.innovativemedicine.*
+ca.islandora.*
+ca.islandora.alpaca.*
+ca.islandora.component.*
+ca.islandora.indexing.*
+ca.islandora.sync.*
+ca.isupeene.*
+ca.jeb.*
+ca.jimr.*
+ca.johnhorman.maven.*
+ca.juliusdavies.*
+ca.krasnay.*
+ca.ma99us.*
+ca.mcgill.sable.*
+ca.mcscert.jtet.*
+ca.mestevens.ios.*
+ca.mestevens.java.*
+ca.mestevens.unity.*
+ca.mrvisser.*
+ca.nanometrics.*
+ca.nanometrics.maven.plugins.*
+ca.nexapp.*
+ca.odell.*
+ca.omny.*
+ca.oson.json.*
+ca.pgon.*
+ca.pjer.*
+ca.qc.ircm.*
+ca.radiant3.*
+ca.rbon.*
+ca.redtoad.*
+ca.rmen.*
+ca.ryangreen.*
+ca.schwitzer.*
+ca.seinesoftware.*
+ca.sm360.cronitor.*
+ca.snappay.*
+ca.solo-studios.*
+ca.stellardrift.*
+ca.stellardrift.guice-backport.*
+ca.stellardrift.guice-backport.extensions.*
+ca.sukhsingh.actions.*
+ca.svarb.*
+ca.szc.configparser.*
+ca.szc.groovy.pnc.*
+ca.szc.maven.*
+ca.szc.thirdparty.nl.jworks.markdown_to_asciidoc.*
+ca.ucalgary.ispia.*
+ca.uhn.hapi.*
+ca.uhn.hapi.example.*
+ca.uhn.hapi.fhir.*
+ca.uhn.hapi.fhir.karaf.*
+ca.uhn.ws.*
+ca.uhnresearch.pughlab.*
+ca.umontreal.iro.*
+ca.umontreal.iro.simul.*
+ca.uwaterloo.*
+ca.vanzyl.*
+ca.vanzyl.concord.*
+ca.vanzyl.concord.ck8s.*
+ca.vanzyl.concord.plugins.*
+ca.vanzyl.concord.terraform.*
+ca.vanzyl.maven.plugins.*
+ca.vanzyl.provisio.maven.plugins.*
+ca.vanzyl.sigstore.maven.*
+ca.voidstarzero.*
+ca.weblite.*
+ca.wheatstalk.*
+cactus.*
+cafe.adriel.bonsai.*
+cafe.adriel.lyricist.*
+cafe.adriel.voyager.*
+cafe.cryptography.*
+cam.narzt.getargv.*
+camp.xit.google.*
+camp.xit.jacod.*
+capital.scalable.*
+capital.sharpe.*
+care.better.platform.*
+care.better.schema.*
+cargo.*
+cas.*
+casa.alexey.*
+cash.atto.*
+cash.bitcoinj.*
+cash.muro.*
+cash.z.ecc.android.*
+castor.*
+cat.albirar.*
+cat.albirar.lib.*
+cat.albirar.telegram.bots.*
+cat.champel.*
+cat.dvmlls.*
+cat.ereza.*
+cat.inspiracio.*
+cat.ppicas.customtypeface.*
+cat.rokubun.core.*
+cat.rokubun.jason.*
+cat.rokubun.wals.*
+cc.abstra.pasilla.*
+cc.agentx.*
+cc.aicode.java.e2e.*
+cc.akkaha.*
+cc.apopo.*
+cc.bable.*
+cc.bitlib.*
+cc.block.*
+cc.block.data.*
+cc.blynk.clickhouse.*
+cc.carm.lib.*
+cc.carm.plugin.*
+cc.catalysts.*
+cc.catalysts.boot.*
+cc.catalysts.gradle.*
+cc.catalysts.structurizr.*
+cc.cc4414.*
+cc.ccoke.*
+cc.cfig.*
+cc.co.scala-reactive.*
+cc.concurrent.*
+cc.corentin.util.*
+cc.corly.*
+cc.ddrpa.*
+cc.ddrpa.security.*
+cc.dot.*
+cc.drx.*
+cc.duduhuo.*
+cc.duduhuo.util.*
+cc.eamon.*
+cc.eamon.open.*
+cc.ecore.*
+cc.factorie.*
+cc.fanlei.*
+cc.flightdeck.*
+cc.fozone.*
+cc.fozone.struts2.*
+cc.fozone.validation.*
+cc.freiberg.*
+cc.gasches.archetypes.*
+cc.gospy.*
+cc.holylcd.*
+cc.ichangan.*
+cc.ikai.tool.*
+cc.iliz.mybatis.shading.*
+cc.imorning.*
+cc.ivory.*
+cc.javaone.jpa.*
+cc.jilt.*
+cc.jinglupeng.*
+cc.jinhx.*
+cc.jooylife.*
+cc.jstr.*
+cc.jweb.*
+cc.kave.*
+cc.kave.repackaged.*
+cc.kebei.*
+cc.kebei.onion.*
+cc.kevinlu.*
+cc.kkon.*
+cc.liloo.*
+cc.luckyzerg.calculator.*
+cc.mallet.*
+cc.mashroom.*
+cc.mashroom.squirrel.*
+cc.minotaur.*
+cc.nabi.web.*
+cc.neckbeard.*
+cc.niushuai.project.*
+cc.openkit.*
+cc.owoo.*
+cc.plural.*
+cc.popkorn.*
+cc.pptshow.*
+cc.protea.auntbertha.*
+cc.protea.crmtext.*
+cc.protea.foundation.*
+cc.protea.foundation.http.*
+cc.protea.guidestar.*
+cc.protea.helloShim.*
+cc.protea.platform.*
+cc.protea.spreedly.*
+cc.rabbitcontrol.*
+cc.rankey.*
+cc.rbbl.*
+cc.rbbl.game-of-life.*
+cc.rbbl.gitlab-ci-kotlin-dsl-extensions.*
+cc.redberry.*
+cc.redpen.*
+cc.regolo.*
+cc.renken.*
+cc.ricecx.*
+cc.roden.*
+cc.scrambledbytes.sse.*
+cc.seeed.sensecap-sdk.*
+cc.shacocloud.*
+cc.shacocloud.octopus.*
+cc.simpleframework.*
+cc.siyecao.fastdfs.*
+cc.siyecao.mapper.*
+cc.siyecao.uid.*
+cc.smartcash.smartcashj.*
+cc.sofast.infrastructure.*
+cc.spray.*
+cc.spray.can.*
+cc.spray.json.*
+cc.springworks.*
+cc.stacks.*
+cc.taylorzhang.*
+cc.tracyzhang.*
+cc.twittertools.*
+cc.uncarbon.framework.*
+cc.vihackerframework.*
+cc.vileda.*
+cc.vileda.kalfor.*
+cc.voox.*
+cc.wanforme.*
+cc.wanforme.nukkit.*
+cc.wecando.*
+cc.wikitools.*
+cc.youchain.*
+cc.zenfery.*
+cc.zstart.*
+cc.zuv.*
+cd.connect.common.*
+cd.connect.composites.java.*
+cd.connect.features.*
+cd.connect.jersey.*
+cd.connect.jetty.*
+cd.connect.maven.*
+cd.connect.openapi.*
+cd.connect.openapi.gensupport.*
+cd.connect.pipeline.*
+cd.connect.plugins.*
+cd.connect.servlet.*
+cd.connect.third_party.*
+cd.connect.tiles.*
+cd.go.groovydsl.*
+cd.go.jrepresenter.*
+cd.go.plugin.*
+cd.go.plugin.base.*
+center.wxp.*
+cewolf.*
+cf.bautroixa.firestoreodm.*
+cf.janga.*
+cf.janga.knit.*
+cf.roooster.*
+cf.srxl.*
+cf.ystapi.*
+cglib.*
+ch.314.*
+ch.aaap.*
+ch.abertschi.*
+ch.abertschi.arquillian.*
+ch.abertschi.sct.*
+ch.abertschi.sct.arquillian.*
+ch.abertschi.unserialize.*
+ch.acanda.maven.*
+ch.acmesoftware.*
+ch.acra.*
+ch.admin.bag.covidcertificate.*
+ch.admin.geo.openswissmaps.*
+ch.agent.*
+ch.aonyx.broker.ib.*
+ch.approppo.*
+ch.artecat.grengine.*
+ch.artecat.jexler.*
+ch.ascendise.validator.*
+ch.astorm.*
+ch.awae.*
+ch.baurs.*
+ch.bbv.fsm.*
+ch.becompany.*
+ch.bfh.due1.*
+ch.bfh.unicrypt.*
+ch.bildspur.*
+ch.bind.*
+ch.brickwork.bsetl.*
+ch.brix.camunda.connector.*
+ch.carve.*
+ch.cern.*
+ch.cern.dirq.*
+ch.cern.dirq.test.*
+ch.cern.eam.*
+ch.cern.hadoop.*
+ch.cern.hbase.*
+ch.cern.hbase.connectors.*
+ch.cern.hbase.connectors.kafka.*
+ch.cern.hbase.connectors.spark.*
+ch.cern.hbase.thirdparty.*
+ch.cern.spark.*
+ch.cern.sparkmeasure.*
+ch.cmbntr.*
+ch.codeblock.qrinvoice.*
+ch.codeblock.qrinvoice.boofcv.*
+ch.codeblock.qrinvoice.bulk.*
+ch.codeblock.qrinvoice.core.*
+ch.codeblock.qrinvoice.documents.*
+ch.codeblock.qrinvoice.itext5.*
+ch.codeblock.qrinvoice.openpdf.*
+ch.codeblock.qrinvoice.pdfbox.*
+ch.codeblock.qrinvoice.rest.*
+ch.codeblock.qrinvoice.tests.*
+ch.codeflair.bynder-aem.*
+ch.confinale.*
+ch.cordsen.*
+ch.crearex.*
+ch.datascience.*
+ch.difty.kris.*
+ch.digitalfondue.basicxlsx.*
+ch.digitalfondue.dbtojson.*
+ch.digitalfondue.jfiveparse.*
+ch.digitalfondue.jscover.*
+ch.digitalfondue.liquibaseorausertable.*
+ch.digitalfondue.ni-http-suite.*
+ch.digitalfondue.npjt-extra.*
+ch.digitalfondue.stampo.*
+ch.digitalfondue.synckv.*
+ch.digitalfondue.vatchecker.*
+ch.dissem.jabit.*
+ch.dissem.msgpack.*
+ch.dkitc.*
+ch.docksnet.*
+ch.docksnet.codegen.*
+ch.dreipol.*
+ch.dsivd.*
+ch.dsivd.copper.*
+ch.dsivd.jaxb-plugins.*
+ch.dvbern.oss.beanvalidation.*
+ch.dvbern.oss.cdifixtures.*
+ch.dvbern.oss.cdipersistence.*
+ch.dvbern.oss.cditest.*
+ch.dvbern.oss.cryptutil.*
+ch.dvbern.oss.datatypes.*
+ch.dvbern.oss.datehelper.*
+ch.dvbern.oss.doctemplate.*
+ch.dvbern.oss.excelmerger.*
+ch.dvbern.oss.healthcheck.gc.*
+ch.dvbern.oss.invoicegenerator.*
+ch.dvbern.oss.iso20022.*
+ch.dvbern.oss.junit-beanvalidation-extension.*
+ch.dvbern.oss.maven.*
+ch.dvbern.oss.maven.jgitflow.*
+ch.eitchnet.*
+ch.empros.*
+ch.empros.kmap.*
+ch.epfl.bbp.nlp.*
+ch.epfl.bluebrain.nexus.*
+ch.epfl.dedis.*
+ch.epfl.gsn.*
+ch.epfl.lamp.*
+ch.epfl.lara.*
+ch.epfl.leb.*
+ch.epfl.scala.*
+ch.epfl.tyqu.*
+ch.ergon.adam.*
+ch.ethz.acl.*
+ch.ethz.ganymed.*
+ch.ethz.globis.phtree.*
+ch.ethz.inf.vs.*
+ch.ethz.origo.*
+ch.exense.*
+ch.exense.commons.*
+ch.exense.rtm.*
+ch.exense.smb.*
+ch.exense.step-enterprise.examples.*
+ch.exense.step.*
+ch.exense.step.examples.*
+ch.exense.step.library.*
+ch.exense.viz.*
+ch.fortysix.*
+ch.fritteli.*
+ch.fritteli.a-maze-r.*
+ch.frostnova.*
+ch.galinet.*
+ch.galinet.reactive.plumber.*
+ch.galinet.xml.*
+ch.gbrain.*
+ch.ge.etat.ael.enu.*
+ch.ge.etat.securite.*
+ch.geowerkstatt.ilivalidator.extensions.functions.*
+ch.grengine.*
+ch.halarious.*
+ch.hevs.gdx2d.*
+ch.hevs.medgift.epad.plugins.*
+ch.hevs.medgift.epad.plugins.common.*
+ch.hortis.sonar.*
+ch.hotmilk.embrava.core.*
+ch.hsr.*
+ch.hsr.adv.*
+ch.hsr.mas.oms-financialanalyzer.*
+ch.icosys.*
+ch.ifocusit.*
+ch.ifocusit.livingdoc.*
+ch.imvs.*
+ch.inftec.*
+ch.inftec.flyway.*
+ch.inftec.ju.*
+ch.inftec.test.*
+ch.inss.joaswizard.*
+ch.inventsoft.akka.*
+ch.inventsoft.graph.*
+ch.islandsql.*
+ch.itds.taglib.*
+ch.iterate.openstack.*
+ch.j3t.*
+ch.jalu.*
+ch.javacamp.bot-detector.*
+ch.jodersky.*
+ch.jooel.*
+ch.kk7.*
+ch.leadrian.equalizer.*
+ch.leadrian.samp.kamp.*
+ch.leadrian.slf4k.*
+ch.leadrian.stubr.*
+ch.ledcom.*
+ch.ledcom.agent.jmx.*
+ch.ledcom.assertj-extensions.*
+ch.ledcom.maven.*
+ch.ledcom.tomcat.interceptors.*
+ch.ledcom.tomcat.valves.*
+ch.liip.aem.*
+ch.liquidmind.*
+ch.marcus-schulte.maven.*
+ch.maxant.*
+ch.megard.*
+ch.mfrey.jackson.*
+ch.mfrey.maven.plugin.*
+ch.mfrey.thymeleaf.extras.cache.*
+ch.mfrey.thymeleaf.extras.with.*
+ch.mimo.*
+ch.miranet.commons.*
+ch.miranet.rdfstructure.*
+ch.mobi.liima.client.*
+ch.mobi.maven.*
+ch.mobi.mobitor.*
+ch.mobi.mobitor.plugins.*
+ch.mobileid.mid-java-client.*
+ch.movinno.oss.*
+ch.nerdin.*
+ch.netcetera.eclipse.*
+ch.ninecode.cim.*
+ch.obermuhlner.*
+ch.odaceo.azure.*
+ch.olmero.*
+ch.open-health.*
+ch.pascalhanimann.simpletabcomplete.*
+ch.patchcode.*
+ch.pete.appconfig.*
+ch.petikoch.libs.*
+ch.phatec.*
+ch.pontius.nio.*
+ch.poole.*
+ch.poole.android.*
+ch.poole.geo.*
+ch.poole.geo.pmtiles-reader.*
+ch.poole.gradle.*
+ch.poole.misc.*
+ch.poole.osm.*
+ch.postfinance.*
+ch.poweredge.ntlmv2-auth.*
+ch.powerunit.*
+ch.powerunit.extensions.*
+ch.pricemeier.*
+ch.produs.*
+ch.puzzle.*
+ch.qarts.specalizr.*
+ch.qligier.*
+ch.qos.cal10n.*
+ch.qos.cal10n.plugins.*
+ch.qos.logback.*
+ch.qos.logback.contrib.*
+ch.qos.logback.db.*
+ch.qos.mistletoe.*
+ch.qos.reload4j.*
+ch.rabanti.*
+ch.racic.*
+ch.racic.selenium.*
+ch.racic.selenium.helper.*
+ch.racic.testing.*
+ch.raffael.gradlePlugins.antlr4.*
+ch.raffael.gradlePlugins.preshadow.*
+ch.raffael.markdown-doclet.*
+ch.raffael.meldioc.*
+ch.raffael.pegdown-doclet.*
+ch.ralscha.*
+ch.randelshofer.*
+ch.rasc.*
+ch.rasc.hibppasswords.*
+ch.regdata.rps.engine.client.*
+ch.repnik.quartz-retry.*
+ch.rfin.java-util.*
+ch.rhj.*
+ch.rhj.java.*
+ch.rhj.junit.*
+ch.ringler.tools.*
+ch.rolandschaer.ascrblr.*
+ch.rotscher.*
+ch.rotscher.flyway.*
+ch.rotscher.maven.core.*
+ch.rotscher.maven.plugins.*
+ch.rts.*
+ch.sahits.*
+ch.sahits.game.*
+ch.sbb.*
+ch.sbb.maven.archetypes.*
+ch.sbb.maven.plugins.*
+ch.sbb.mobile.ml.*
+ch.sbb.releasetrain.*
+ch.sbb.scion.*
+ch.sbs.*
+ch.sbs.pipeline.*
+ch.sbs.preptools.*
+ch.schlagundrahm.swat.datapower.*
+ch.schlagundrahm.swat.datapower.tools.ant.*
+ch.schlau.pesche.*
+ch.schlau.pesche.syringe.*
+ch.semafor.*
+ch.sf.htt.*
+ch.shamu.*
+ch.sharedvd.jaxb-plugins.*
+ch.sharedvd.tipi.*
+ch.sidorenko.scoverage.*
+ch.simas.*
+ch.simas.camel.*
+ch.simas.monitor.*
+ch.simas.qlrm.*
+ch.simas.sqlresultmapper.*
+ch.simschla.*
+ch.softappeal.yass.*
+ch.softappeal.yass2.*
+ch.software-atelier.*
+ch.sourcemotion.vertx.*
+ch.sourcepond.*
+ch.sourcepond.commons.*
+ch.sourcepond.io.*
+ch.sourcepond.jdbc.*
+ch.sourcepond.maven.plugins.*
+ch.sourcepond.osgi.cmpn.*
+ch.sourcepond.spring.*
+ch.sourcepond.testing.*
+ch.sourcepond.utils.*
+ch.squaredesk.nova.*
+ch.srf.*
+ch.stangenberg.*
+ch.stegmaier.java2tex.*
+ch.streamly.*
+ch.swaechter.*
+ch.swissbilling.*
+ch.tatool.*
+ch.tbmelabs.*
+ch.teleboy.*
+ch.temparus.advancedrecyclerview.*
+ch.temparus.android.*
+ch.temparus.colorpicker.*
+ch.threema.*
+ch.timo-schmid.*
+ch.trick17.better-checks.*
+ch.tutteli.atrium.*
+ch.tutteli.kbox.*
+ch.tutteli.niok.*
+ch.tutteli.spek.*
+ch.tutti.android.applover.*
+ch.tutti.android.bottomsheet.*
+ch.tutti.gradle.android.svg.*
+ch.ubique.android.*
+ch.ubique.gradle.*
+ch.ubique.openapi.*
+ch.umb.curo.*
+ch.unibas.cs.gravis.*
+ch.usi.si.codelounge.*
+ch.usi.si.seart.*
+ch.uzh.ifi.ddis.*
+ch.uzh.ifi.ddis.hadoop.*
+ch.uzh.ifi.ddis.ifp.*
+ch.uzh.ifi.ddis.ifp.esper.*
+ch.veehait.devicecheck.*
+ch.venky.redfort.*
+ch.viascom.*
+ch.viascom.groundwork.*
+ch.viseon.*
+ch.viseon.openOrca.*
+ch.viseon.openOrca.server.*
+ch.viseon.threejs.*
+ch.vorburger.*
+ch.vorburger.exec.*
+ch.vorburger.mariaDB4j.*
+ch.vorburger.minecraft.osgi.*
+ch.voulgarakis.*
+ch.wavein.*
+ch.weetech.*
+ch.welld.kie.*
+ch.x28.inscriptis.*
+ch.zizka.csvcruncher.*
+ch.zizka.junitdiff.*
+ch.zzeekk.spark.*
+charlotte.*
+chat.belinked.*
+chat.dim.*
+chat.sdk.*
+chat.tamtam.*
+checkstyle.*
+church.i18n.*
+city.smartb.cccev.*
+city.smartb.d2.*
+city.smartb.f2.*
+city.smartb.fixers.gradle.*
+city.smartb.fixers.gradle.config.*
+city.smartb.fixers.gradle.d2.*
+city.smartb.fixers.gradle.dependencies.*
+city.smartb.fixers.gradle.kotlin.jvm.*
+city.smartb.fixers.gradle.kotlin.mpp.*
+city.smartb.fixers.gradle.publish.*
+city.smartb.fixers.gradle.sonar.*
+city.smartb.fs.*
+city.smartb.geo.*
+city.smartb.i2.*
+city.smartb.im.*
+city.smartb.iris.*
+city.smartb.s2.*
+city.smartb.ssm.*
+cl.alma.camel.acs.*
+cl.daplay.*
+cl.hambreysed.supertools.*
+cl.magnet.magnetrestclient.*
+cl.symbiose.*
+cl.yaykuy.*
+classworlds.*
+click.webelement.*
+clickstream.*
+clirr.*
+cloud.acog.*
+cloud.agileframework.*
+cloud.aispring.*
+cloud.altemista.fwk.altemista.*
+cloud.altemista.fwk.amazon.*
+cloud.altemista.fwk.archetype.*
+cloud.altemista.fwk.async.*
+cloud.altemista.fwk.azure.*
+cloud.altemista.fwk.batch.*
+cloud.altemista.fwk.cache.*
+cloud.altemista.fwk.connection.*
+cloud.altemista.fwk.cryptography.*
+cloud.altemista.fwk.docker.*
+cloud.altemista.fwk.framework.*
+cloud.altemista.fwk.integration.*
+cloud.altemista.fwk.jwt.*
+cloud.altemista.fwk.mail.*
+cloud.altemista.fwk.message.*
+cloud.altemista.fwk.microservices.*
+cloud.altemista.fwk.monitoring.*
+cloud.altemista.fwk.oauth2.*
+cloud.altemista.fwk.performance.*
+cloud.altemista.fwk.persistence.*
+cloud.altemista.fwk.reporting.*
+cloud.altemista.fwk.rest.*
+cloud.altemista.fwk.rules.*
+cloud.altemista.fwk.security.*
+cloud.altemista.fwk.soap.*
+cloud.altemista.fwk.stream.*
+cloud.altemista.fwk.swagger.*
+cloud.altemista.fwk.thymeleaf.*
+cloud.altemista.fwk.webapp.modules.*
+cloud.altemista.fwk.workflow.*
+cloud.appstack.*
+cloud.artik.*
+cloud.caroline.*
+cloud.cirrusup.*
+cloud.codestore.*
+cloud.commandframework.*
+cloud.configs.*
+cloud.djet.codegen.*
+cloud.djet.spring.*
+cloud.dnation.integration.*
+cloud.drakon.*
+cloud.elit.*
+cloud.eppo.*
+cloud.filibuster.*
+cloud.genesys.*
+cloud.gouyiba.*
+cloud.hedou.*
+cloud.ilum.*
+cloud.iswift.framework.*
+cloud.jgo.*
+cloud.kwrobot.*
+cloud.latitude.*
+cloud.localstack.*
+cloud.longfa.*
+cloud.mburger.*
+cloud.mburger.mb_android_kt.*
+cloud.metaapi.sdk.*
+cloud.mgl.spring.boot.*
+cloud.mindbox.*
+cloud.mofayun.*
+cloud.nimburst.*
+cloud.nxt-mobility.*
+cloud.orbit.*
+cloud.pace.*
+cloud.pangea.*
+cloud.pianola.*
+cloud.piranha.*
+cloud.piranha.admin.*
+cloud.piranha.appserver.*
+cloud.piranha.arquillian.*
+cloud.piranha.cdi.*
+cloud.piranha.classloader.*
+cloud.piranha.core.*
+cloud.piranha.database.*
+cloud.piranha.dist.*
+cloud.piranha.extension.*
+cloud.piranha.faces.*
+cloud.piranha.feature.*
+cloud.piranha.http.*
+cloud.piranha.jndi.*
+cloud.piranha.maven.*
+cloud.piranha.maven.archetypes.*
+cloud.piranha.maven.plugins.*
+cloud.piranha.micro.*
+cloud.piranha.micro.shrinkwrap.*
+cloud.piranha.microprofile.*
+cloud.piranha.microprofile.omnifaces.*
+cloud.piranha.microprofile.smallrye.*
+cloud.piranha.modular.*
+cloud.piranha.monitor.*
+cloud.piranha.naming.*
+cloud.piranha.pages.*
+cloud.piranha.policy.*
+cloud.piranha.resource.*
+cloud.piranha.rest.*
+cloud.piranha.security.*
+cloud.piranha.server.*
+cloud.piranha.servlet.*
+cloud.piranha.session.*
+cloud.piranha.spring.*
+cloud.piranha.transaction.*
+cloud.piranha.upload.*
+cloud.piranha.war.*
+cloud.piranha.webapp.*
+cloud.playio.*
+cloud.playio.gradle.antora.*
+cloud.playio.gradle.codegen.*
+cloud.playio.gradle.docgen.*
+cloud.playio.gradle.oss.*
+cloud.playio.gradle.pandoc.*
+cloud.playio.gradle.qwe.app.*
+cloud.playio.gradle.qwe.docker.*
+cloud.playio.gradle.root.*
+cloud.pluses.*
+cloud.prefab.*
+cloud.proxi.*
+cloud.proxi.sdk.*
+cloud.proxi.sdkv3.*
+cloud.quasarch.*
+cloud.rio.*
+cloud.seltzer1717.clojure.*
+cloud.syrobin.*
+cloud.testload.*
+cloud.tianai.captcha.*
+cloud.tianai.crypto.*
+cloud.tianai.csv.*
+cloud.tianai.rpc.*
+cloud.tianai.rpc.register.*
+cloud.tianai.rpc.remoting.*
+cloud.tianai.rpc.remoting.codec.*
+cloud.topcode.open.*
+cloud.ttdys.mbg.*
+cloud.unionj.*
+cloud.weiniu.*
+clover.*
+club.bigtian.*
+club.callmee.*
+club.chlab.*
+club.codefocus.framework.*
+club.easy-utils.*
+club.gclmit.*
+club.gclmit.codes.*
+club.i-show.*
+club.javacore.*
+club.javafamily.*
+club.kingyin.*
+club.lemos.*
+club.minnced.*
+club.moonlink.*
+club.mrxiao.*
+club.mydlq.*
+club.pizzalord.*
+club.psychose.*
+club.rippl.*
+club.skilldevs.utils.*
+club.spreadme.*
+club.sword13.art.*
+club.tempvs.*
+club.tilitili.*
+club.trandiscuss.*
+club.ximeng.huawei.*
+club.ximeng.util.*
+club.ximeng.webjars.*
+club.xtdf.node.tree.*
+club.zhcs.*
+cm.xd.*
+cn.123tool.chen.*
+cn.404z.*
+cn.4coder.*
+cn.51daxia.*
+cn.6tail.*
+cn.6xyun.android.*
+cn.94zichao.*
+cn.aaron911.*
+cn.ablxyw.*
+cn.ac.xxw.*
+cn.acey.integrate.*
+cn.acmsmu.mgsky1.*
+cn.acyou.*
+cn.adalab.*
+cn.aethli.*
+cn.afternode.mc.*
+cn.afterturn.*
+cn.aghost.*
+cn.ai-connect.*
+cn.ai-jia.log-gatherer.clients.*
+cn.aifei.*
+cn.airfei.air-core.*
+cn.akeparking.api.*
+cn.alapi.*
+cn.alien95.*
+cn.allbs.*
+cn.alphabets.light.*
+cn.alvince.droidprism.*
+cn.alvince.zanpakuto.*
+cn.amingg.boot.*
+cn.amorou.*
+cn.amorou.rest.crypto.*
+cn.amorou.uid.*
+cn.amossun.*
+cn.anguslean.*
+cn.anloo.*
+cn.antcore.*
+cn.aotcloud.*
+cn.apiclub.test.*
+cn.apiclub.third.*
+cn.apiclub.tool.*
+cn.appface.*
+cn.aradin.*
+cn.arnohand.*
+cn.arnohand.modules.*
+cn.asany.chaos.*
+cn.asens.*
+cn.assassinx.*
+cn.atcoder.*
+cn.atimer.*
+cn.atomicer.sikong.*
+cn.atomicer.skmq.*
+cn.atomicer.zephyr.*
+cn.atomtool.*
+cn.aurorastarry.*
+cn.authing.*
+cn.authok.*
+cn.autorepairehelper.*
+cn.autumnclouds.redis.*
+cn.baiweigang.*
+cn.bbahh.*
+cn.bctools.*
+cn.bee-cloud.*
+cn.beecloud.*
+cn.belier.*
+cn.belier.pay.*
+cn.benma666.*
+cn.berberman.*
+cn.bestwu.*
+cn.bestwu.apidoc.*
+cn.bestwu.autodoc.*
+cn.bestwu.generator.*
+cn.bestwu.gradle.*
+cn.bestwu.groovy-publish.*
+cn.bestwu.kotlin-publish.*
+cn.bestwu.plugin-publish.*
+cn.bestwu.profile.*
+cn.bestwu.publish.*
+cn.bestwu.simpleframework.*
+cn.bestwu.wechat.*
+cn.bigcore.*
+cn.bigmodel.openapi.*
+cn.bingerz.android.*
+cn.bingoogolapple.*
+cn.bingoogolapple.bgabanner.*
+cn.bingoogolapple.bgaindicator.*
+cn.bingoogolapple.bgamenu.*
+cn.bingoogolapple.loon.*
+cn.bit1024.android.maventest.*
+cn.bitfactory.*
+cn.bizvane.openapi.*
+cn.bjdd301.*
+cn.blankcat.catbot.*
+cn.bluech.android.*
+cn.blueisacat.*
+cn.bluemobi.dylan.*
+cn.boboweike.*
+cn.boommanpro.*
+cn.bootdu.plugin.*
+cn.bootx.*
+cn.bootx.platform.*
+cn.bosign.*
+cn.brainpoint.*
+cn.bridgeli.*
+cn.brk2outside.*
+cn.buk.api.wechat.*
+cn.buk.common.*
+cn.buli-home.*
+cn.bywei.*
+cn.caijava.*
+cn.canos.*
+cn.caohongliang.*
+cn.centychen.*
+cn.cenxt.*
+cn.cescforz.*
+cn.chahuyun.*
+cn.charlab.os.*
+cn.charoncloud.*
+cn.charoncloud.plugin.*
+cn.charoncloud.plugin.maven.*
+cn.charoncloud.plugins.*
+cn.chendahai.*
+cn.chenhuanming.*
+cn.chenjy.yums.*
+cn.chenlc.qcloud.sdk.*
+cn.chenlh.*
+cn.chenlichao.*
+cn.chenlichao.web.ssm.*
+cn.chenzw.excel.*
+cn.chenzw.mybatis.*
+cn.chenzw.sms.*
+cn.chenzw.sso.*
+cn.chenzw.swagger.*
+cn.chenzw.toolkit.*
+cn.chings.openapi.*
+cn.chiship.sdk.*
+cn.chitanda.*
+cn.cimoc.*
+cn.ciphermagic.*
+cn.cloudscope.*
+cn.cloudself.*
+cn.cnaworld.framework.*
+cn.cnscoo.*
+cn.cocook.*
+cn.cocowwy.*
+cn.codeforfun.*
+cn.codegg.*
+cn.codepandas.*
+cn.coder123.*
+cn.codest.*
+cn.coding520.*
+cn.codingguide.*
+cn.codingxxm.*
+cn.com.analysys.*
+cn.com.antcloud.api.*
+cn.com.binging.*
+cn.com.chinanews.*
+cn.com.chinarecrm.*
+cn.com.connext.msf.*
+cn.com.connext.msf.saas.*
+cn.com.dabby.idaas.*
+cn.com.dabby.idaas.ciam.*
+cn.com.fishin.*
+cn.com.infosec.*
+cn.com.itez.*
+cn.com.jeeweb.*
+cn.com.joycode.*
+cn.com.kingbase.*
+cn.com.louie.*
+cn.com.mooho.*
+cn.com.ogtwelve.*
+cn.com.onlinetool.*
+cn.com.openboot.*
+cn.com.pism.ezasse.*
+cn.com.pism.frc.*
+cn.com.pism.gfd.*
+cn.com.postrock.yaolib.*
+cn.com.riversoft.*
+cn.com.thinkit.cloud.*
+cn.com.twoke.*
+cn.com.vastdata.*
+cn.com.warlock.*
+cn.com.wdcapp.*
+cn.com.xuxiaowei.boot.*
+cn.com.xuxiaowei.boot.next.*
+cn.com.xuxiaowei.utils.*
+cn.com.zhaoweiping.*
+cn.com.zstars.*
+cn.conifercone.*
+cn.coufran.*
+cn.coufran.project.*
+cn.crabapples.*
+cn.craccd.*
+cn.crane4j.*
+cn.crazywalker.*
+cn.crowdos.*
+cn.crudapi.*
+cn.crushes.cloud.*
+cn.cxnei.*
+cn.cycode.datatranslate.*
+cn.cyejing.*
+cn.daenx.*
+cn.dailystudio.*
+cn.daimax.*
+cn.daimaxia.*
+cn.daiwenhao.*
+cn.dalgen.plugins.*
+cn.danielw.*
+cn.datastacks.*
+cn.db101.*
+cn.dceast.platform.*
+cn.deathdealer.*
+cn.deepbit.*
+cn.deepmax.*
+cn.denghanxi.*
+cn.detachment.*
+cn.dev-space.*
+cn.dev33.*
+cn.dev8.*
+cn.devit.maven.*
+cn.dgchong.maven.*
+cn.dhbin.*
+cn.dlihasa.easykits.*
+cn.dlihasa.xpay.*
+cn.dlysxx.www.common.*
+cn.doctech.*
+cn.donecro.*
+cn.dong144.mpgen.*
+cn.donting.*
+cn.dorck.android.*
+cn.dreampie.*
+cn.dreamtobe.filedownloader.*
+cn.dreamtobe.kpswitch.*
+cn.dreamtobe.messagehandler.*
+cn.dreamtobe.percentsmoothhandler.*
+cn.dreamtobe.threaddebugger.*
+cn.dubby.*
+cn.duskykite.open.*
+cn.dustlight.auth.*
+cn.dustlight.captcha.*
+cn.dustlight.datacenter.*
+cn.dustlight.flow.*
+cn.dustlight.fun.*
+cn.dustlight.jobless.*
+cn.dustlight.messenger.*
+cn.dustlight.storage.*
+cn.dustlight.storaging.*
+cn.dyaoming.common.*
+cn.dynamictp.*
+cn.easii.*
+cn.easy-es.*
+cn.easy4j.*
+cn.easylib.*
+cn.easyproject.*
+cn.easyutil.*
+cn.edu.fudan.dsm.*
+cn.edu.hfut.dmic.webcollector.*
+cn.edu.sjtu.omnilab.*
+cn.edu.tsinghua.*
+cn.elegent.security.*
+cn.ellabook.*
+cn.elwy.*
+cn.elwy.common.*
+cn.enaium.*
+cn.enaium.cafully.*
+cn.enilu.*
+cn.enilu.tools.*
+cn.enited.union.*
+cn.ennwifi.*
+cn.entertech.android.*
+cn.eonml.*
+cn.eova.*
+cn.eppdev.jee.*
+cn.eppdev.mlib.*
+cn.exces.*
+cn.ezbuild.*
+cn.ezeyc.*
+cn.fangxinqian.operator.sdk.*
+cn.fangxinqian.sdk.*
+cn.fantasticmao.mundo.*
+cn.fanzy.breeze.*
+cn.fanzy.minio.*
+cn.fanzy.plus.*
+cn.fastf.*
+cn.fastoo.*
+cn.fastposter.*
+cn.fastword.*
+cn.fatcarter.*
+cn.fatebug.cloud.*
+cn.featherfly.*
+cn.featherfly.authorities.*
+cn.featherfly.common.*
+cn.featherfly.configuration.*
+cn.featherfly.constant.*
+cn.featherfly.easyapi.*
+cn.featherfly.hammer.*
+cn.featherfly.juorm.*
+cn.featherfly.permission.*
+cn.feige.*
+cn.felord.*
+cn.felord.wepay.spring.boot.*
+cn.fenglingsoftware.*
+cn.fgstore.*
+cn.fightingguys.security.web.*
+cn.finalteam.rxgalleryfinal.*
+cn.fireround.*
+cn.flowboot.*
+cn.fly2think.*
+cn.flyelf.cache.*
+cn.flyzy2005.*
+cn.fntop.*
+cn.followtry.*
+cn.foofun.*
+cn.fornever.*
+cn.fox-tech.*
+cn.fraudmetrix.*
+cn.freelancy.sxtwl.*
+cn.fscode.common.*
+cn.fscode.commons.*
+cn.fsdev.*
+cn.funcoding.easyshare.*
+cn.funcoding.resources.*
+cn.fxbin.bubble.*
+cn.fxbin.swagger.*
+cn.fyupeng.*
+cn.gateside.*
+cn.gcsts.*
+cn.geektool.*
+cn.geminis.*
+cn.geminis.crypto.*
+cn.geminis.dependency.*
+cn.geminis.fabric.*
+cn.geminis.resources.*
+cn.gengar.*
+cn.gjing.*
+cn.gjsm.*
+cn.glwsq.kukuze.*
+cn.gmlee.tools.*
+cn.gnux.*
+cn.godmao.*
+cn.gongler.*
+cn.gudqs.*
+cn.guomw.cloud.*
+cn.guoxy.*
+cn.guoyukun.*
+cn.guoyukun.crack.*
+cn.guoyukun.jasst.*
+cn.guoyukun.mvn.*
+cn.guozhiyun.*
+cn.gybyt.*
+cn.handyplus.lib.*
+cn.handyplus.lib.attribute.*
+cn.handyplus.lib.mm.*
+cn.hangsman.*
+cn.hangsman.operatelog.*
+cn.hangsman.operationlog.*
+cn.hankchan.*
+cn.haoxiaoyong.email.*
+cn.haoxiaoyong.ocr.*
+cn.haoxiaoyong.ocr.email.*
+cn.haoxiaoyong.oss.*
+cn.haoxiaoyong.personal.seal.*
+cn.happyloves.*
+cn.har01d.*
+cn.har01d.tool.*
+cn.harveychan.*
+cn.hashdog.*
+cn.hchub.*
+cn.hdinson.bling.*
+cn.hebidu.mq.*
+cn.hejinyo.nacos.*
+cn.hermesdi.*
+cn.herodotus.engine.*
+cn.herodotus.oss.*
+cn.hhchat.*
+cn.hiboot.mcn.*
+cn.hikyson.godeye.*
+cn.hikyson.rocket.*
+cn.hill4j.rpcext.*
+cn.hill4j.tool.*
+cn.hippo4j.*
+cn.hippox.*
+cn.hiroz.*
+cn.hll520.linclient.*
+cn.hll520.linling.*
+cn.hollycloud.*
+cn.home1.*
+cn.home1.log-config.*
+cn.home1.tools.*
+cn.howardliu.*
+cn.howaric.cache.*
+cn.hperfect.*
+cn.hserver.*
+cn.hssnow.*
+cn.huangdayu.*
+cn.huangxulin.*
+cn.huazai.tool.*
+cn.huermao.*
+cn.humingfeng.*
+cn.huolala.*
+cn.huolala.glog.android.*
+cn.huolala.therouter.*
+cn.hutool.*
+cn.hydrz.*
+cn.hyperchain.*
+cn.hyperchain.javasdk.*
+cn.ibaijia.*
+cn.ibizlab.plugin.*
+cn.icanci.*
+cn.icanci.loopstack.rec.*
+cn.icotools.*
+cn.icuter.*
+cn.idea360.*
+cn.ideabuffer.*
+cn.idugou.bizlog.*
+cn.iguodou.*
+cn.ihomeland.slides.*
+cn.iisme.*
+cn.iisme.cloud.*
+cn.iliubang.*
+cn.imaq.*
+cn.imkarl.*
+cn.infop.*
+cn.infrabase.*
+cn.intelvision.*
+cn.inusha.*
+cn.iofan.*
+cn.iosd.*
+cn.iotwasu.*
+cn.ipfs-files.*
+cn.ipokerface.*
+cn.iq99.*
+cn.ironblog.*
+cn.is4j.insp.*
+cn.isqing.icloud.*
+cn.isuyu.boot.*
+cn.isuyu.face.h5.chk.*
+cn.itlym.*
+cn.itlym.shoulder.*
+cn.itoak.*
+cn.itpiggy.*
+cn.itwoods.*
+cn.ivan95.me.*
+cn.izern.*
+cn.j4ger.*
+cn.jadenziv.source.*
+cn.jairdavis.*
+cn.jants.*
+cn.jarkata.*
+cn.jasonone.*
+cn.jasonone.autotable.*
+cn.jasonone.him.*
+cn.jasonone.jame.*
+cn.jasonone.jfx.*
+cn.jasonone.ognl.*
+cn.jasonone.ueditor.*
+cn.java-union.*
+cn.javabird.*
+cn.javaboot.*
+cn.javaer.*
+cn.javaer.aliyun.*
+cn.javaer.jany.*
+cn.javaer.springfox.*
+cn.javaer.wechat.*
+cn.javaex.*
+cn.javaf.*
+cn.javaf.cq.*
+cn.javainterview.*
+cn.javasalon.*
+cn.jbone.*
+cn.jdevelops.*
+cn.jeeweb.*
+cn.jesims.*
+cn.jetclouds.*
+cn.jexxs.*
+cn.jexxs.boot.*
+cn.jexxs.boot.plugin.*
+cn.jhc.*
+cn.jiaminzhu.commons.*
+cn.jiangzeyin.*
+cn.jiangzeyin.fast-boot.*
+cn.jiangzeyin.security.*
+cn.jianwoo.openai.*
+cn.jianwoo.openai.auth.*
+cn.jiguang.*
+cn.jiguang.sdk.*
+cn.jiguang.sdk.ad.*
+cn.jiguang.sdk.ad.adapter.*
+cn.jiguang.sdk.ad.third.*
+cn.jiguang.sdk.engagelab.*
+cn.jiguang.sdk.plugin.*
+cn.jiiiiiin.*
+cn.jijl.util.*
+cn.jimmiez.*
+cn.jimmyshi.*
+cn.jimoos.*
+cn.jlnaisi.*
+cn.jmicro.*
+cn.jmonitor.*
+cn.jonay.*
+cn.jorianye.common.*
+cn.joylau.code.*
+cn.jpush.api.*
+cn.jque.*
+cn.js.icode.*
+cn.juantu.vip.*
+cn.jzvd.*
+cn.jzvd.scc.*
+cn.kanejin.adbox.*
+cn.kanejin.commons.*
+cn.kanejin.exts.*
+cn.kanejin.olla.*
+cn.kanejin.textslider.*
+cn.kanejin.view.*
+cn.kanejin.webop.*
+cn.katool.*
+cn.kduck.*
+cn.keayuan.*
+cn.keepbx.jpom-plugin.*
+cn.keepbx.jpom.*
+cn.keking.*
+cn.keking.project.*
+cn.kerrysmec.mpaas.*
+cn.kevinkda.*
+cn.kevinkda.core.*
+cn.knero.*
+cn.kongnannan.*
+cn.kstry.framework.*
+cn.kubeclub.*
+cn.kv-design.*
+cn.kxlove.*
+cn.labzen.*
+cn.lalaframework.*
+cn.lampup.*
+cn.langpy.*
+cn.lanink.*
+cn.lanxin.*
+cn.lazytool.*
+cn.lead2success.util.*
+cn.leancloud.*
+cn.leancloud.android.*
+cn.leancloud.play.*
+cn.legendshop.*
+cn.lesper.*
+cn.letcode.*
+cn.letspay.*
+cn.leyekeji.*
+cn.lgk0.*
+cn.lhemi.*
+cn.liangyuen.*
+cn.liberfree.*
+cn.licoy.*
+cn.lilq.*
+cn.lilq.smilodon.*
+cn.lindianyu.*
+cn.lingyangwl.framework.*
+cn.linham.*
+cn.linjpxc.*
+cn.linkey.*
+cn.lioyan.*
+cn.lishaoshuai.*
+cn.lishiyuan.*
+cn.liujunjiang.*
+cn.liushilei.*
+cn.ljserver.tool.*
+cn.llzero.*
+cn.lnkdoc.sdk.*
+cn.locusc.*
+cn.lonecloud.*
+cn.lonelysnow.*
+cn.lonnrot.*
+cn.loveswift.*
+cn.luckyee.dubbo.*
+cn.luern0313.lson.*
+cn.luway.*
+cn.lzgabel.converter.*
+cn.lzgabel.jaxb.*
+cn.lzgabel.jaxb.jaxb.*
+cn.lzgabel.jaxb.xml.bind.*
+cn.lzgabel.jaxb.xml.bind.external.*
+cn.lzgabel.jaxb.xml.bind.mvn.*
+cn.lzgabel.layouter.*
+cn.lzxz1234.weixin.*
+cn.m1c.lannie.*
+cn.m9d2.chatgpt.*
+cn.magichand.*
+cn.magichand.plugin.*
+cn.majingjing.*
+cn.majingjing.tm.blog.*
+cn.mangowork.*
+cn.mapway.*
+cn.mapway.gwt.*
+cn.meddb.*
+cn.microanswer.*
+cn.miludeer.*
+cn.mindstack.*
+cn.mingfer.*
+cn.miniants.*
+cn.minsin.*
+cn.minsin.core.*
+cn.minsin.excel.*
+cn.minsin.feign.*
+cn.minsin.version.*
+cn.miw.*
+cn.mklaus.tools.*
+cn.moltres.component_bus.*
+cn.monitor4all.*
+cn.montaro.*
+cn.moongoddess.*
+cn.morethank.*
+cn.mpy634.*
+cn.mrcode.mycat.*
+cn.mrcode.tool.*
+cn.mricefox.glog.android.*
+cn.msuno.*
+cn.mucute.*
+cn.muzin.*
+cn.myafx.*
+cn.mybatisboost.*
+cn.mythoi.*
+cn.myzju.mock.*
+cn.mzhong.*
+cn.naturemix.*
+cn.navclub.*
+cn.navigational.*
+cn.neday.sisyphus.*
+cn.net.clink.*
+cn.net.ds.*
+cn.net.mugui.*
+cn.net.rjnetwork.*
+cn.net.sichen.*
+cn.net.smartone.*
+cn.net.vidyo.*
+cn.netbuffer.*
+cn.networklab.*
+cn.newxnet.plugins.*
+cn.nexthuman.open.*
+cn.nextop.*
+cn.nikeo.jar-transformer.*
+cn.nikeo.jsonBuilder.*
+cn.nikeo.permisos.*
+cn.nikeo.phrase.*
+cn.nikeo.reparatur.*
+cn.niuable.*
+cn.nkpro.elcube.*
+cn.northsun.*
+cn.northsun.base.*
+cn.northsun.constant.*
+cn.northsun.parent.*
+cn.nothinghere.*
+cn.novelweb.*
+cn.numeron.*
+cn.nxtools.*
+cn.ocoop.framework.*
+cn.ocoop.framework.mybatis.plugin.*
+cn.ocoop.framework.sql.*
+cn.oever.*
+cn.okcoming.*
+cn.omisheep.*
+cn.omisheep.au.*
+cn.onekit.*
+cn.onekit.x2x.cloud.*
+cn.oneplustow.*
+cn.openapis.*
+cn.opencodes.*
+cn.opom.*
+cn.org.awcp.*
+cn.org.codecrafters.*
+cn.org.dianjiu.*
+cn.org.faster.*
+cn.org.hentai.*
+cn.org.jcloud.*
+cn.org.jkas.*
+cn.org.mediaedit.*
+cn.org.merlin.*
+cn.org.my-blockchain.client.*
+cn.org.opendfl.*
+cn.org.rapid.*
+cn.org.thinkcloud.*
+cn.org.thinkcloud.quickstart.*
+cn.org.wangchangjiu.*
+cn.org.zeronote.*
+cn.org.zhixiang.*
+cn.p00q.choice.*
+cn.p00q.dblogin.*
+cn.pa4j.*
+cn.patterncat.*
+cn.paxos.rabbitsnail.*
+cn.payingcloud.*
+cn.payingcloud.util.*
+cn.payingcloud.weixin.*
+cn.pedant.safewebviewbridge.*
+cn.pedant.sweetalert.*
+cn.pengh.pbase.*
+cn.pinusdb.jdbc.*
+cn.pivoto.jdk.*
+cn.pivoto.polaris.*
+cn.pivoto.polaris.toolkit.*
+cn.playalot.*
+cn.playscala.*
+cn.pomit.*
+cn.ponfee.*
+cn.port2.meetingsdk.*
+cn.powernukkitx.*
+cn.ppps.andserver.*
+cn.praysoul.ybutil.*
+cn.ps1.*
+cn.psoho.*
+cn.q-game.*
+cn.qhplus.emo.*
+cn.qianyanglong.sdk.*
+cn.qingin.*
+cn.qlfbbs.its.*
+cn.qmso.*
+cn.qqhxj.*
+cn.qqhxj.common.*
+cn.qqhxj.rxtx.*
+cn.quinnchen.hunter.*
+cn.raddev.*
+cn.ransj.rn.*
+cn.refacter.*
+cn.regionsoft.*
+cn.reinforce.plugin.*
+cn.renlm.plugins.*
+cn.renyuzhuo.rautoupdate.*
+cn.renyuzhuo.rjson.*
+cn.renyuzhuo.rlib.*
+cn.renyuzhuo.rlog.*
+cn.rhymed.common.*
+cn.richinfo.agent.android.*
+cn.riris.*
+cn.rivers100.*
+cn.rongcloud.im.*
+cn.rongcloud.private.sdk.*
+cn.rongcloud.sdk.*
+cn.rongcloud.sdk.push.*
+cn.rpamis.*
+cn.ruleengine.*
+cn.ryoii.*
+cn.safekeeper.*
+cn.saliey.moduleone.*
+cn.samehope.*
+cn.sanchar.excel.*
+cn.sanenen.*
+cn.sayjava.*
+cn.scbsi.*
+cn.schoolwow.*
+cn.sexycode.*
+cn.sh.cares.*
+cn.sh.ideal.*
+cn.shanyaliux.*
+cn.shanyaliux.serialport.*
+cn.shazhengbo.*
+cn.shazhengbo.storage.*
+cn.shellming.metrics.*
+cn.shellming.thrift.*
+cn.shenyanchao.ik-analyzer.*
+cn.shenyanchao.ut.*
+cn.sherlockzp.hdimageview.*
+cn.showcodes.*
+cn.shper.*
+cn.shper.plugin.*
+cn.shuibo.*
+cn.shuzilm.core.*
+cn.signit.sdk.*
+cn.simplifydb.*
+cn.sinapp.meutils.*
+cn.sinlmao.*
+cn.sinlmao.commons.*
+cn.siriusbot.*
+cn.sissors.*
+cn.siweikj.*
+cn.sixlab.*
+cn.sj1.*
+cn.skyisazure.wjjhook.*
+cn.skyjilygao.util.*
+cn.skylarkai.*
+cn.sleepybear.*
+cn.sliew.*
+cn.slipi.*
+cn.smallbun.scaffold.*
+cn.smallbun.screw.*
+cn.smartcoding.*
+cn.smartdec.*
+cn.smartdec.sdk.*
+cn.smilevers.*
+cn.smthit.v4.*
+cn.snowheart.*
+cn.sntumc.common.*
+cn.snz1.*
+cn.soboys.*
+cn.softhings.dscp.*
+cn.soilove.*
+cn.someget.*
+cn.songxinqiang.*
+cn.sourcespro.*
+cn.sowjz.*
+cn.spark2fire.*
+cn.spark2fire.alberti.*
+cn.sparrowmini.*
+cn.spring-up.*
+cn.springboot.*
+cn.springcloud.dubbo.*
+cn.springcloud.feign.*
+cn.springcloud.gray.*
+cn.springhub.*
+cn.springlet.*
+cn.sskxyz.*
+cn.stackbox.*
+cn.stackbox.archetypes.*
+cn.starboot.socket.*
+cn.starrys.*
+cn.structured.*
+cn.stylefeng.guns.*
+cn.stylefeng.roses.*
+cn.suniper.cenj.*
+cn.suniper.pma.*
+cn.sunyuqiang.*
+cn.superfw.*
+cn.supzx.utils.*
+cn.surcode.*
+cn.svecri.*
+cn.svipbot.*
+cn.sx.yys.*
+cn.sylinx.*
+cn.szsctc.*
+cn.t.*
+cn.taketoday.*
+cn.takujo.*
+cn.tangjiabao.*
+cn.tdchain.*
+cn.teaey.*
+cn.teaey.apns4j.*
+cn.tekin.*
+cn.tekin.spring.*
+cn.teleinfo.id-pointer.*
+cn.tellyouwhat.*
+cn.tenfell.*
+cn.tenmg.*
+cn.testin.analysis.*
+cn.testnewbie.automation.*
+cn.tg-openx.*
+cn.thearies.*
+cn.therouter.*
+cn.therouter.agp8.*
+cn.thinkingdata.*
+cn.thinkingdata.android.*
+cn.thinkingdata.ta.*
+cn.thinkinginjava.*
+cn.threeoranges.*
+cn.tiecode.*
+cn.tiennet.dolphin.*
+cn.timeface.tfoss.*
+cn.timeface.widget.*
+cn.tinyhai.compose.*
+cn.tncube.*
+cn.topviewclub.*
+cn.torna.*
+cn.toutatis.*
+cn.trinea.android.common.*
+cn.trinea.android.view.autoscrollviewpager.*
+cn.tsa.sdk.*
+cn.ttpai.framework.*
+cn.tuheishan.*
+cn.twelvet.excel.*
+cn.twelvet.websocket.*
+cn.tyoui.*
+cn.tyrg.*
+cn.tzq0301.*
+cn.ucloud.*
+cn.ucloud.ufile.*
+cn.ujava.*
+cn.uncode.*
+cn.undraw.*
+cn.univyz.*
+cn.up-pro.*
+cn.veasion.*
+cn.venny.*
+cn.vertxup.*
+cn.vicren.intercept.*
+cn.vika.*
+cn.vinsonws.tools.*
+cn.virde.*
+cn.virens.*
+cn.vitelab.*
+cn.voidnet.*
+cn.vonce.*
+cn.vorbote.*
+cn.w2n0.genghiskhan.*
+cn.wandersnail.*
+cn.wangcaitao.*
+cn.wangdm.*
+cn.wangdm.maven.plugins.*
+cn.wanghaomiao.*
+cn.wangshuaitong.library.*
+cn.wangzq.*
+cn.wanlinus.*
+cn.watsontech.*
+cn.watsontech.webhelper.*
+cn.we-win.modules.*
+cn.wearctic.*
+cn.webfuse.*
+cn.wecloud.*
+cn.weforward.*
+cn.weiecho.*
+cn.weiguangfu.*
+cn.weisoftware.*
+cn.weiyinfu.*
+cn.wekture.*
+cn.wellt.*
+cn.wenkang365t.*
+cn.wensiqun.*
+cn.wic4j.*
+cn.wic4j.boot.*
+cn.wic4j.security.*
+cn.willingxyz.parentpom.*
+cn.willingxyz.restdoc.*
+cn.wisewe.*
+cn.wizzer.*
+cn.wizzer.app.*
+cn.wjchang.util.*
+cn.wjee.boot.*
+cn.wjybxx.dson.*
+cn.wlcloudy.*
+cn.woblog.android.*
+cn.woodwhales.common.*
+cn.wooops.*
+cn.workde.*
+cn.wormholestack.meventnice.*
+cn.wsyjlly.*
+cn.wuchuheng.*
+cn.wufuqi.*
+cn.wumoe.*
+cn.wusifx.*
+cn.wwjdev.slidinguppanel.*
+cn.wxingzou.conditionflowengine.*
+cn.wxrwcz.*
+cn.wxxsxx.*
+cn.wzbos.android.*
+cn.xanderye.*
+cn.xfyun.*
+cn.xfyun.aiui.aiuiplayer.*
+cn.xhteam.*
+cn.xiaoandcai.*
+cn.xiaocuoben.*
+cn.xiejx.*
+cn.xiexianbin.ueditor.*
+cn.ximcloud.homekit.*
+cn.xisoil.*
+cn.xjbpm.*
+cn.xjiangwei.beatuifulvcf.*
+cn.xlsea.*
+cn.xmjar.*
+cn.xnatural.*
+cn.xnatural.aio.*
+cn.xnatural.app.*
+cn.xnatural.enet.*
+cn.xnatural.http.*
+cn.xnatural.jpa.*
+cn.xnatural.remoter.*
+cn.xnatural.sched.*
+cn.xnatural.task.*
+cn.xphsc.*
+cn.xphsc.boot.*
+cn.xpp011.*
+cn.xsaf1207.*
+cn.xsshome.*
+cn.xtgss.*
+cn.xubitao.*
+cn.xuqiudong.support.*
+cn.xusc.*
+cn.xuyanwu.*
+cn.xuyonghong.network.*
+cn.xuyonghong.permission.*
+cn.xx996.*
+cn.xxywithpq.*
+cn.xyliang.*
+cn.yang37.*
+cn.yanjingtp.*
+cn.yanjingtp.utils.*
+cn.yanyvpingsheng.*
+cn.yanzx-dev.gitlab.*
+cn.yerl.*
+cn.yerl.android.*
+cn.yerl.gradle.*
+cn.yerl.web.*
+cn.yioks.gitlab.core.*
+cn.yiynx.*
+cn.yjava.*
+cn.ymatrix.*
+cn.ymotel.*
+cn.yogehaoren.*
+cn.yongfenggz.sdk.*
+cn.youngkbt.*
+cn.youweisoft.*
+cn.yt4j.*
+cn.yueshutong.*
+cn.yukonga.*
+cn.yunlingfly.*
+cn.yusiwen.*
+cn.yusiwen.commons.*
+cn.yzhua.*
+cn.zcltd.*
+cn.zcltd.btg.*
+cn.zhaiyifan.*
+cn.zhaiyifan.rememberedittext.*
+cn.zhangfusheng.*
+cn.zhangqin56.*
+cn.zhangsw.*
+cn.zhangtiancinb.*
+cn.zhdst.fa.*
+cn.zhgliu.*
+cn.zhoushilan.*
+cn.zhucongqi.*
+cn.zhucongqi.kits.*
+cn.zhuguoqing.*
+cn.zhuoluodada.opensource.*
+cn.zhxu.*
+cn.zhyjohn.darktools.*
+cn.zhys513.*
+cn.zidot.*
+cn.zifangsky.*
+cn.ziyicloud.framework.boot.*
+cn.zkdcloud.*
+cn.zkyle.*
+cn.zoecloud.*
+cn.zongkuiy.*
+cn.zull.tracing.*
+cn.zvo.email.*
+cn.zvo.fileupload.*
+cn.zvo.http.*
+cn.zvo.log.*
+cn.zvo.page.*
+cn.zxporz.*
+cn.zyjblogs.*
+cn.zzq0324.*
+cn.zzq0324.radish.*
+cn.zzzykj.*
+co.52inc.*
+co.abit.api.*
+co.abit.api.core.*
+co.abit.api.identity.*
+co.abit.ares.*
+co.abit.boot.*
+co.abit.prime.*
+co.actioniq.*
+co.actioniq.mill.*
+co.actioniq.scalastyle.*
+co.actioniq.thirdparty.com.twitter.*
+co.actioniq.thirdparty.me.lessis.*
+co.actioniq.thirdparty.ohnosequences.*
+co.adcel.android.*
+co.aenterhy.*
+co.ambisafe.*
+co.androidian.library.*
+co.ankurg.expressview.*
+co.anteia.*
+co.appreactor.*
+co.arago.*
+co.arago.hiro.client.*
+co.arago.util.*
+co.arcs.android.*
+co.arcs.groove.*
+co.areyouonpoint.pointsdk.*
+co.aurasphere.*
+co.aurasphere.botmill.*
+co.aurasphere.maven.plugins.*
+co.aurasphere.metrics.*
+co.axiomzen.maven.wagons.*
+co.baiku.boot.*
+co.bird.skate.*
+co.bitcode.utils.*
+co.bitpesa.sdk.*
+co.bitshifted.*
+co.bitshifted.appforge.*
+co.bittub.api.*
+co.bittub.ares.*
+co.bittub.boot.*
+co.bittub.prime.*
+co.blocke.*
+co.boorse.*
+co.botanalytics.*
+co.bugfreak.*
+co.buybuddy.*
+co.cask.*
+co.cask.cdap.*
+co.cask.cdap.metadata.*
+co.cask.cdap.packs.*
+co.cask.common.*
+co.cask.hbase.*
+co.cask.http.*
+co.cask.hydrator.*
+co.cask.mmds.*
+co.cask.plugins.*
+co.cask.re.*
+co.cask.tephra.*
+co.cask.tigon.*
+co.cask.tracker.*
+co.cask.wrangler.*
+co.chenkangming.*
+co.cloudcheflabs.chango.*
+co.cloudcraft.*
+co.cloudify.*
+co.codecraft.*
+co.com.devco.*
+co.com.devco.automation.*
+co.com.sofka.*
+co.convertloop.*
+co.cryptr.*
+co.customer360.*
+co.daily.*
+co.dapi.*
+co.databeast.*
+co.datachef.*
+co.datadome.*
+co.datadome.fraud.*
+co.datadome.module.*
+co.datadome.sdk.*
+co.datadudes.*
+co.davidarmstrong.*
+co.decodable.*
+co.devhack.*
+co.devspark.*
+co.dift.ui.swipetoaction.*
+co.diji.*
+co.dv01.jquantlib.*
+co.dv01.sangria.*
+co.early.fore.*
+co.early.persista.*
+co.easimart.*
+co.elastic.apm.*
+co.elastic.clients.*
+co.elastic.logging.*
+co.elastic.opentelemetry.contrib.*
+co.elastic.support.*
+co.elastic.thumbnails4j.*
+co.emblock.*
+co.empow.*
+co.enear.maven.plugins.*
+co.escapeideas.maven.*
+co.euphony.lib.*
+co.exabit.api.*
+co.exabit.ares.*
+co.exabit.boot.*
+co.exabit.prime.*
+co.faraboom.*
+co.fast.android.sdk.*
+co.fastcat.analyzer.*
+co.featbit.*
+co.fingerprintsoft.*
+co.fizzed.*
+co.freeside.*
+co.fs2.*
+co.fusionx.*
+co.fusionx.bus.*
+co.fusionx.spotify.*
+co.gokwik.*
+co.gongzh.procbridge.*
+co.gongzh.servicekit.*
+co.helmethair.*
+co.igorski.*
+co.ikust.*
+co.infinum.*
+co.infinum.goldfinger.*
+co.infinum.polyglot-android-client.*
+co.ingensol.*
+co.invoid.demolibrary.*
+co.ipdata.client.*
+co.ipregistry.*
+co.jbear.lib.*
+co.jirm.*
+co.jsilval.apimanager.*
+co.jufeng.*
+co.jurvis.*
+co.kr.itwise.*
+co.l1x.*
+co.leantechniques.*
+co.leatherback.*
+co.legato.libraries.*
+co.lemnisk.app.android.*
+co.lemonlabs.*
+co.logup.*
+co.lookify.*
+co.lors.*
+co.lujun.*
+co.luminositylabs.oss.*
+co.luminositylabs.oss.arquillian.*
+co.luminositylabs.oss.arquillian.cube.*
+co.luminositylabs.oss.arquillian.drone.*
+co.luminositylabs.oss.arquillian.selenium.*
+co.luminositylabs.oss.distributions.*
+co.luminositylabs.oss.ica.*
+co.luminositylabs.oss.ica.migration.*
+co.luminositylabs.oss.ica.search.*
+co.luminositylabs.oss.maven.plugins.*
+co.luminositylabs.payara.arquillian.*
+co.luoja.*
+co.macrometa.*
+co.macrometa.c8jamm.*
+co.macrometa.c8streams.handlers.*
+co.mailtarget.*
+co.mercenary-creators.*
+co.mewf.humpty.*
+co.mewf.sqlwriter.*
+co.mide.zinniandroid.*
+co.moengage.*
+co.mtarget.*
+co.naughtyspirit.*
+co.navdeep.*
+co.netscal.*
+co.notix.*
+co.novu.*
+co.nstant.in.*
+co.ntbl.*
+co.ntbl.dropwizard.*
+co.ntbl.podcastfeedhandler.*
+co.ntier.*
+co.ntier.mongo.*
+co.omise.*
+co.omkar.utility.*
+co.openapp.sdk.*
+co.openfin.*
+co.oril.*
+co.pangeia.*
+co.panghu.*
+co.panghu.boot.*
+co.panghu.common.*
+co.paralleluniverse.*
+co.parish.stephen.publisher.*
+co.payload.*
+co.paystack.android.*
+co.paystack.android.design.widget.*
+co.pisano.feedback.*
+co.pishfa.accelerate.*
+co.pjrt.*
+co.poynt.postman.runner.*
+co.pragmati.*
+co.present.rpc.*
+co.privacyone.*
+co.privacyone.cerberus.*
+co.privacyone.keychain.*
+co.privacyone.ldar.*
+co.privacyone.sdk.*
+co.projectn.*
+co.pushalert.*
+co.pushe.plus.*
+co.reachfive.identity.*
+co.realtime.*
+co.rodnan.*
+co.roverlabs.*
+co.saltpay.terminal.*
+co.seedglobal.design.*
+co.sepulveda.*
+co.smartpay.*
+co.spendabit.*
+co.spraybot.*
+co.stateful.*
+co.steeleye.*
+co.streamx.fluent.*
+co.streamx.license3j.*
+co.summit58.bpmn.*
+co.summit58.dmn.*
+co.summit58.json.*
+co.tamara.*
+co.teapot.*
+co.technius.*
+co.theasi.*
+co.thepeer.*
+co.tomlee.gradle.plugins.*
+co.tomlee.guava.services.*
+co.tomlee.nifty.*
+co.tophe.*
+co.topl.*
+co.torri.*
+co.touchlab.*
+co.touchlab.cklib.*
+co.touchlab.crashkios.*
+co.touchlab.crashkios.bugsnaglink.*
+co.touchlab.crashkios.crashlyticslink.*
+co.touchlab.faktory.*
+co.touchlab.faktory.access.*
+co.touchlab.faktory.kmmbridge.*
+co.touchlab.kermit.*
+co.touchlab.paktager.*
+co.touchlab.skie.*
+co.touchlab.touchlabtools.*
+co.touchlab.touchlabtools.docusaurusosstemplate.*
+co.trikita.*
+co.tryterra.*
+co.tunan.tucache.*
+co.uk.rushorm.*
+co.unruly.*
+co.unruly.flume.*
+co.upvest.*
+co.userwatch.*
+co.uzzu.danger.plugins.*
+co.uzzu.kortex.*
+co.uzzu.strikts.*
+co.uzzu.structurizr.ktx.*
+co.vacom.app.vacomclientlib.*
+co.vendorflow.oss.maildrop.*
+co.verisoft.*
+co.weepay.*
+co.windly.*
+co.wrisk.dropwizard.*
+co.wrisk.jcredstash.*
+co.wrisk.jdbi.*
+co.wrisk.jersey.*
+co.wrisk.logback.*
+co.wuji.*
+co.yellowpay.*
+co.yml.*
+co.youverify.*
+co.yugang.*
+co.zecko.retailer.*
+co.zsmb.*
+co.zuper.android.*
+cobertura.*
+coconut.*
+cocoon.*
+code.google.com.*
+code316.*
+codes.derive.*
+codes.dylanlacey.*
+codes.fepi.*
+codes.laurence.statsd4k.*
+codes.laurence.warden.*
+codes.matteo.*
+codes.quine.*
+codes.quine.labo.*
+codes.quine.labs.*
+codes.rafael.concurrent-trees.*
+codes.rafael.documentsql.*
+codes.rafael.feed.*
+codes.rafael.gradlemavenplugin.*
+codes.rafael.interceptablehttpclient.*
+codes.rafael.jacksonjaxbextension.*
+codes.rafael.jaxb-xew-plugin.*
+codes.rafael.jaxb2_commons.*
+codes.rafael.mavenchecksumextension.*
+codes.rafael.modulemaker.*
+codes.rafael.springstreaminterop.*
+codes.rafael.structuraltype.*
+codes.rafael.task.*
+codes.rafael.xjc.*
+codes.reactive.*
+codes.sen.*
+codes.sf.*
+codes.side.*
+codes.vps.*
+codes.wesley-dev.*
+codes.writeonce.jetscript.*
+coffee.cypher.*
+coffee.cypher.impropriety.*
+coffee.cypher.kettle.*
+colt.*
+com.*
+com.0opslab.*
+com.100shouhou.golddata.*
+com.101tec.*
+com.101zj.*
+com.1024developer.android.xtools.*
+com.10darts.*
+com.10duke.client.*
+com.10duke.client.json.*
+com.10duke.client.jwt.*
+com.10duke.client.parent.*
+com.10duke.client.sso.*
+com.17jee.*
+com.1d3.*
+com.1gravity.*
+com.1km365.*
+com.1kmlive.*
+com.1re1.*
+com.1spatial.*
+com.1stleg.*
+com.21ber.*
+com.21buttons.*
+com.24liveblog.*
+com.2808proxy.*
+com.2c2p.*
+com.2gis.cartoshka.*
+com.2oi7.*
+com.2train395.limelight.api.*
+com.321wing.wingframework.*
+com.35liuqi.*
+com.3levers.cssselectors.*
+com.3pillarglobal.labs.*
+com.3sidedcube.storm.*
+com.3sidedcube.util.*
+com.3xcool.*
+com.41concepts.*
+com.47deg.*
+com.47deg.karat.*
+com.47deg.xef.*
+com.4dconcept.springframework.data.*
+com.4ert.*
+com.4paradigm.hybridse.*
+com.4paradigm.hybridsql.*
+com.4paradigm.openmldb.*
+com.500px.*
+com.51degrees.*
+com.51sole.jxyq123.*
+com.52inc.*
+com.54chen.*
+com.54w74b.*
+com.5831wan.mavencenter.*
+com.5hospital.tools.*
+com.6ack.*
+com.7p-group.*
+com.8kdata.mongowp.*
+com.8kdata.mongowp.api.safe.library.*
+com.8kdata.mongowp.bson.*
+com.8kdata.mongowp.client.*
+com.8kdata.mongowp.server.*
+com.8kdata.netty-bson.*
+com.8x8.cloud.*
+com.91tec.*
+com.9isuper.eden.*
+com.9isuper.eve.*
+com.9isuper.pelecanus.*
+com.9ls.*
+com.IceCreamQAQ.*
+com.IceCreamQAQ.Yu.*
+com.IceCreamQAQ.YuQ.*
+com.ToxicBakery.android.version.*
+com.ToxicBakery.betterernaming.*
+com.ToxicBakery.fcmclient.*
+com.ToxicBakery.kfinstatemachine.*
+com.ToxicBakery.kfinstatemachine.hyperion.*
+com.ToxicBakery.library.bcrypt.*
+com.ToxicBakery.library.noise.*
+com.ToxicBakery.library.nsd.rx.*
+com.ToxicBakery.libs.jlibewf.*
+com.ToxicBakery.logging.*
+com.ToxicBakery.viewpager.transforms.*
+com.ToxicBakery.widget.calendarview.*
+com.Upwork.*
+com.a3test.component.*
+com.a483210.*
+com.a6raywa1cher.*
+com.a9ski.*
+com.a9ski.archetypes.*
+com.a9ski.aws.lambda.*
+com.a9ski.brooklyn.*
+com.a9ski.jsf.*
+com.a9ski.text.encoding.*
+com.a9ski.utils.*
+com.aagam.*
+com.aallam.openai.*
+com.aallam.permissionsflow.*
+com.aallam.preferencesflow.*
+com.aallam.similarity.*
+com.aallam.ulid.*
+com.aamend.*
+com.aamend.hadoop.*
+com.aamend.spark.*
+com.aapbd.maventest.*
+com.aaronbedra.*
+com.aaronicsubstances.*
+com.aayushatharva.*
+com.aayushatharva.brotli4j.*
+com.aazen.tools.build.*
+com.abacusfi.*
+com.abakhi.android.mpower.*
+com.abasecode.opencode.*
+com.abavilla.*
+com.abcodeworks.*
+com.abdulradi.*
+com.abercap.*
+com.abewy.backpack.*
+com.abey.*
+com.abiquo.*
+com.abissell.*
+com.abkabk.*
+com.abkabk.magicaccessories.*
+com.ableneo.liferay.*
+com.ably.tracking.*
+com.abnamro.*
+com.abnamro.coesd.azure.*
+com.abnamro.coesd.public.*
+com.abooc.*
+com.aboutyou.cloud.adminapi.*
+com.aboutyou.cloud.storefrontapi.*
+com.abranhe.*
+com.abroadbent.*
+com.absmartly.sdk.*
+com.abstractelemental.*
+com.abstratt.*
+com.abtasty.*
+com.abubusoft.*
+com.abubusoft.testing.compile.*
+com.abusix.*
+com.abusix.util.*
+com.acanx.*
+com.acaziasoft.highlightedcalendarview.*
+com.accelad.*
+com.accelerate-experience.*
+com.accenture.*
+com.accenture.atom.*
+com.accenture.testing.bdd.*
+com.accessgatelabs.oss.*
+com.acciente.oacc.*
+com.acecounter.ace.*
+com.aceevo.*
+com.aceevo.ursus.*
+com.acenhauer.corball.*
+com.aceql.*
+com.acervera.osm4scala.*
+com.acgist.*
+com.acheck21.java.*
+com.acidmanic.*
+com.acidmanic.myoccontainer.*
+com.acjay.*
+com.ackbox.*
+com.acltabontabon.*
+com.acmtc.*
+com.acoinfo.*
+com.aconex.scrutineer.*
+com.acorns.*
+com.acornui.*
+com.acornui.app.*
+com.acornui.js.*
+com.acornui.kotlin-js.*
+com.acornui.kotlin-jvm.*
+com.acornui.kotlin-mpp.*
+com.acornui.root-settings.*
+com.acornui.root.*
+com.acornui.settings.*
+com.acornui.skins.*
+com.acostanza.*
+com.acpreda.*
+com.acquired.*
+com.acquitygroup.demandware.*
+com.acquitygroup.demandware.project.*
+com.acrcloud.sdks.*
+com.acrolinx.client.*
+com.acrosure.*
+com.actelion.research.*
+com.actigence.*
+com.actimust.*
+com.actionbarsherlock.*
+com.actionjava.*
+com.actionlauncher.*
+com.actionml.*
+com.actionsky.*
+com.actiontestscript.*
+com.activecq.api.*
+com.activecq.tools.quickimage.*
+com.activequant.*
+com.activitystream.*
+com.acvitech.*
+com.acxiom.*
+com.acyumi.*
+com.ad-authenticator.*
+com.ad-pole.android.*
+com.ad_dice.textlib.*
+com.adadapted.*
+com.adamdierkens.*
+com.adamkobus.*
+com.adamldavis.*
+com.adamlewis.*
+com.adammcneilly.*
+com.adamratzman.*
+com.adamthody.*
+com.adamweigold.*
+com.adaptavist.*
+com.adaptc.gradle.*
+com.adaptc.mws.*
+com.adaptc.mws.plugins.*
+com.adaptiverecognition.*
+com.adaptivui.*
+com.adaptrex.*
+com.adarshr.*
+com.adashrod.mkvscanner.*
+com.adcollider.*
+com.adcolony.*
+com.addc.*
+com.addc.build.*
+com.addc.mojo.*
+com.addc.pom.*
+com.addhen.*
+com.addhen.android.*
+com.addicticks.jaxb.*
+com.addicticks.oss.*
+com.addicticks.oss.jaxb.*
+com.addicticks.oss.maven.*
+com.addplus9.*
+com.addthis.*
+com.addthis.basis.*
+com.addthis.common.build.maven.pom.*
+com.addthis.metrics.*
+com.adelegue.*
+com.adendamedia.*
+com.adenki.*
+com.adeo.*
+com.adeo.libres.*
+com.adeptik.*
+com.adeptj.*
+com.adeptues.*
+com.adevinta.android.*
+com.adevinta.spark.*
+com.adform.*
+com.adgadev.jplusone.*
+com.adgear.*
+com.adgem.*
+com.adgyde.*
+com.adidas.*
+com.adidas.mvi.*
+com.adikteev.*
+com.adithyasairam.android.*
+com.adivery.*
+com.adjust.adobeextension.*
+com.adjust.sdk.*
+com.adkhambek.leo.*
+com.adkhambek.moon.*
+com.adkhambek.pack.*
+com.adleritech.*
+com.adlibsoftware.*
+com.adlinktech.gateway.*
+com.adlinktech.gateway.archetypes.*
+com.adlocus.*
+com.admc.*
+com.admin4j.*
+com.admin4j.common.*
+com.admin4j.framework.*
+com.admin4j.json.*
+com.admin4j.limiter.*
+com.admin4j.redis.*
+com.admxj.maven.plugin.*
+com.adnuntius.android.*
+com.adobe.*
+com.adobe.aam.*
+com.adobe.abp.*
+com.adobe.acrobat.*
+com.adobe.acs.*
+com.adobe.acs.bundles.*
+com.adobe.adep.maven.*
+com.adobe.aem.*
+com.adobe.aem.commons.*
+com.adobe.aem.communities.*
+com.adobe.aem.demomachine.*
+com.adobe.aem.dot.*
+com.adobe.aem.guides.*
+com.adobe.aem.guides.wknd-shared.*
+com.adobe.aem.headless.*
+com.adobe.aemfd.*
+com.adobe.aio.*
+com.adobe.aio.aem.*
+com.adobe.api.platform.*
+com.adobe.api.platform.runtime.*
+com.adobe.blazeds.*
+com.adobe.campaign.tests.*
+com.adobe.campaign.tests.bridge.*
+com.adobe.campaign.tests.bridge.service.*
+com.adobe.campaign.tests.bridge.testdata.*
+com.adobe.campaign.tests.phased.*
+com.adobe.commerce.cif.*
+com.adobe.cq.*
+com.adobe.cq.aam.*
+com.adobe.cq.commerce.*
+com.adobe.cq.dam.*
+com.adobe.cq.media.*
+com.adobe.cq.sample.*
+com.adobe.cq.screens.*
+com.adobe.cq.social.*
+com.adobe.cq.spa.archetypes.*
+com.adobe.cq.testing.*
+com.adobe.cq.wcm.*
+com.adobe.creativesdk.*
+com.adobe.creativesdk.android.shared.*
+com.adobe.creativesdk.android.shared.common.*
+com.adobe.creativesdk.aviary.common.*
+com.adobe.creativesdk.foundation.*
+com.adobe.creativesdk.labs.*
+com.adobe.documentcloud.*
+com.adobe.documentservices.*
+com.adobe.dx.*
+com.adobe.event.*
+com.adobe.experiencecloud.ecid.*
+com.adobe.flex.compiler.*
+com.adobe.flex.framework.*
+com.adobe.granite.*
+com.adobe.granite.analytics.*
+com.adobe.granite.archetypes.*
+com.adobe.granite.ide.*
+com.adobe.granite.maven.*
+com.adobe.granite.oak.*
+com.adobe.granite.sling.*
+com.adobe.granite.tools.*
+com.adobe.livecycle.*
+com.adobe.livecycle.aemformsjee-client-sdk.*
+com.adobe.livecycle.dsc.*
+com.adobe.mac.*
+com.adobe.marketing.mobile.*
+com.adobe.mobile.*
+com.adobe.nlp.*
+com.adobe.pdf.*
+com.adobe.platform.ml.*
+com.adobe.qe.*
+com.adobe.reef.commons.*
+com.adobe.ride.*
+com.adobe.s3fs.*
+com.adobe.scc.*
+com.adobe.sharedcloud.worker.XMPFilesProcessor.*
+com.adobe.sign.*
+com.adobe.solr.plugin.*
+com.adobe.statelanguage.*
+com.adobe.stock.*
+com.adobe.suitetech.*
+com.adobe.target.*
+com.adobe.target.mobile.*
+com.adobe.tat.*
+com.adobe.testing.*
+com.adobe.xliff.*
+com.adobe.xmp.*
+com.adonax.*
+com.adongs.*
+com.adouteam.*
+com.adp.marketplace.api.product.userinfo.*
+com.adp.marketplace.connection.*
+com.adpdigital.push.*
+com.adpushup.*
+com.adrianfilip.*
+com.adrianhurt.*
+com.adropofliquid.*
+com.adscore.*
+com.adsolutions.*
+com.adsoul.*
+com.adtran.*
+com.adtsw.*
+com.adtsw.jdatalayer.*
+com.adtsw.jos.*
+com.advancedpwr.*
+com.adview.*
+com.adyen.*
+com.adyen.authentication.*
+com.adyen.checkout.*
+com.adyen.cse.*
+com.adyen.threeds.*
+com.adzerk.*
+com.aeert.*
+com.aegirmaps.*
+com.aegisql.*
+com.aegisql.conveyor-persistence-jdbc.*
+com.aegisql.id_builder.*
+com.aegisql.persistence.*
+com.aeontronix.aeon-commons.*
+com.aeontronix.aeonfileprocessor.*
+com.aeontronix.anypoint-tools.*
+com.aeontronix.elogging.*
+com.aeontronix.enhanced-mule.*
+com.aeontronix.enhancedmule.*
+com.aeontronix.genesis.*
+com.aeontronix.kryptotek.*
+com.aeontronix.log4j2.*
+com.aeontronix.maven.*
+com.aeontronix.mule.connector.openidconnect.*
+com.aeontronix.restclient.*
+com.aeontronix.unpack.*
+com.aeontronix.vfs.*
+com.aerisweather.*
+com.aerokube.lightning.*
+com.aerospike.*
+com.aerse.*
+com.aerse.maven.*
+com.aestasit.infrastructure.aws.*
+com.aestasit.infrastructure.groowin.*
+com.aestasit.infrastructure.mock.*
+com.aestasit.infrastructure.puppet.*
+com.aestasit.infrastructure.sshoogr.*
+com.aestasit.infrastructure.winrm.*
+com.aetrion.flickr.*
+com.aeuok.*
+com.aevi.android.*
+com.aevi.barcode.*
+com.aevi.dms.*
+com.aevi.launcher.*
+com.aevi.print.*
+com.aevi.sdk.*
+com.aevi.sdk.config.*
+com.aevi.sdk.flow.*
+com.aevi.sdk.pos.flow.*
+com.aevi.sdk.pos.flow.config.*
+com.aevi.ui.library.*
+com.aevi.util.*
+com.affinda.api.*
+com.affinidi.stg.*
+com.affirm.*
+com.affise.*
+com.afklm.*
+com.afollestad.*
+com.afollestad.assent.*
+com.afollestad.assure.*
+com.afollestad.inline-activity-result.*
+com.afollestad.material-dialogs.*
+com.afollestad.rxkprefs.*
+com.afrigis.lib.*
+com.afrigis.services.*
+com.afrogleap.docustream.*
+com.afrozaar.wordpress.*
+com.afrunt.*
+com.afrunt.h2s.*
+com.afrunt.imdb.*
+com.afrunt.jpa.*
+com.afrunt.pgs.*
+com.afrunt.randomjoke.*
+com.after_sunrise.commons.*
+com.after_sunrise.cryptocurrency.*
+com.after_sunrise.oss.*
+com.afterpay.*
+com.aftership.*
+com.aftia.*
+com.aftia.plugin.*
+com.agapsys.*
+com.agapsys.archetypes.*
+com.agapsys.libs.*
+com.agapsys.plugins.*
+com.ageet.apkname.*
+com.ageet.filelogprovider.*
+com.aggrepoint.framework.*
+com.aggrepoint.utils.*
+com.agical.rmock.*
+com.agido.*
+com.agifac.deploy.*
+com.agifac.lib.*
+com.agifac.maf.*
+com.agifac.maf.desktop.*
+com.agifac.maf.packaging.*
+com.agilarity.*
+com.agile4j.*
+com.agileactors.*
+com.agileandmore.*
+com.agileasoft.*
+com.agilejava.blammo.*
+com.agilejava.docbkx.*
+com.agilepirates.*
+com.agiletestingframework.*
+com.agilistanbul.*
+com.agiliumlabs.arquillian.*
+com.agiliumlabs.osxappbundle.*
+com.aginity.aqe.*
+com.agoda.*
+com.agoda.boots.*
+com.agoda.kakao.*
+com.agoda.ninjato.*
+com.agonyforge.*
+com.agoragames.*
+com.agorapulse.*
+com.agorapulse.testing.*
+com.agrirouter.api.lmis.*
+com.agrirouter.proto.*
+com.agsft.*
+com.aheaditec.*
+com.ahirajustice.*
+com.ahmedjazzar.rosetta.*
+com.ahome-it.*
+com.ahyakamil.*
+com.ahyakamil.akcache.*
+com.ai-republic.*
+com.ai-solutions.freeflyer.*
+com.aibank.wealth.*
+com.aibton.*
+com.aidangrabe.*
+com.aigens.*
+com.aihook.*
+com.ailbb.*
+com.ailyr.*
+com.aimconsulting.*
+com.aimilin.*
+com.aimmac23.*
+com.ainrif.acorn.*
+com.ainrif.apiator.*
+com.ainrif.gears.*
+com.ainsightful.*
+com.air-software.*
+com.airbnb.*
+com.airbnb.android.*
+com.airbnb.okreplay.*
+com.airbnb.walkman.*
+com.airbus-cyber-security.graylog.*
+com.airbyte.*
+com.airhacks.*
+com.airhacks.rulz.*
+com.airlenet.*
+com.airlenet.dubbo.extension.*
+com.airlenet.io.socket.*
+com.airlenet.netconf.*
+com.airlenet.network.*
+com.airlenet.portforwarding.*
+com.airlenet.sshproxy.*
+com.airlenet.yang.*
+com.airnauts.*
+com.airnauts.toolkit.*
+com.airrobe.*
+com.airsaid.*
+com.airsaid.sample.*
+com.airwallex.airskiff.*
+com.aisecurius.*
+com.aiselis.*
+com.aispeech.android.*
+com.aitusoftware.*
+com.aiwiown.*
+com.aiwiown.dbutils.*
+com.aiwiown.face.*
+com.aiwiown.jword.*
+com.aiwuyu.commons.*
+com.aixoft.*
+com.aiyaapp.aiya.*
+com.aizuda.*
+com.aizuda.easy-security.*
+com.ajaxjs.*
+com.ajjpj.a-base.*
+com.ajjpj.a-collections.*
+com.ajjpj.a-foundation.*
+com.ajjpj.a-mapper.*
+com.ajjpj.a-sql-mapper.*
+com.ajjpj.a-sysmon.*
+com.ajjpj.simple-akka-downing.*
+com.ajtjp.*
+com.akaita.android.*
+com.akaita.java.*
+com.akamai.*
+com.akamai.edgegrid.*
+com.akathist.maven.plugins.launch4j.*
+com.akeshmiri.*
+com.akexorcist.*
+com.akexorcist.filewritercompat.*
+com.akeyless-security.*
+com.akeyless-security.auth.swagger.*
+com.akeyless-security.kfm.swagger.*
+com.akeyless-security.uam.swagger.*
+com.akiban.*
+com.akijoey.*
+com.akkagrpc.*
+com.akkaserverless.*
+com.akmetiuk.*
+com.akolov.*
+com.akuleshov7.*
+com.akvelon.*
+com.al333z.*
+com.alachisoft.*
+com.alachisoft.ncache.*
+com.alanapi.banner.*
+com.alanapi.db.*
+com.alanapi.dialog.*
+com.alanapi.fab.animation.*
+com.alanapi.flow.*
+com.alanapi.image.*
+com.alanapi.imagepreview.*
+com.alanapi.imagezoom.*
+com.alanapi.mvp.*
+com.alanapi.navigation.*
+com.alanapi.refreshlayout.*
+com.alanapi.rx.http.*
+com.alanapi.seekbar.*
+com.alanapi.switchbutton.*
+com.alanapi.tab.*
+com.alanapi.ui.*
+com.alanapi.viewpagerindicator.*
+com.alanapi.wheelview.*
+com.alanbuttars.commons.*
+com.alanmrace.*
+com.alanpoi.*
+com.alazeprt.*
+com.albertoborsetta.*
+com.albertoquesada.*
+com.albroco.*
+com.aldaviva.easter4j.*
+com.aldoapps.*
+com.aldwx.*
+com.aldwx.aldsdk.*
+com.aleax.blight.*
+com.alebit.jelsongname.*
+com.alecstrong.*
+com.alecstrong.grammar.kit.composer.*
+com.alecstrong.sql.psi.*
+com.alejandrohdezma.*
+com.alemira.*
+com.alertavert.*
+com.alessandromarrella.*
+com.alex-zaitsev.*
+com.alex1304.botrino.*
+com.alex1304.jdash.*
+com.alexanderperucci.*
+com.alexandredias3d.*
+com.alexandriasoftware.swing.*
+com.alexbarter.*
+com.alexbeardsley.*
+com.alexbt.*
+com.alexdupre.*
+com.alexdupre.shapeshift.*
+com.alexecollins.*
+com.alexecollins.docker.*
+com.alexecollins.jspec.*
+com.alexecollins.maven.plugin.*
+com.alexeinunez.*
+com.alexeygrigorev.*
+com.alexgilleran.*
+com.alexgorbatchev.*
+com.alexitc.*
+com.alexkasko.*
+com.alexkasko.delta.*
+com.alexkasko.installer.*
+com.alexkasko.krakatau.*
+com.alexkasko.maven.*
+com.alexkasko.netty.*
+com.alexkasko.rest.*
+com.alexkasko.springjdbc.*
+com.alexkasko.springjdbc.typedqueries.*
+com.alexkasko.tasks.*
+com.alexkasko.unsafe.*
+com.alexnederlof.*
+com.alexprut.*
+com.alexprut.algo.*
+com.alexsimo.rxjava2firebase.*
+com.alexstyl.*
+com.alexstyl.swipeablecard.*
+com.alextherapeutics.*
+com.alexvasilkov.*
+com.alfame.esb.bpm.*
+com.algolia.*
+com.algolia.instantsearch.*
+com.algorand.*
+com.algorigo.device.*
+com.algorigo.library.*
+com.algorigo.rx.*
+com.algorigo.ui.*
+com.algorithmia.*
+com.alhuelamo.*
+com.alialbaali.kamel.*
+com.alianga.*
+com.alianza.*
+com.alibaba.*
+com.alibaba.aligenie.*
+com.alibaba.alink.*
+com.alibaba.android.*
+com.alibaba.android.mnnkit.*
+com.alibaba.android.tume.*
+com.alibaba.android.workbench.*
+com.alibaba.ans.*
+com.alibaba.arms.apm.*
+com.alibaba.arthas.*
+com.alibaba.asyncload.*
+com.alibaba.bds.*
+com.alibaba.blink.*
+com.alibaba.boot.*
+com.alibaba.calcite.*
+com.alibaba.citrus.*
+com.alibaba.citrus.sample.*
+com.alibaba.citrus.tool.*
+com.alibaba.cloud.*
+com.alibaba.cloud.analyticdb.*
+com.alibaba.cobar.*
+com.alibaba.cola.*
+com.alibaba.compileflow.*
+com.alibaba.csb.sdk.*
+com.alibaba.csb.trace.*
+com.alibaba.csp.*
+com.alibaba.da.coin.*
+com.alibaba.damo.*
+com.alibaba.database.*
+com.alibaba.dauth.*
+com.alibaba.dchain.*
+com.alibaba.dingtalk.*
+com.alibaba.dragonwell.*
+com.alibaba.druid.*
+com.alibaba.dts.client.*
+com.alibaba.edas.*
+com.alibaba.edas.acm.*
+com.alibaba.edas.configcenter.*
+com.alibaba.fastffi.*
+com.alibaba.fastjson2.*
+com.alibaba.fastsql.*
+com.alibaba.fescar.*
+com.alibaba.flink.*
+com.alibaba.flink.ml.*
+com.alibaba.graphscope.*
+com.alibaba.hbase.*
+com.alibaba.hologres.*
+com.alibaba.hsf.*
+com.alibaba.idst.*
+com.alibaba.jstorm.*
+com.alibaba.jvm.sandbox.*
+com.alibaba.kt.*
+com.alibaba.lindorm.*
+com.alibaba.lindorm.thirdparty.*
+com.alibaba.middleware.*
+com.alibaba.middleware.race.*
+com.alibaba.mq-amqp.*
+com.alibaba.mq-amqp.jms.*
+com.alibaba.mqtt.*
+com.alibaba.msha.*
+com.alibaba.nacos.*
+com.alibaba.nls.*
+com.alibaba.oneagent.*
+com.alibaba.ons.*
+com.alibaba.otter.*
+com.alibaba.p3c.*
+com.alibaba.p3c.idea.*
+com.alibaba.pelican.*
+com.alibaba.race.*
+com.alibaba.rocketmq.*
+com.alibaba.rsocket.*
+com.alibaba.schedulerx.*
+com.alibaba.smart.framework.*
+com.alibaba.spring.*
+com.alibaba.spring.boot.*
+com.alibaba.tamper.*
+com.alibaba.testable.*
+com.alibaba.ververica.*
+com.alicp.jetcache.*
+com.aliction.*
+com.alidahaghin.*
+com.alidaodao.app.*
+com.alidaodao.web.*
+com.alienff.*
+com.alihafizji.creditcardedittext.*
+com.alihafizji.splitimageview.*
+com.alikeaudience.dmpsdk.*
+com.alikeaudience.sdk.*
+com.alilitech.*
+com.alimuzaffar.lib.*
+com.alinkeji.*
+com.alipay.chainstack.*
+com.alipay.global.sdk.*
+com.alipay.jarslink.*
+com.alipay.mychainx.*
+com.alipay.myjava.*
+com.alipay.rdf.file.*
+com.alipay.sdk.*
+com.alipay.sofa.*
+com.alipay.sofa.acts.*
+com.alipay.sofa.common.*
+com.alipay.sofa.lookout.*
+com.alippo.chatwoot.*
+com.aliseeks.*
+com.aliyun.*
+com.aliyun.abfs.*
+com.aliyun.angelia.*
+com.aliyun.api.gateway.*
+com.aliyun.apsaradb.*
+com.aliyun.atp.*
+com.aliyun.be.*
+com.aliyun.calcite.avatica.*
+com.aliyun.datahub.*
+com.aliyun.datalake.*
+com.aliyun.dataworks.*
+com.aliyun.dfs.*
+com.aliyun.dpa.*
+com.aliyun.drc.*
+com.aliyun.dts.*
+com.aliyun.dts.deliver.*
+com.aliyun.ecs.*
+com.aliyun.ecs.easysdk.*
+com.aliyun.ecs.easysdk.assembly.*
+com.aliyun.ecs.easysdk.demos.*
+com.aliyun.ecs.easysdk.incubator-plugins.*
+com.aliyun.emr.*
+com.aliyun.eventbridge.*
+com.aliyun.fc.runtime.*
+com.aliyun.hbase.*
+com.aliyun.hbase.test.*
+com.aliyun.igraph.*
+com.aliyun.iotx.*
+com.aliyun.kms.*
+com.aliyun.lindorm.*
+com.aliyun.mns.*
+com.aliyun.mq.*
+com.aliyun.mqs.*
+com.aliyun.oas.*
+com.aliyun.odps.*
+com.aliyun.opensearch.*
+com.aliyun.openservices.*
+com.aliyun.openservices.eas.*
+com.aliyun.openservices.tablestore.*
+com.aliyun.oss.*
+com.aliyun.pds.*
+com.aliyun.phoenix.*
+com.aliyun.relay.*
+com.aliyun.relay.auth.*
+com.aliyun.schedulerx.*
+com.aliyun.tablestore.*
+com.aliyun.tair.*
+com.aliyun.tpp.*
+com.aliyunidaas.*
+com.alkacon.*
+com.alkimiapps.*
+com.allanditzel.*
+com.allen-sauer.gwt.dnd.*
+com.allen-sauer.gwt.log.*
+com.allen-sauer.gwt.voices.*
+com.allenru.*
+com.allensean.*
+com.allihoopa.allihoopa-android.*
+com.allocab.*
+com.allogy.*
+com.allogy.json.*
+com.allogy.maven.wagon.*
+com.allpiper.*
+com.allsparkcube.*
+com.allya.maven.wagon.*
+com.almende.eve.*
+com.almis.ade.*
+com.almis.awe.*
+com.almworks.integers.*
+com.almworks.jira.structure.*
+com.almworks.sqlite4java.*
+com.alogient.cameleon.java.extension.*
+com.alogient.cameleon.java.sdk.*
+com.alpactech.*
+com.alphacephei.*
+com.alphalxy.*
+com.alphapay.sdk.*
+com.alpinenow.*
+com.alsatpardakht.*
+com.alta189.*
+com.altapay.*
+com.alterationx10.*
+com.alterioncorp.*
+com.alternativepayments.*
+com.altom.*
+com.altoros.*
+com.alttester.*
+com.alugarei.*
+com.alumisky.*
+com.alvazan.*
+com.alviere.*
+com.alviere.android.*
+com.alzakharov.*
+com.amadeus.*
+com.amadeus.asciidoc.*
+com.amadeus.session.*
+com.amap.api.*
+com.amarjanica.*
+com.amashchenko.maven.plugin.*
+com.amashchenko.struts2.actionflow.*
+com.amashchenko.struts2.pdfstream.*
+com.amazon.aes.webservices.client.*
+com.amazon.alexa.*
+com.amazon.alexa.aace.*
+com.amazon.alexa.aacs.*
+com.amazon.android.*
+com.amazon.android.amazonpay.*
+com.amazon.appanalyticshub.*
+com.amazon.carbonado.*
+com.amazon.datagen.*
+com.amazon.deequ.*
+com.amazon.device.*
+com.amazon.device.inputmapping.*
+com.amazon.device.tools.build.*
+com.amazon.device.tools.lint.*
+com.amazon.emr.*
+com.amazon.ion.*
+com.amazon.opendistroforelasticsearch.*
+com.amazon.opendistroforelasticsearch.client.*
+com.amazon.paapi.*
+com.amazon.pay.*
+com.amazon.redshift.*
+com.amazon.sidewalk.*
+com.amazonaws.*
+com.amazonaws.proprot.*
+com.amazonaws.resources.*
+com.amazonaws.s3.*
+com.amazonaws.scala.*
+com.amazonaws.secretsmanager.*
+com.amazonaws.serverless.*
+com.amazonaws.serverless.archetypes.*
+com.amdelamar.*
+com.amdocs.zusammen.*
+com.amdocs.zusammen.plugin.*
+com.americanexpress.span.*
+com.americanexpress.unify.flowret.*
+com.americanexpress.unify.jdocs.*
+com.americanwell.android.*
+com.amido.stacks.modules.*
+com.amihaiemil.ai.*
+com.amihaiemil.devops.*
+com.amihaiemil.web.*
+com.aminebag.larjson.*
+com.aminography.*
+com.amirkhawaja.*
+com.amitapi.*
+com.amitinside.*
+com.amlinv.*
+com.amlinv.activemq.*
+com.amlinv.xml.*
+com.amoerie.*
+com.amplifino.nestor.*
+com.amplify.*
+com.amplifyframework.*
+com.amplifyframework.ui.*
+com.amplitude.*
+com.amstronghuang.slider.*
+com.amysta.jclouds.*
+com.amysta.jclouds.api.*
+com.amysta.jclouds.common.*
+com.amysta.jclouds.driver.*
+com.amysta.jclouds.labs.*
+com.amysta.jclouds.provider.*
+com.anandroiddev.*
+com.anaplan.engineering.*
+com.anaplan.engineering.vdm-stub-generator.*
+com.anaptecs.jeaf.*
+com.anaptecs.jeaf.commons.*
+com.anaptecs.jeaf.core.*
+com.anaptecs.jeaf.fast-lane.*
+com.anaptecs.jeaf.generator.*
+com.anaptecs.jeaf.generator.sample.*
+com.anaptecs.jeaf.jersey.*
+com.anaptecs.jeaf.json.*
+com.anaptecs.jeaf.junit.*
+com.anaptecs.jeaf.launcher.*
+com.anaptecs.jeaf.mail.*
+com.anaptecs.jeaf.maven.*
+com.anaptecs.jeaf.owalibs.*
+com.anaptecs.jeaf.persistence.*
+com.anaptecs.jeaf.rest.*
+com.anaptecs.jeaf.security.*
+com.anaptecs.jeaf.services.*
+com.anaptecs.jeaf.tools.*
+com.anaptecs.jeaf.uml.*
+com.anaptecs.jeaf.validation.*
+com.anaptecs.jeaf.workload.*
+com.anaptecs.jeaf.x-fun.*
+com.anasoft.os.*
+com.anatawa12.*
+com.anatawa12.asar4j.*
+com.anatawa12.auto-tostring.*
+com.anatawa12.autoVisitor.*
+com.anatawa12.decompileCrasher.*
+com.anatawa12.forge.*
+com.anatawa12.jarInJar.*
+com.anatawa12.jasm.*
+com.anatawa12.java-stab-gen.*
+com.anatawa12.jbsdiff.*
+com.anatawa12.kotlinScriptRunner.*
+com.anatawa12.lightweight-protobuf.*
+com.anatawa12.mod-patching.*
+com.anatawa12.sai.*
+com.anbai.*
+com.anbillon.*
+com.anbillon.dagger.*
+com.anbillon.routine.*
+com.ancientlightstudios.*
+com.ancientprogramming.fixedformat4j.*
+com.andersen-gott.*
+com.andkulikov.*
+com.andonapp.*
+com.andraskindler.parallaxviewpager.*
+com.andraskindler.quickscroll.*
+com.andreabaccega.*
+com.andrearichiardi.android.*
+com.andrebreves.*
+com.andrebreves.java.*
+com.andree-surya.*
+com.andreidemus.http-kit.*
+com.andrelanouette.solr4j.*
+com.andretietz.houston.*
+com.andretietz.retroauth.*
+com.andretietz.retrofit.*
+com.andrewgapic.*
+com.andrewgiang.spritzertextview.*
+com.andrewjamesjohnson.*
+com.andrewjc.*
+com.andrewkroh.gradle.*
+com.andrewmccall.faker.*
+com.andrewreitz.*
+com.andrewreitz.bad.*
+com.andrewreitz.velcro.*
+com.andrewswan.*
+com.andreytim.jafar.*
+com.android-widget.*
+com.android.*
+com.android.databinding.*
+com.android.ddmlib.*
+com.android.prefs.*
+com.android.tools.*
+com.android.tools.analytics-library.*
+com.android.tools.build.*
+com.android.tools.ddms.*
+com.android.tools.external.com-intellij.*
+com.android.tools.external.lombok.*
+com.android.tools.jack.*
+com.android.tools.jill.*
+com.android.tools.layoutlib.*
+com.android.tools.lint.*
+com.android.tools.lint.checks.*
+com.android.volley.*
+com.android9527.pushsdk.*
+com.androidacy.*
+com.androidadvance.surveylib.*
+com.androideasy.permissions.*
+com.androidhuman.*
+com.androidhuman.rxfirebase.*
+com.androidhuman.rxfirebase2.*
+com.androidisland.arch.*
+com.androidmapsextensions.*
+com.androidpi.*
+com.androidplot.*
+com.androidstudy.daraja.*
+com.androidsx.*
+com.androidzeitgeist.android-network-intents.*
+com.androidzeitgeist.featurizer.*
+com.andylibrian.jsastrawi.*
+com.andyln.*
+com.andyserver.maven.plugins.*
+com.aneeshpu.dbdeppop.*
+com.anggrayudi.*
+com.angie910.*
+com.angkorteam.framework.extension.*
+com.angusmorton.*
+com.aniketkadam.pdb.*
+com.anilcanaydin.*
+com.anitechcs.*
+com.aniways.*
+com.anji-plus.*
+com.anjlab.android.*
+com.anjlab.android.iab.v3.*
+com.annimon.*
+com.annotationconstraints.*
+com.anocube.*
+com.anothercaffeinatedday.*
+com.anothercaffeinatedday.sob.*
+com.anotherspectrum.*
+com.anprosit.*
+com.anrisoftware.anlopencl.*
+com.anrisoftware.fractions.*
+com.anrisoftware.globalpom.*
+com.anrisoftware.gsanalysis.*
+com.anrisoftware.jmejfx.*
+com.anrisoftware.prefdialog.*
+com.anrisoftware.propertiesutils.*
+com.anrisoftware.registration.*
+com.anrisoftware.resources.*
+com.anrisoftware.simplerest.*
+com.anrisoftware.sscontrol.*
+com.ansill.lock.*
+com.ansill.utility.*
+com.ansill.validation.*
+com.ansvia.graph.*
+com.antelopesystem.authframework.*
+com.antelopesystem.crudframework.*
+com.antgroup.antchain.openapi.*
+com.antgroup.tugraph.*
+com.anthavio.*
+com.anthemengineering.*
+com.anthemengineering.mojo.*
+com.antheminc.oss.*
+com.antherd.*
+com.antiaction.*
+com.antkorwin.*
+com.antlersoft.browsebyquery.*
+com.antoineguay.*
+com.anton-johansson.*
+com.anton46.*
+com.antonchernyshov.integrations.appinsights.aws.ec2.*
+com.antonioalejandro.*
+com.antonioaltieri.telegram.*
+com.antoniocappiello.library.*
+com.antonowycz.*
+com.antonpotapov.*
+com.antonyudin.cassandra.*
+com.antonyudin.filters.pdf.*
+com.antonyudin.wildfly.security.*
+com.antonzhdanov.*
+com.antsomi.*
+com.antwerkz.*
+com.antwerkz.afton.*
+com.antwerkz.bottlerocket.*
+com.antwerkz.build.*
+com.antwerkz.critter.*
+com.antwerkz.github.*
+com.antwerkz.graven.*
+com.antwerkz.kibble.*
+com.antwerkz.lariat.*
+com.antwerkz.maven.*
+com.antwerkz.sofia.*
+com.antwerkz.super-expressive.*
+com.anubhavshukla.*
+com.anwios.alog.*
+com.anwios.android.*
+com.anwios.androidlog.*
+com.anwios.meterview.view.*
+com.anyascii.*
+com.anyqn.lib.*
+com.aoapps.*
+com.aoe.*
+com.aoindustries.*
+com.aol.advertising.vulcan.*
+com.aol.cyclops.*
+com.aol.microservices.*
+com.aol.obi.*
+com.aol.one.*
+com.aol.one.reporting.*
+com.aol.simplereact.*
+com.aoodax.jvm.common.*
+com.aotasoft.taggroup.*
+com.apa70.*
+com.apachat.*
+com.apadmi.*
+com.apadmi.mockzilla.*
+com.apandey.*
+com.apandey.forks.spek.*
+com.aparapi.*
+com.aparzev.*
+com.apcc4m.*
+com.ape9527.*
+com.apeer.*
+com.api-tech.*
+com.api2pdf.client.*
+com.apicatalog.*
+com.apifan.common.*
+com.apifan.framework.*
+com.apifortress.*
+com.apifortress.apielements.*
+com.apifortress.parsers.*
+com.apigee.edge.config.*
+com.apigee.registry.config.*
+com.apigee.smartdocs.config.*
+com.apiomat.*
+com.apiomat.helper.*
+com.apiseven.apisix.*
+com.apistd.uni.*
+com.apitable.*
+com.apitrary.*
+com.aplaline.baibulo.*
+com.apm4all.hadoop.*
+com.apm4all.tracy.*
+com.apmvista.agent.android.*
+com.apollo-lib.*
+com.apollographql.android.*
+com.apollographql.apollo.*
+com.apollographql.apollo3.*
+com.apollographql.apollo3.external.*
+com.apollographql.federation.*
+com.apolunor.*
+com.apothesource.pillfill.*
+com.app3.*
+com.app55.*
+com.appadhoc.*
+com.appaloosa-store.*
+com.appaloosa-store.appaloosa-android-tools.*
+com.appbooster.appboostersdk.*
+com.appboy.*
+com.appbrain.*
+com.appcarry.*
+com.appcrossings.*
+com.appcrossings.config.*
+com.appcues.*
+com.appdirect.*
+com.appdynamics.*
+com.appdynamics.agent.*
+com.appfiza.android.*
+com.apphance.ameba.*
+com.apphance.flow.*
+com.apphud.*
+com.appian.*
+com.appier.*
+com.appivo.jpromise.*
+com.appkim.i18nstrings.*
+com.appland.*
+com.appland.appmap.*
+com.applandeo.*
+com.applause.*
+com.applcn.*
+com.apple.*
+com.apple.itunes.storekit.*
+com.applidok.*
+com.appliedolap.essbase.*
+com.appliedrec.verid.*
+com.applitools.*
+com.applivery.*
+com.applovin.*
+com.applovin.mediation.*
+com.appmagnetics.*
+com.appmattus.*
+com.appmattus.certificatetransparency.*
+com.appmattus.crypto.*
+com.appmattus.fixture.*
+com.appmattus.layercache.*
+com.appmattus.leaktracker.*
+com.appmattus.mpu.*
+com.appmojo.*
+com.appneta.agent.java.*
+com.appnexus.grafana-client.*
+com.appnexus.oas.mobilesdk.*
+com.appnexus.opensdk.*
+com.appnexus.opensdk.csr.*
+com.appnexus.opensdk.mediatedviews.*
+com.appnexus.pricecheck.*
+com.appodeal.ads.*
+com.appodeal.ads.sdk.*
+com.appodeal.ads.sdk.core.*
+com.appodeal.ads.sdk.networks.*
+com.appodeal.ads.sdk.services.*
+com.appolica.*
+com.appoptics.agent.java.*
+com.appoptics.metrics.*
+com.apporiented.*
+com.approvaltests.*
+com.approveapi.*
+com.appsamurai.appsprize.*
+com.appsamurai.storyly.*
+com.appscode.api.*
+com.appscode.searchlight.*
+com.appscode.stash.*
+com.appscode.voyager.*
+com.appsflyer.*
+com.appsingularity.*
+com.appslandia.*
+com.appspector.*
+com.appspress.single-source-sdk.*
+com.appstractive.*
+com.appswithlove.loco.*
+com.appswithlove.updraft.*
+com.apptasticsoftware.*
+com.apptentive.*
+com.appthwack.*
+com.apptimize.segment.*
+com.apptrail.*
+com.appunite.*
+com.appvirality.*
+com.appwavelets.agent.*
+com.appyads.services.*
+com.appyvet.*
+com.apruve.*
+com.aptabase.*
+com.aptoide.pt.*
+com.aptopayments.sdk.*
+com.apuntesdejava.*
+com.apurebase.*
+com.apusapps.*
+com.apyhs.*
+com.aquafx-project.*
+com.aquaticinformatics.*
+com.aquenos.epics.jackie.*
+com.aquenos.epics.jackie.diirt.*
+com.aragost.javahg.*
+com.araguacaima.*
+com.araguacaima.braas.*
+com.arakelian.*
+com.aranea-apps.android.demo.*
+com.aranea-apps.android.libs.*
+com.arangodb.*
+com.aranya.jquery.*
+com.arashpayan.*
+com.arassec.igor.*
+com.arasthel.*
+com.arasthel.navigation.*
+com.arboratum.*
+com.arcadeanalytics.*
+com.arcadedb.*
+com.arcaniax.*
+com.arcansecurity.skeerel.*
+com.arcao.*
+com.arcbees.*
+com.arcbees.analytics.*
+com.arcbees.appengine.*
+com.arcbees.archetypes.*
+com.arcbees.facebook.*
+com.arcbees.gaestudio.*
+com.arcbees.gquery.*
+com.arcbees.gss.*
+com.arcbees.seo.*
+com.arcbees.stripe.*
+com.archeruu.*
+com.archipelagos-labs.*
+com.arconsis.*
+com.arcticicestudio.*
+com.arcusx.chrono.*
+com.ardikars.common.*
+com.ardikars.jxnet.*
+com.ardikars.jxpacket.*
+com.ardikars.memories.*
+com.ardikars.pcap.*
+com.ardoq.*
+com.ardor3d.*
+com.arekusu.datamover.*
+com.arello-mobile.*
+com.arena-returns.*
+com.arextest.*
+com.argonio.gora.*
+com.argosnotary.argos.*
+com.argyle.*
+com.arhs-group.*
+com.arianegraphql.*
+com.ariht.*
+com.aripd.*
+com.ariskk.*
+com.arize.*
+com.arjenzhou.*
+com.arjie.groundhog.*
+com.arkanosis.*
+com.arkivanov.decompose.*
+com.arkivanov.essenty.*
+com.arkivanov.mvikotlin.*
+com.arkivanov.parcelize.darwin.*
+com.arkondata.*
+com.arloor.*
+com.arm.mbed.cloud.*
+com.arm.mbed.cloud.sdk.*
+com.armanbilge.*
+com.arnaudpiroelle.*
+com.arnyminerz.library.kmconnector.*
+com.arnyminerz.markdowntext.*
+com.aromajoin.sdk.*
+com.arosbio.*
+com.arost.*
+com.arpit9mittal.fmk.*
+com.arpitos.*
+com.arpitram.*
+com.arpnetworking.*
+com.arpnetworking.build.*
+com.arpnetworking.code.play2-maven-plugin.*
+com.arpnetworking.code.sbt-compiler-maven-plugin.*
+com.arpnetworking.commons.*
+com.arpnetworking.kairosdb.*
+com.arpnetworking.logback.*
+com.arpnetworking.metrics.*
+com.arpnetworking.metrics.extras.*
+com.arpnetworking.test.*
+com.arronlong.*
+com.arronlong.httpclientutil.*
+com.arsframework.*
+com.artemkaxboy.*
+com.artemzin.assert-parcelable.*
+com.artemzin.mrobserver.*
+com.artemzin.rxjava.*
+com.artemzin.rxjavav1v2adapter.*
+com.artemzin.rxui.*
+com.artemzin.rxui2.*
+com.artfii.amq.*
+com.artfii.fluentsql.*
+com.arthenica.*
+com.arthurivanets.*
+com.arthurivanets.arvi.*
+com.arthuryidi.provider.*
+com.articulatesoftware.*
+com.artipie.*
+com.artisan-software.glide.*
+com.artistech.*
+com.artit-k.*
+com.artnaseef.*
+com.artofsolving.*
+com.arturmkrtchyan.kafka.*
+com.arturmkrtchyan.mintds.*
+com.arturmkrtchyan.sizeof4j.*
+com.arunpattni.*
+com.arusarka.*
+com.arxanfintech.*
+com.aryaemini.*
+com.aryaemini.nvi.*
+com.asahaf.javacron.*
+com.asamm.*
+com.asana.*
+com.asankha.*
+com.asarkar.grpc.*
+com.asarkar.kotlinx.*
+com.asarkar.spring.*
+com.asayama.docs.gwt.angular.*
+com.asayama.docs.gwt.angular.examples.*
+com.asayama.gwt.*
+com.asayama.gwt.angular.*
+com.asayama.gwt.bootstrap.*
+com.asayama.gwt.fa.*
+com.asayama.gwt.jquery.*
+com.ascendcorp.*
+com.ascert.open.*
+com.aserto.*
+com.ashampoo.*
+com.ashokvarma.android.*
+com.ashtonit.*
+com.asidatascience.*
+com.asikatechnologies.*
+com.asikatechnologies.android.*
+com.askfast.askfastapi.*
+com.askfast.strowger.sdk.*
+com.asksira.android.*
+com.asosyalbebe.*
+com.aspectran.*
+com.asprise.imaging.*
+com.asprise.ocr.*
+com.asprotunity.*
+com.asprotunity.queryiteasy.*
+com.asrevo.*
+com.asrevo.archetypes.*
+com.asrevo.cloud.*
+com.assaabloyglobalsolutions.axon.dynamodb.*
+com.assaydepot.*
+com.assembla.scala-incubator.*
+com.assemblade.cat.*
+com.assertthat.*
+com.assertthat.plugins.*
+com.assist4j.*
+com.assist4j.boot.*
+com.assylias.*
+com.astamuse.*
+com.astercasc.*
+com.astralanguage.*
+com.astrapay.*
+com.astrepid.*
+com.astuetz.*
+com.astutebits.*
+com.asual.lesscss.*
+com.asymmetrik.*
+com.asyncant.aws.lambda.*
+com.asyncant.crypto.*
+com.asyncapi.*
+com.asyncexcel.*
+com.ataopro.*
+com.ataraxer.*
+com.atatctech.*
+com.atatus.apm.*
+com.athaydes.*
+com.athaydes.automaton.*
+com.athaydes.gradle.osgi.*
+com.athaydes.javanna.*
+com.athaydes.jgrab.*
+com.athaydes.kanvas.*
+com.athaydes.keepup.*
+com.athaydes.logfx.*
+com.athaydes.osgiaas.*
+com.athaydes.pony.gradle.*
+com.athaydes.protobuf.*
+com.athaydes.rawhttp.*
+com.atilika.kuromoji.*
+com.atinternet.*
+com.atiurin.*
+com.atjava.*
+com.atlan.*
+com.atlascopco.*
+com.atlassian.*
+com.atlassian.amps.*
+com.atlassian.ari.*
+com.atlassian.asap.*
+com.atlassian.bamboo.*
+com.atlassian.bamboo.specs.extension.*
+com.atlassian.bitbucket.codeinsights.*
+com.atlassian.bootgraph.*
+com.atlassian.buildeng.*
+com.atlassian.clover.*
+com.atlassian.commonmark.*
+com.atlassian.connect.*
+com.atlassian.dummy.*
+com.atlassian.jgitflow.*
+com.atlassian.labs.*
+com.atlassian.marketplace.*
+com.atlassian.maven.archetypes.*
+com.atlassian.maven.enforcer.*
+com.atlassian.maven.plugins.*
+com.atlassian.oai.*
+com.atlassian.performance.judgement.*
+com.atlassian.plugins.*
+com.atlassian.pom.*
+com.atlassian.ratelimit.*
+com.atlassian.stash.*
+com.atlassian.stride.*
+com.atlassian.ta.*
+com.atlassian.usercontext.*
+com.atlassian.xmlrpc.*
+com.atolcd.alfresco.*
+com.atomgraph.*
+com.atomgraph.etl.aws.kinesis.*
+com.atomgraph.etl.csv.*
+com.atomgraph.etl.json.*
+com.atomicjar.*
+com.atomicleopard.*
+com.atomicleopard.thundr.*
+com.atomikos.*
+com.atomkus.*
+com.atommerce.*
+com.atommiddleware.*
+com.atomscat.*
+com.atooma.*
+com.atsid.*
+com.att.aft.*
+com.att.ajsc.*
+com.att.authz.*
+com.att.cadi.*
+com.att.camel.*
+com.att.cdp.*
+com.att.eelf.*
+com.att.inno.*
+com.att.m2x.*
+com.att.nsa.*
+com.att.ocnp.mgmt.*
+com.att.research.xacml.*
+com.att.scld.*
+com.att.woorea.*
+com.attafitamim.mtproto.*
+com.attafitamim.navigation.*
+com.attafitamim.room.*
+com.attafitamim.sensor.*
+com.attensa.*
+com.attentive.*
+com.attestr.*
+com.attivio.platform.*
+com.attivio.platform.archetypes.*
+com.attraqt.*
+com.atviettelsolutions.*
+com.atypon.wayf.*
+com.audienceproject.*
+com.audioburst.*
+com.auginte.*
+com.augmentedlogic.flere.service.*
+com.augmentedlogic.flere.toolkit.*
+com.augmentedlogic.flere.ui.*
+com.augmentedlogic.jettpack.*
+com.augmentedlogic.pbkdf2tool.*
+com.augmentedlogic.simplefeedreader.*
+com.augmentedlogic.simpleslack.*
+com.augustbonds.*
+com.augustcellars.cose.*
+com.augustl.*
+com.augustnagro.*
+com.augusttechgroup.*
+com.auiucloud.*
+com.aukletapm.go.*
+com.auntvt.*
+com.aurelhubert.*
+com.aureusapps.*
+com.aureusapps.android.*
+com.auritylab.*
+com.auritylab.graphql-kotlin-toolkit.*
+com.auryc.*
+com.austindewey.*
+com.austindoupnik.gnc4j.*
+com.austinv11.harmony.*
+com.austinv11.servicer.*
+com.autentia.*
+com.auterion.*
+com.auth0.*
+com.auth0.android.*
+com.authkit.*
+com.authlete.*
+com.authme.*
+com.authsignal.*
+com.authy.*
+com.authzed.api.*
+com.authzee.kotlinguice4.*
+com.autocommunicationshub.*
+com.autodesk.*
+com.autofrog.xbee.*
+com.autognizant.*
+com.automacent.*
+com.automatak.lib4s.*
+com.automateitapp.*
+com.automatic.*
+com.automation-remarks.*
+com.automationrockstars.*
+com.automationrockstars.design.*
+com.automationrockstars.gunter.*
+com.automattic.*
+com.automattic.android.*
+com.autonomousapps.*
+com.autonomousapps.dependency-analysis.*
+com.autonomouslogic.commons.*
+com.autonomouslogic.customspecfilter.*
+com.autonomouslogic.dynamomapper.*
+com.autonomouslogic.jacksonobjectstream.*
+com.autonomouslogic.microsql.*
+com.autoscout24.gradle.*
+com.autotec.sdk.*
+com.autsia.bracer.*
+com.auxilii.msgparser.*
+com.av8data.*
+com.avakkachen.*
+com.avalon-inc.web.*
+com.avanza.astrix.*
+com.avanza.gs.*
+com.avanza.hystrix.*
+com.avanza.mimer.*
+com.avanza.ymer.*
+com.avast.*
+com.avast.bytes.*
+com.avast.client.*
+com.avast.clients.rabbitmq.*
+com.avast.clients.storage.*
+com.avast.cloud.*
+com.avast.gradle.*
+com.avast.gradle.docker-compose.*
+com.avast.grpc.*
+com.avast.grpc.jwt.*
+com.avast.hashes.*
+com.avast.metrics.*
+com.avatao.tfw.sdk.*
+com.avengerpenguin.*
+com.avenida.banten.*
+com.aventrix.jnanoid.*
+com.aventstack.*
+com.avides.gitlab.*
+com.avides.lambda.*
+com.avides.spring.*
+com.avides.springboot.springtainer.*
+com.avides.springboot.testcontainer.*
+com.avides.xml.*
+com.avides.xpath.*
+com.avidintelli.surveysdk.*
+com.avihu-harush.*
+com.avioconsulting.*
+com.avioconsulting.maven.*
+com.avioconsulting.mule.*
+com.avionos.aem.akamai.*
+com.avionos.aem.cacheablerenditions.*
+com.avionos.aem.experienceframework.*
+com.avionos.aem.foundation.*
+com.avionos.aem.modellist.*
+com.avionos.aem.rootpageinjector.*
+com.avionos.aem.veneer.*
+com.avira.couchdoop.*
+com.avito.android.*
+com.avojak.mojo.*
+com.avonfitzgerald.*
+com.avrios.mvn.plugin.*
+com.avsystem.anjay.*
+com.avsystem.commons.*
+com.avsystem.scex.*
+com.awareframework.*
+com.awilton.*
+com.awilton.junit.kafka.*
+com.axellience.*
+com.axialworks.spring.modules.*
+com.axiastudio.*
+com.axibase.*
+com.axinfu.*
+com.axiomalaska.*
+com.axisapplications.*
+com.axisj.*
+com.axlabs.*
+com.axlradius.*
+com.axokoi.*
+com.axondevgroup.*
+com.axonibyte.bonemesh.*
+com.axonivy.*
+com.axonivy.ivy.ci.*
+com.axonivy.ivy.test.*
+com.axonivy.ivy.webtest.*
+com.axtstar.*
+com.axway.ats.distrib.*
+com.axway.ats.expectj.*
+com.axway.ats.framework.*
+com.axway.ats.framework.agent.*
+com.axway.ats.framework.agent.standalone.*
+com.axway.ats.framework.agent.webapp.*
+com.axway.ats.framework.examples.*
+com.axway.ats.framework.utilities.*
+com.axway.ats.gnu.classpath.ext.*
+com.axway.ats.httpdblogger.*
+com.axway.ats.testexplorer.*
+com.axzae.*
+com.aye10032.*
+com.aylien.newsapi.*
+com.aylien.sita.newsapi.*
+com.aylien.textapi.*
+com.aylvn.*
+com.aymanmadkour.jgears.*
+com.ayoprez.*
+com.ayushsingla.dblib.*
+com.azaptree.*
+com.azavea.*
+com.azavea.geotrellis.*
+com.azavea.stac4s.*
+com.azerion.*
+com.azimo.*
+com.azuqua.*
+com.azure.*
+com.azure.android.*
+com.azure.cosmos.spark.*
+com.azure.data.*
+com.azure.resourcemanager.*
+com.azure.spring.*
+com.azure.tools.*
+com.azurenight.maven.*
+com.azuriom.*
+com.azwul.api.*
+com.b0c0.*
+com.b0ve.*
+com.b2wdigital.*
+com.b2wdigital.iafront.*
+com.b2wdigital.iafront.persistense.*
+com.b3dgs.*
+com.b3dgs.lionengine.*
+com.b3dgs.radialencapsulation.*
+com.baadl.*
+com.baasbox.*
+com.baasflow.events.*
+com.baayso.*
+com.bablooka.*
+com.baboaisystem.*
+com.babylonhealth.*
+com.babylonhealth.lit.*
+com.backbase.oss.*
+com.backbase.oss.deferredresources.*
+com.backblaze.b2.*
+com.backelite.*
+com.backendless.*
+com.backpackcloud.*
+com.backstopsolutions.*
+com.backtype.*
+com.bacoder.box.*
+com.bacoder.jgit.*
+com.bacoder.parser.*
+com.bacoder.scm-tools.*
+com.badlogicgames.*
+com.badlogicgames.ashley.*
+com.badlogicgames.box2dlights.*
+com.badlogicgames.gdx-controllers.*
+com.badlogicgames.gdx.*
+com.badlogicgames.gdxpay.*
+com.badlogicgames.jamepad.*
+com.badlogicgames.jglfw.*
+com.badlogicgames.jlayer.*
+com.badlogicgames.packr.*
+com.badoo.mobile.*
+com.badoo.reaktive.*
+com.baerbak.maven.*
+com.baffalotech.*
+com.bagridb.*
+com.bagsvaerd-crypto.*
+com.bagtag.ebt-framework.*
+com.bagtag.ebt-library.*
+com.bagtag.ebtframework.*
+com.bah.*
+com.bah.jmockit.*
+com.bah.jmockit.com.googlecode.jmockit.*
+com.bah.lucene.*
+com.bahadirakin.*
+com.bahmanm.*
+com.baidao.android.wizardpager.*
+com.baidu.*
+com.baidu.aip.*
+com.baidu.apm.*
+com.baidu.beidou.*
+com.baidu.bifromq.*
+com.baidu.cfc.*
+com.baidu.cloud.*
+com.baidu.dev2.*
+com.baidu.disconf.*
+com.baidu.dueros.*
+com.baidu.hugegraph.*
+com.baidu.iot.*
+com.baidu.jprotobuf.*
+com.baidu.lbs.*
+com.baidu.lbsyun.*
+com.baidu.mapapi.*
+com.baidu.mapp.*
+com.baidu.maven.*
+com.baidu.mobads.*
+com.baidu.mobstat.*
+com.baidu.openrasp.*
+com.baidu.unbiz.*
+com.baidu.xuper.*
+com.baidubce.*
+com.baidubce.cfc.*
+com.baidubce.faas.*
+com.baidubce.formula.*
+com.baidubce.mediasdk.*
+com.baifendian.*
+com.bailizhang.lynxdb.*
+com.bakdata.*
+com.bakdata.common-kafka-streams.*
+com.bakdata.dedupe.*
+com.bakdata.fluent-kafka-streams-tests.*
+com.bakdata.generic-avro-reflect.*
+com.bakdata.gradle.*
+com.bakdata.jool2.*
+com.bakdata.kafka.*
+com.bakdata.kserve.*
+com.bakdata.seq2.*
+com.bakgethwa.*
+com.balajeetm.mystique.*
+com.balancedpayments.*
+com.balihoo.sdk.*
+com.baliset.*
+com.baloise.maven.*
+com.balysv.*
+com.balysv.materialmenu.*
+com.bambora.checkout.*
+com.bamfaltech.*
+com.bancstac.*
+com.bancvue.*
+com.bandiago.libs.*
+com.bandwidth.*
+com.bandwidth.java.*
+com.bandwidth.sdk.*
+com.bandyer.*
+com.bangdb.*
+com.banjocreek.riverbed.*
+com.banno.*
+com.banxa.*
+com.banxware.*
+com.banzaicloud.*
+com.baojieearth.*
+com.baomibing.*
+com.baomidou.*
+com.baoquan.*
+com.baozhizhi.miniapis.*
+com.baptistecarlier.kotlin.datagouvfr.*
+com.baqend.*
+com.barbarysoftware.*
+com.barchart.*
+com.barchart.base.*
+com.barchart.feed.*
+com.barchart.http.*
+com.barchart.kitfox.*
+com.barchart.pivot.*
+com.barchart.udt.*
+com.barchart.util.*
+com.barchart.version.tester.*
+com.barchart.wrap.*
+com.barcke.y.*
+com.bardframework.*
+com.barelogics.*
+com.baremaps.*
+com.baremetalcloud.*
+com.barista-v.*
+com.baristav.bugreporter.*
+com.baristav.debugartist.*
+com.barrybecker4.*
+com.barryzhang.*
+com.bartoszgajda.scalaopenweathermap.*
+com.bartoszlipinski.*
+com.bartoszlipinski.flippablestackview.*
+com.bartoszlipinski.intdefs.*
+com.bartoszlipinski.recyclerviewheader.*
+com.bartoszlipinski.rxanimationbinding.*
+com.basarsoft.gradle.*
+com.base2art.*
+com.base4j.*
+com.basgeekball.*
+com.bashhead.maven.*
+com.basho.riak.*
+com.basho.riak.hadoop.*
+com.basho.riak.protobuf.*
+com.basho.riak.test.*
+com.basicex.*
+com.basicfu.*
+com.basicfu.log.*
+com.basicfu.sip.*
+com.basistech.*
+com.basistech.maven.plugins.*
+com.basistech.org.apache.httpcomponents.*
+com.basistech.rosette.*
+com.basistech.tclre.*
+com.basksoft.*
+com.basksoft.report.*
+com.bastengao.freeroute.*
+com.bastly.*
+com.bastly.android.*
+com.batch.android.*
+com.batoulapps.adhan.*
+com.battcn.*
+com.battcn.boot.*
+com.battcn.cloud.*
+com.baudoliver7.*
+com.baulsupp.*
+com.baulsupp.kolja.*
+com.bayer.*
+com.baynote.*
+com.bayudwiyansatria.*
+com.bazaarvoice.*
+com.bazaarvoice.astyanax.*
+com.bazaarvoice.auth.*
+com.bazaarvoice.awslocal.*
+com.bazaarvoice.bvandroidsdk.*
+com.bazaarvoice.bvkotlinsdk.*
+com.bazaarvoice.cms.*
+com.bazaarvoice.commons.*
+com.bazaarvoice.commons.data.*
+com.bazaarvoice.commons.scala.*
+com.bazaarvoice.curator.*
+com.bazaarvoice.dropwizard.*
+com.bazaarvoice.elasticsearch.client.*
+com.bazaarvoice.emodb.*
+com.bazaarvoice.jackson.*
+com.bazaarvoice.jolt.*
+com.bazaarvoice.jsonpps.*
+com.bazaarvoice.maven.plugins.*
+com.bazaarvoice.ostrich.*
+com.bazaarvoice.ostrich.examples.*
+com.bazaarvoice.ostrich.examples.calculator.*
+com.bazaarvoice.ostrich.examples.dictionary.*
+com.bazaarvoice.ostrich.zookeeper.*
+com.bazaarvoice.snitch.*
+com.bazarnazar.*
+com.bazoud.elasticsearch.*
+com.bazoud.metrics.*
+com.bbende.tripod.*
+com.bbn.adept.*
+com.bbn.bue.*
+com.bbn.nlp.*
+com.bbn.poi.visio.*
+com.bbossgroups.*
+com.bbossgroups.activiti.*
+com.bbossgroups.bigdata.*
+com.bbossgroups.boot.*
+com.bbossgroups.pdp.*
+com.bbossgroups.plugins.*
+com.bbossgroups.rpc.*
+com.bbossgroups.security.*
+com.bbossgroups.security.auth.*
+com.bbrownsound.*
+com.bbva.arq.devops.ae.mirrorgate.*
+com.bbva.ndb.*
+com.bcdiploma.*
+com.bcgdv.*
+com.bcgdv.jwt.*
+com.bchun.*
+com.bdeastmoney.ai.*
+com.bdhobare.*
+com.be-bound.*
+com.be-hase.grpc-micrometer.*
+com.be-hase.lamtils.*
+com.be-hase.output-capture.*
+com.bea.wlplatform.*
+com.bea.xml.*
+com.beabravedude.*
+com.beachape.*
+com.beachape.extensions.*
+com.beachape.filemanagement.*
+com.beachape.metascraper.*
+com.beachape.unlesswhen.*
+com.beacon50.*
+com.beaglesecurity.*
+com.bealearts.collection.*
+com.bealetech.*
+com.beamly.*
+com.beamly.flumeback.*
+com.beamly.playpen.*
+com.beanbeanjuice.*
+com.beanit.*
+com.beanstream.api.*
+com.beardedhen.*
+com.bearwaves.*
+com.beastwall.*
+com.beatjs.android.*
+com.beautiful-scala.*
+com.beautrace.*
+com.bedatadriven.*
+com.bedatadriven.spss.*
+com.bedrockstreaming.*
+com.bee.*
+com.beehyv.*
+com.beeinstant.*
+com.beekeeperdata.*
+com.beelego.*
+com.beepbell.*
+com.beepiz.blegattcoroutines.*
+com.beeswax.*
+com.beetstra.jutf7.*
+com.befovy.fijkplayer.*
+com.begcode.*
+com.behaviosec.cloud.*
+com.behsacorp.*
+com.beijunyi.*
+com.beijunyi.parallelgit.*
+com.beimin.*
+com.beirtipol.*
+com.bekioui.jaxrs.*
+com.bekioui.maven.plugin.*
+com.bekioui.netty.jaxrs.*
+com.bekioui.parent.*
+com.bekioui.plugin.*
+com.bekk.boss.*
+com.belerweb.*
+com.beli-tech.*
+com.belladati.*
+com.bellotapps.archetypes.*
+com.bellotapps.the-messenger.*
+com.bellotapps.utils.*
+com.bellotapps.webapps.*
+com.belteshazzar.*
+com.benasher44.*
+com.benayn.*
+com.benbarkay.htmltopdf.*
+com.bendb.droptools.*
+com.bendb.dropwizard.*
+com.bendb.influx.*
+com.bendb.placeholders.*
+com.bendb.thrifty.*
+com.benfante.paypal.*
+com.benmccann.*
+com.bennyhuo.*
+com.bennyhuo.kotlin.*
+com.bennyhuo.kotlin.apt.*
+com.bennyhuo.kotlin.plugin.deepcopy.*
+com.bennyhuo.kotlin.plugin.embeddable.*
+com.bennyhuo.kotlin.plugin.embeddable.test.*
+com.bennyhuo.kotlin.reflect.*
+com.bennyhuo.kotlin.trimindent.*
+com.bennyhuo.tieguanyin.*
+com.benoitquenaudon.*
+com.benromberg.nopackagecycles.*
+com.beowulfchain.*
+com.beowulfe.hap.*
+com.berbix.*
+com.bericotech.*
+com.berlioz.*
+com.bernardomg.cli.*
+com.bernardomg.maven.*
+com.bernardomg.maven.archetypes.*
+com.bernardomg.maven.skins.*
+com.bernardomg.tabletop.*
+com.bernardomg.tabletop.dreadball.*
+com.bernardomg.velocity.*
+com.berryworks.*
+com.bertoncelj.*
+com.bertoncelj.dropwizard.*
+com.bertoncelj.hibernatejson.*
+com.bertoncelj.jdbi.entitymapper.*
+com.bertoncelj.wildflysingletonservice.*
+com.bertramlabs.plugins.*
+com.bespinglobal.alertnow.*
+com.besselstudio.*
+com.bestellensoftware.*
+com.bestvike.*
+com.bestxty.*
+com.betfair.caching.*
+com.betfair.cougar.*
+com.betfair.net.java.opendmk.*
+com.betfair.platform.*
+com.betfair.plugins.*
+com.betfair.sre.*
+com.betfair.tornjak.*
+com.bettercloud.*
+com.betterconfig.*
+com.beust.*
+com.bevuta.*
+com.beyondconstraint.sqlking.*
+com.beyongx.*
+com.bfjournal.*
+com.bgasparotto.*
+com.bhaptics.player.*
+com.bhaptics.tactosy.*
+com.bhinneka.coral.*
+com.bhullnatik.*
+com.bi-instatag.*
+com.biasee.giru.*
+com.biboheart.*
+com.bicou.*
+com.bidstack.*
+com.bidstack.adapters.*
+com.bigcay.excel.*
+com.bigchaindb.*
+com.bigcloud.djomo.*
+com.bigdullrock.*
+com.bigelectrons.joesan.*
+com.bignerdranch.android.*
+com.bigossp.*
+com.bigsonata.swarm.*
+com.bigstep.*
+com.bihe0832.android.*
+com.bijava.*
+com.bikeemotion.*
+com.bilal-fazlani.*
+com.bilal-fazlani.zio-mongo.*
+com.bilalalp.*
+com.biligle.exclude.*
+com.biligle.mix.*
+com.billdingsoftware.*
+com.bimbr.*
+com.bimface.*
+com.bimromatic.*
+com.binance4j.*
+com.binaryfork.*
+com.binarytale.*
+com.binarytale.jee.*
+com.binarytweed.*
+com.bingchunmoli.*
+com.bingzer.android.*
+com.bingzer.android.ads.*
+com.bingzer.android.ads.networks.amazon.*
+com.bingzer.android.ads.networks.google.*
+com.bingzer.android.ads.networks.leadbolt.*
+com.bingzer.android.ads.networks.mobfox.*
+com.bingzer.android.async.*
+com.bingzer.android.cloudy.*
+com.bingzer.android.dbv.*
+com.bingzer.android.driven.*
+com.bingzer.android.eula.*
+com.bingzer.android.patterns.*
+com.binishmatheww.*
+com.bio-matic.*
+com.bio-matic.labeledseekslider.*
+com.bionicspirit.*
+com.bipinet.cubes.*
+com.bipinet.pointsdistance.*
+com.biqasoft.*
+com.birbit.*
+com.bisahealth.*
+com.bisna.*
+com.bisnode.kafka.authorization.*
+com.bisnode.logging.*
+com.bisnode.opa.*
+com.bit-scout.*
+com.bitactor.framework.cloud.spring.*
+com.bitactor.framework.cloud.spring.boot.*
+com.bitactor.framework.core.*
+com.bitalino.*
+com.bitbreeds.crypto.*
+com.bitbreeds.p2p.*
+com.bitbreeds.webrtc.*
+com.bitcoinpaygate.*
+com.bitheads.*
+com.bitmark.sdk.*
+com.bitmechanic.*
+com.bitmovin.api.*
+com.bitmovin.api.sdk.*
+com.bitmovin.bitcodin.api.*
+com.bitmoving.util.*
+com.bitoex.*
+com.bitofcode.*
+com.bitofcode.archetype.*
+com.bitofcode.oss.sdk.*
+com.bitpay.*
+com.bitplan.*
+com.bitplan.antlr.*
+com.bitplan.can4eve.*
+com.bitplan.dragtop.*
+com.bitplan.gui.*
+com.bitplan.multimodule.*
+com.bitplan.pdfextractor.*
+com.bitplan.pdfindex.*
+com.bitplan.pom.*
+com.bitplan.radolan.*
+com.bitplan.rest.*
+com.bitplan.simplegraph.*
+com.bitplan.sprinkler.*
+com.bitplan.vcard.*
+com.bitplan.vzjava.*
+com.bitplan.wikifrontend.*
+com.bitso.*
+com.biuqu.*
+com.bizmda.bizsip.*
+com.bizo.*
+com.bizrateinsights.*
+com.bjiaolong.*
+com.bjoernkw.*
+com.bjondinc.*
+com.bkahlert.*
+com.bkahlert.kommons.*
+com.bkahlert.koodies.*
+com.bkood.*
+com.black-kamelia.sprinkler.*
+com.blackbirdai.*
+com.blackbuild.devops.docalot.*
+com.blackbuild.groovy.dsl.config.*
+com.blackbuild.groovycps.*
+com.blackbuild.jenkins.groovy-cps.*
+com.blackbuild.jenkins.shared-lib.*
+com.blackbuild.klum.ast.*
+com.blackbuild.klum.common.*
+com.blackbuild.klum.wrap.*
+com.blackbuild.multicli.*
+com.blackbuild.tools.cliwrapper.*
+com.blackducksoftware.integration.*
+com.blackducksoftware.plugins.*
+com.blacklane.jvm.*
+com.blacklocus.*
+com.blacklocus.jres.*
+com.blacklocus.queue-slayer.*
+com.blacksquircle.ui.*
+com.blackteachan.bttools.*
+com.bladecoder.engine.*
+com.bladecoder.ink.*
+com.bladecoder.packr.*
+com.bladejava.*
+com.blandware.android.atleap.*
+com.blankj.*
+com.blastedstudios.*
+com.blautic.*
+com.blazebit.*
+com.blazegraph.*
+com.blazegraph.sample.*
+com.blazemeter.*
+com.blibli.oss.*
+com.blibli.oss.helpers.*
+com.blibli.oss.sellerapi.client.*
+com.blingblingbang.*
+com.blinkbox.books.*
+com.blinkfox.*
+com.blitline.*
+com.blitz-chain.*
+com.blitzllama.*
+com.blockchain.*
+com.blockchyp.*
+com.blockpie.*
+com.blockpointdb.*
+com.blockscore.*
+com.blocktyper.*
+com.blocktyper.localehelper.*
+com.blogspot.ctasada.gwt-eureka.*
+com.blogspot.geekabyte.jprowork.*
+com.blogspot.geekabyte.krawkraw.*
+com.blogspot.geekabyte.krwkrw.*
+com.blogspot.geekabyte.webmuncher.*
+com.blogspot.mydailyjava.*
+com.blogspot.ostas.*
+com.blogspot.tonyatkins.*
+com.blogspot.toomuchcoding.*
+com.bloidonia.*
+com.bloock.sdk.*
+com.bloogefest.*
+com.bloomberg.*
+com.bloomscorp.*
+com.bloomscorp.bmx-spring-base.*
+com.blossom-project.*
+com.blossom-project.tools.*
+com.bloxbean.*
+com.bloxbean.cardano.*
+com.blr19c.*
+com.blue-veery.*
+com.blueapron.*
+com.bluebillywig.*
+com.bluebillywig.bbnativeplayersdk.*
+com.bluebreezecf.*
+com.bluecatcode.common.*
+com.bluecatcode.core.*
+com.bluecatcode.fj.*
+com.bluecatcode.guava.*
+com.bluecatcode.hamcrest.*
+com.bluecatcode.junit.*
+com.bluecatcode.mockito.*
+com.bluecatcode.time.*
+com.bluecats.*
+com.bluecirclesoft.open.*
+com.blueconic.*
+com.bluefirereader.*
+com.bluejeans.*
+com.bluejeans.aws.lambda.*
+com.bluejeans.common.*
+com.bluejeans.lambadaframework.*
+com.bluelinelabs.*
+com.bluelock.*
+com.bluelotussoftware.*
+com.bluematador.maven.*
+com.bluenimble.serverless.*
+com.blueshift.*
+com.bluetangstudio.*
+com.bluetangstudio.common.*
+com.bluetrailsoft.drowsinessmodule.*
+com.bluetrainsoftware.*
+com.bluetrainsoftware.bathe.*
+com.bluetrainsoftware.bathe.initializers.*
+com.bluetrainsoftware.bathe.web.*
+com.bluetrainsoftware.classpathscanner.*
+com.bluetrainsoftware.common.*
+com.bluetrainsoftware.composite.*
+com.bluetrainsoftware.composites.*
+com.bluetrainsoftware.dtogen.*
+com.bluetrainsoftware.gerrit.*
+com.bluetrainsoftware.maven.*
+com.bluetrainsoftware.maven.plugins.*
+com.bluetrainsoftware.parent.*
+com.bluetrainsoftware.tiles.*
+com.blukii.*
+com.blurscope.*
+com.bluslee.*
+com.bluurr.*
+com.bmc.truesight.saas.*
+com.bmsi.*
+com.bmuschko.*
+com.bnd-lib.*
+com.bnorm.*
+com.bnorm.auto.weave.*
+com.bnorm.junit5.contingent.*
+com.bnorm.ktor.retrofit.*
+com.bnorm.patchwork.*
+com.bnorm.power.*
+com.bnorm.react.*
+com.bnsal.*
+com.bnyte.*
+com.bobkevic.jackson.datatype.*
+com.bobpaulin.camel.*
+com.bobpaulin.jmeter.*
+com.bobpaulin.maven.jsonp.*
+com.bodybank.*
+com.bodybuilding.turbine.*
+com.bogdwellers.*
+com.boivie.*
+com.bojiw.*
+com.boku.*
+com.bol.*
+com.boletobancario.*
+com.bolyartech.ezlambda.*
+com.bolyartech.forge.*
+com.bolyartech.forge.server.*
+com.bolyartech.scram_sasl.*
+com.bonree.*
+com.bookegou.*
+com.booking.*
+com.booking.validator.*
+com.bookislife.*
+com.booleworks.*
+com.boonlogic.*
+com.boot4j.*
+com.bootdao.*
+com.bootvue.common.*
+com.boozallen.cognition.*
+com.borachio.*
+com.borasoftware.balau.*
+com.borax12.materialdaterangepicker.*
+com.bordercloud.*
+com.bordereast.ninja.*
+com.borjaglez.*
+com.bornium.*
+com.bortbort.arduino.*
+com.bot4s.*
+com.botbox.*
+com.botion.android.*
+com.botnerd.core.*
+com.botplatform.*
+com.botronsoft.cmj.spi.*
+com.botscrew.*
+com.botscrew.botframework.*
+com.bouncestorage.*
+com.boundary.*
+com.boundary.dropwizard.consul.*
+com.boutouil.*
+com.bowlingx.*
+com.bowriverstudio.*
+com.box.*
+com.box20six.*
+com.boxfish.*
+com.boxframework.*
+com.boyunjian.flashdb.*
+com.bpfaas.*
+com.bpodgursky.*
+com.bq.*
+com.bq.corbel.*
+com.bq.corbel.lib.*
+com.bq.oss.*
+com.bq.oss.corbel.*
+com.bq.oss.lib.*
+com.bq.private.*
+com.braango.*
+com.bradcypert.*
+com.bradleydwyer.*
+com.bradneighbors.buildable.*
+com.bradneighbors.builders.*
+com.bradrydzewski.*
+com.bradyaiello.deepprint.*
+com.bradyid.*
+com.braimanm.*
+com.brainodev.gnfr.*
+com.braintreepayments.*
+com.braintreepayments.api.*
+com.braintreepayments.gateway.*
+com.braisgabin.detekt.*
+com.brambolt.*
+com.brambolt.gradle.*
+com.brambolt.wildfly.*
+com.brambolt.wrench.*
+com.brandongogetap.*
+com.brandontoner.*
+com.brandwatch.*
+com.brandwatch.mixpanel.*
+com.brayanjules.*
+com.braze.*
+com.breakingequity.*
+com.breinify.*
+com.brendangoldberg.*
+com.brentcroft.*
+com.brentcroft.tools.*
+com.breskeby.rewrite.*
+com.bretpatterson.*
+com.brettonw.*
+com.brettonw.bedrock.*
+com.breuninger.boot.*
+com.brewinapps.*
+com.brewtab.*
+com.brewtab.json.*
+com.briangriffey.*
+com.brianmowen.*
+com.brianpritchett.*
+com.brienwheeler.*
+com.brienwheeler.apps.*
+com.brienwheeler.dist.*
+com.brienwheeler.lib.*
+com.brienwheeler.svc.*
+com.brienwheeler.web.*
+com.brienwheeler.web.js.*
+com.brienwheeler.web.tags.*
+com.brightback.oss.*
+com.brightcove.*
+com.brightcove.metrics.*
+com.brightcove.zencoder.api.*
+com.brightsparklabs.*
+com.brihaspathee.aphrodite.*
+com.brihaspathee.artemis.*
+com.brihaspathee.operation.*
+com.brihaspathee.quotes.*
+com.brihaspathee.zeus.*
+com.bring.*
+com.bringg.*
+com.brinkus.labs.*
+com.brinvex.*
+com.brinvex.util.*
+com.britesnow.*
+com.brkt.*
+com.broadcom.*
+com.broadlume.*
+com.broeskamp.*
+com.broeskamp.monorepo.gradle.plugin.*
+com.broeskamp.monorepo.gradle.plugin.base.*
+com.broeskamp.monorepo.gradle.plugin.kotlin-android.*
+com.broeskamp.monorepo.gradle.plugin.multiplatform-mobile-lib.*
+com.broeskamp.monorepo.gradle.plugin.multiplatform.*
+com.broeskamp.monorepo.gradle.plugin.quarkus.*
+com.broeskamp.monorepo.gradle.plugin.settings.*
+com.broeskamp.monorepo.gradle.plugin.vue-app.*
+com.bronto.api.*
+com.bronto.oss.*
+com.brotherlogic.*
+com.brotherlogic.discogs.*
+com.brotherlogic.recordcollection.*
+com.browseengine.bobo.*
+com.browserstack.*
+com.browserup.*
+com.brsanthu.*
+com.brucebat.*
+com.brucepang.*
+com.brucezee.jspider.*
+com.brunokrebs.*
+com.brunomcustodio.math.numbertheory.*
+com.brunomnsilva.*
+com.brunooliveira.droidnate.*
+com.brvith.orchestrator.*
+com.bryanherbst.openssl-checker.*
+com.bryghts.apptemplate.*
+com.bryghts.enum.*
+com.bryghts.ftypes-array.*
+com.bryghts.ftypes-caseclass.*
+com.bryghts.ftypes-string.*
+com.bryghts.ftypes-vals.*
+com.bryghts.ftypes.*
+com.bryghts.jbegood.*
+com.bryghts.kissdata.*
+com.bryghts.kissjson.*
+com.bryghts.kissmx.*
+com.bryghts.kissnumber.*
+com.bryghts.numerics.*
+com.bryghts.thecollector.*
+com.bsb.common.vaadin.*
+com.bsb64.*
+com.bsgrd.treasurer.*
+com.bsgrd.treasurer.edifact.*
+com.bsmoot.*
+com.bstek.uflo.*
+com.bstek.ureport.*
+com.bstek.urule.*
+com.btaz.datautil.*
+com.btaz.util.*
+com.btc-ag.redg.*
+com.btcassessors.*
+com.btgpactualsolutions.etd.*
+com.btjava.*
+com.btmatthews.atlas.*
+com.btmatthews.hamcrest.*
+com.btmatthews.jaxb2_commons.*
+com.btmatthews.jcrunit.*
+com.btmatthews.junit.*
+com.btmatthews.ldapunit.*
+com.btmatthews.maven.plugins.*
+com.btmatthews.maven.plugins.inmemdb.*
+com.btmatthews.maven.plugins.ldap.*
+com.btmatthews.mojo.*
+com.btmatthews.selenium.junit4.*
+com.btmatthews.springboot.*
+com.btmatthews.utils.*
+com.btoddb.*
+com.btye102.*
+com.buabook.*
+com.bucket4j.*
+com.bucuoa.west.*
+com.buddy.*
+com.budhash.cliche.*
+com.budjb.*
+com.budongfeng.*
+com.budwk.nb.*
+com.buession.*
+com.buession.cas.*
+com.buession.logging.*
+com.buession.security.*
+com.buession.springboot.*
+com.buession.springcloud.*
+com.buession.springcloud.stream.*
+com.bug-cloud.*
+com.bugfender.sdk.*
+com.buglife.sdk.*
+com.bugsee.*
+com.bugsnag.*
+com.bugsplat.*
+com.bugtags.android.*
+com.bugtags.library.*
+com.bugtags.metrics.*
+com.bugvm.*
+com.buildkite.test-collector-android.*
+com.buildkite.test-collector-android.unit-test-collector-plugin.*
+com.buildops.*
+com.builtamont.*
+com.bulk-inc.*
+com.bullhorn.*
+com.bulucat.*
+com.bumao.model.*
+com.bumao.models.yuquesdk.*
+com.bumble.appyx.*
+com.bungleton.*
+com.bunjlabs.fuga.*
+com.buralo.*
+com.buralo.spring.boot.memcached.*
+com.buransky.*
+com.burdinov.*
+com.burhanrashid52.*
+com.burningmime.*
+com.buschmais.asciidoctorj.*
+com.buschmais.cdo.*
+com.buschmais.jaxbfx.*
+com.buschmais.jqassistant.*
+com.buschmais.jqassistant.archetype.*
+com.buschmais.jqassistant.cli.*
+com.buschmais.jqassistant.core.*
+com.buschmais.jqassistant.distribution.*
+com.buschmais.jqassistant.doc.*
+com.buschmais.jqassistant.examples.*
+com.buschmais.jqassistant.maven.*
+com.buschmais.jqassistant.neo4j.*
+com.buschmais.jqassistant.neo4jserver.*
+com.buschmais.jqassistant.plugin.*
+com.buschmais.jqassistant.scm.*
+com.buschmais.jqassistant.sonar.*
+com.buschmais.jqassistant.test.*
+com.buschmais.x2j.nocomment.*
+com.buschmais.xo.*
+com.bushangbuxia.*
+com.bushidowallet.*
+com.busyducks.*
+com.busymachines.*
+com.butor.*
+com.butreik.dmask.*
+com.buttercms.*
+com.buttercms.android.*
+com.buttercoin.*
+com.butterfill.*
+com.butterflymx.*
+com.butterflymx.sdk.call.*
+com.butterflymx.sdk.core.*
+com.buyexpressly.*
+com.buyi.recyclerviewpagerindicator.*
+com.buzzilla.*
+com.buzzmsg.android.*
+com.buzzmsg.sdk.*
+com.bwsw.*
+com.bybutter.compose.*
+com.bybutter.sisyphus.*
+com.bybutter.sisyphus.deploy.*
+com.bybutter.sisyphus.k8s.*
+com.bybutter.sisyphus.middleware.*
+com.bybutter.sisyphus.project.*
+com.bybutter.sisyphus.proto.*
+com.bybutter.sisyphus.protobuf.*
+com.bybutter.sisyphus.starter.*
+com.bybutter.sisyphus.tools.*
+com.byclosure.maven.plugins.*
+com.byclosure.webcat.*
+com.bynder.*
+com.byoutline.androidstubserver.*
+com.byoutline.cachedfield.*
+com.byoutline.eventbuscachedfield.*
+com.byoutline.eventcallback.*
+com.byoutline.ibuscachedfield.*
+com.byoutline.mockserver.*
+com.byoutline.observablecachedfield.*
+com.byoutline.ottocachedfield.*
+com.byoutline.ottoeventcallback.*
+com.byoutline.secretsauce.*
+com.byoutline.secretsauce.views.*
+com.bystr.stemkit.*
+com.byteblogs.*
+com.bytebreakstudios.*
+com.bytebreakstudios.gdx.*
+com.bytebybyte.*
+com.bytebybyte.gwt.*
+com.bytedance.*
+com.bytedance.android.*
+com.bytedance.applog.*
+com.bytedance.btrace.*
+com.bytedance.tools.codelocator.*
+com.bytedance.tools.lancet.*
+com.bytedance.ultimate.inflater.*
+com.bytedanceapi.*
+com.bytedesk.*
+com.bytegain.analytics.*
+com.byteground.*
+com.bytehappy.*
+com.bytekast.*
+com.byteowls.*
+com.byteplus.*
+com.bytes-pot.*
+com.bytesgo.*
+com.byteshaft.requests.*
+com.bytesizebook.*
+com.byteslounge.*
+com.bzzzapp.*
+com.c05mic.generictree.*
+com.c0x12c.exposed.codegen.*
+com.c0x12c.exposed.postgis.*
+com.c2.fit.*
+com.c332030.*
+com.c332030.commons.*
+com.c332030.mybatis.*
+com.c4-soft.springaddons.*
+com.c4-soft.springaddons.samples.*
+com.c4-soft.springaddons.starter.*
+com.ca.apim.*
+com.ca.apim.gateway.*
+com.cadenzauk.*
+com.caffeineowl.*
+com.caffinc.*
+com.caffinc.jetter.*
+com.caffinc.sparktools.*
+com.caiotte.framework.*
+com.caitaojun.*
+com.caitaojun.codegenerator.*
+com.caitaojun.ctjdfs.*
+com.caitaojun.ctjwebmvc.*
+com.cakupan.*
+com.calendarfx.*
+com.cali-lang.*
+com.calincosma.*
+com.callcontrol.*
+com.callibrity.logging.*
+com.callidusrobotics.rrb4j.*
+com.callr.*
+com.campudus.*
+com.campusdual.*
+com.camunda.consulting.*
+com.camunda.consulting.util.*
+com.camunda.consulting.webapp.*
+com.camunda.consulting.webapp.plugin.*
+com.canelmas.let.*
+com.cankoluman.*
+com.canoo.*
+com.canoo.dolphin-platform.*
+com.canoo.dolphin.*
+com.canoo.webtest.*
+com.canopas.intro-showcase-view.*
+com.canopas.jetcountrypicker.*
+com.cantaa.*
+com.cantrowitz.*
+com.canva.*
+com.caoccao.javet.*
+com.caojiantao.*
+com.capacitorjs.*
+com.capgemini.mrchecker.*
+com.capgemini.ntc.*
+com.capgemini.oss.maven.master.*
+com.capgemini.platina.*
+com.capgemini.platina.maven.*
+com.capgemini.platina.maven.release.*
+com.capitalone.dashboard.*
+com.capitaltg.*
+com.caravelo.*
+com.carbonribbon.*
+com.cardatechnologies.*
+com.cardinalsolutions.*
+com.cardinfolink.smart.pos.*
+com.cardinity.*
+com.cardiomood.android.*
+com.cardpay.*
+com.carecon.fabric3.*
+com.carecon.fabric3.gradle.*
+com.careem.mockingbird.*
+com.carelesscoyotes.remotedata.*
+com.carepay.*
+com.caretdev.*
+com.careykevin.*
+com.caringo.client.*
+com.cariochi.*
+com.cariochi.recordo.*
+com.cariochi.reflecto.*
+com.carlonzo.ecdsa.*
+com.carlonzo.ukey2.*
+com.carlosbecker.*
+com.carlosedp.*
+com.carlosmuvi.segmentedprogressbar.*
+com.carltian.*
+com.carma.*
+com.carmanconsulting.cassidy.*
+com.carmanconsulting.hibiscus.*
+com.carmatechnologies.cassandra.*
+com.carmatechnologies.commons.*
+com.carmatechnologies.maven.*
+com.carmatechnologies.servlet.*
+com.carmatechnologies.utilities.*
+com.carrotgarden.a.*
+com.carrotgarden.base.*
+com.carrotgarden.jwrapper.*
+com.carrotgarden.log.*
+com.carrotgarden.maven.*
+com.carrotgarden.maven.wagons.*
+com.carrotgarden.nexus.*
+com.carrotgarden.osgi.*
+com.carrotgarden.shocon.*
+com.carrotgarden.sjs.*
+com.carrotgarden.util.*
+com.carrotgarden.wrap.*
+com.carrotsearch.*
+com.carrotsearch.console.*
+com.carrotsearch.elasticsearch-lingo3g.7.7.1.com.carrotsearch.*
+com.carrotsearch.gradle.opts.*
+com.carrotsearch.jdk19.*
+com.carrotsearch.progresso.*
+com.carrotsearch.randomizedtesting.*
+com.carrotsearch.thirdparty.*
+com.cars.*
+com.carterchen247.*
+com.carthooks.*
+com.carto.*
+com.carto.analyticstoolbox.*
+com.casadetasha.*
+com.caseykulm.oauthheader.*
+com.caseykulm.retroravelry.*
+com.cashfree.*
+com.cashfree.pg.*
+com.cashfree.pg.java.*
+com.cashlez.android.*
+com.cassbana.*
+com.cast-info.devops.*
+com.castlemon.maven.*
+com.casualmiracles.*
+com.casualsuperman.*
+com.casualsuperman.portent.*
+com.casualsuperman.portent.engines.*
+com.catchpoint.*
+com.cathive.*
+com.cathive.fonts.*
+com.cathive.fx.*
+com.cathive.fx.inject.*
+com.cathive.sass.*
+com.catify.bpmn.*
+com.catppuccin.*
+com.catwithawand.*
+com.catyee.mybatis.*
+com.caucho.*
+com.causecode.plugins.*
+com.caverock.*
+com.cbruegg.mensaupbservice-common.*
+com.cc-hc.*
+com.ccadllc.cedi.*
+com.ccbill.*
+com.ccbsoftware.*
+com.ccfraser.muirwik.*
+com.ccheptea.auto.value.*
+com.ccpayment.*
+com.ccyblog.myfire.*
+com.cdk8s.tkey.*
+com.cdkpatterns.*
+com.cdptech.*
+com.cdrfood.lovelife.*
+com.cebest.*
+com.cebglobal.*
+com.cedac.spring.security.*
+com.cedarsoft.*
+com.cedarsoft.annotations.*
+com.cedarsoft.asteroids.*
+com.cedarsoft.business.*
+com.cedarsoft.commons.*
+com.cedarsoft.commons.db.*
+com.cedarsoft.commons.history.*
+com.cedarsoft.commons.legacy.*
+com.cedarsoft.commons.old.*
+com.cedarsoft.commons.old.db.*
+com.cedarsoft.commons.old.history.*
+com.cedarsoft.commons.old.legacy.*
+com.cedarsoft.commons.old.rest.*
+com.cedarsoft.commons.old.spring.*
+com.cedarsoft.commons.old.swing.*
+com.cedarsoft.commons.rest.*
+com.cedarsoft.commons.spring.*
+com.cedarsoft.commons.swing-presenter.*
+com.cedarsoft.commons.swing.*
+com.cedarsoft.couchdb.*
+com.cedarsoft.db.*
+com.cedarsoft.dependencies-sets.*
+com.cedarsoft.hudson.*
+com.cedarsoft.maven.*
+com.cedarsoft.open.*
+com.cedarsoft.open.archetype.*
+com.cedarsoft.open.serialization.neo4j.*
+com.cedarsoft.open.serialization.samples.*
+com.cedarsoft.open.serialization.serializers.commons.*
+com.cedarsoft.photos.*
+com.cedarsoft.rest.*
+com.cedarsoft.serialization.*
+com.cedarsoft.serialization.commons-serializers.*
+com.cedarsoft.serialization.generator.*
+com.cedarsoft.serialization.neo4j.*
+com.cedarsoft.serialization.samples.*
+com.cedarsoft.serialization.test.*
+com.cedarsoft.spring.*
+com.cedarsoft.tags.*
+com.cedarsoft.tests.*
+com.cedarsoft.unit.*
+com.cedarsoft.utils.*
+com.cedarsoft.utils.history.*
+com.cedarsoft.utils.legacy.*
+com.cedarsoft.wicket.*
+com.cedarsoftware.*
+com.cedexis.*
+com.cedricwalter.*
+com.cefoler.configuration.*
+com.cefriel.*
+com.cehome.*
+com.ceilfors.groovy.*
+com.ceilfors.maven.plugin.*
+com.celadari.*
+com.celarli.commons.*
+com.celeral.*
+com.celeral.netconf.*
+com.celexus.*
+com.celum.*
+com.cemerick.*
+com.cenqua.clover.*
+com.centit.framework.*
+com.centit.product.*
+com.centit.support.*
+com.centonni.*
+com.central1.buildtools.*
+com.centralway.*
+com.centurylink.cloud.*
+com.centurylink.mdw.*
+com.centurylink.mdw.assets.*
+com.ceph.*
+com.ceph.fs.*
+com.ceram1.*
+com.ceram1.droid.*
+com.ceram1.text.*
+com.ceridwen.circulation.*
+com.ceridwen.util.*
+com.cerner.beadledom.*
+com.cerner.beadledom.avro.*
+com.cerner.bunsen.*
+com.cerner.ccl.*
+com.cerner.ccl.archetype.*
+com.cerner.ccl.cdoc.*
+com.cerner.ccl.comm.*
+com.cerner.ccl.testing.*
+com.cerner.ccl.whitenoise.*
+com.cerner.common.kafka.*
+com.cerner.ftp.*
+com.cerner.marathon.*
+com.cesanta.*
+com.cesarferreira.androidbootstrap.*
+com.cesarferreira.catkit.*
+com.cesarferreira.colorize.*
+com.cesarferreira.crisscross.*
+com.cesarferreira.jsonify.*
+com.cesarferreira.pretender.*
+com.cesarferreira.quickutils.*
+com.cesarferreira.rxpaper.*
+com.cesarferreira.rxpeople.*
+com.cesarvaliente.random_string_generator.*
+com.cetsoft.*
+com.cezarykluczynski.stapi.*
+com.cflewis.hudson.jdepend.*
+com.cgbystrom.*
+com.chain.*
+com.chain.sequence.*
+com.chain5j.*
+com.chainxgame.crypto.*
+com.chaitanyapramod.gradle.*
+com.chalk.*
+com.chalkdigital.*
+com.chan3d.*
+com.changdaowan.*
+com.chanjet.*
+com.chanjx.*
+com.channelape.*
+com.chaochaogege.*
+com.chaoxing.*
+com.chaquo.python.*
+com.chaquo.python.runtime.*
+com.char2lang.*
+com.chargebee.*
+com.chargehound.*
+com.chargemap.android.*
+com.chargemap.android.auto.*
+com.chargemap.compose.*
+com.chargetrip.*
+com.charleex.*
+com.charleex.notifikations.*
+com.charlesahunt.*
+com.charleskorn.kaml.*
+com.charleskorn.okhttp.systemkeystore.*
+com.charlyghislain.authenticator.*
+com.charlyghislain.belcotax.*
+com.charlyghislain.dispatcher.*
+com.charlyghislain.keycloak.*
+com.charminglee911.*
+com.charmingoh.*
+com.charonchui.cyberlink.*
+com.charonchui.framework.*
+com.charonchui.vitamio.*
+com.chartboost.*
+com.chartiq.finsemble.*
+com.chaschev.*
+com.chaseself.*
+com.chat2desk.*
+com.chatroulette.*
+com.chatwork.*
+com.chavaillaz.*
+com.checkdroid.*
+com.checkinpass.iknowlib.*
+com.checkmarx.*
+com.checkmarx.ast.*
+com.checkmarx.maven.*
+com.checkout.*
+com.cheddar.*
+com.cheil-tech.juniverse.*
+com.cheil-tech.retail.*
+com.chelseaurquhart.*
+com.chemdrawcloud.*
+com.chenenyu.*
+com.chenenyu.router.*
+com.chenggongdu.*
+com.chenkaiwei.krest.*
+com.chenkuojun.*
+com.chenlb.mmseg4j.*
+com.chenxiaojie.*
+com.cherokeesoft.*
+com.cherokeesoft.fias.*
+com.cherokeesoft.fias.share.*
+com.cherokeesoft.social.*
+com.chesapeaketechnology.bufmonkey.*
+com.chesapeaketechnology.tools.*
+com.chewords.jsv.*
+com.chfourie.*
+com.chibatching.*
+com.chibatching.kotpref.*
+com.chibchasoft.*
+com.chikli.spring.*
+com.chilipiper.*
+com.chilipotato.springboot.*
+com.chillerlabs.*
+com.chillibits.*
+com.chillycheesy.*
+com.chilmers.config-bootstrapper.*
+com.chimbori.crux.*
+com.chimerapps.*
+com.chimerapps.gradle.*
+com.chimerapps.kotlin-inject-viewmodelfactory.*
+com.chimerapps.niddler.*
+com.chimp-central.*
+com.chinagoods.framework.thinkcloud.*
+com.chinagoods.framework.thinkcloud.quickstart.*
+com.chinamobile.cmos.*
+com.chinanetcenter.wcs.*
+com.chinanetcenter.wcs.sdk.*
+com.chinnsenn.*
+com.chiradip.rediscl.*
+com.chitbazaar.*
+com.chmakered.*
+com.chocodev.*
+com.choncms.*
+com.choodon.common.tool.*
+com.choodon.tool.*
+com.chooongg.utils.*
+com.chooongg.widget.*
+com.chrisalbright.*
+com.chrisdempewolf.*
+com.chrishorner.*
+com.chriskiehl.*
+com.chriskite.*
+com.chrisneveu.*
+com.chrisnewland.*
+com.chrisomeara.*
+com.chrisrenke.giv.*
+com.christianbahl.appkit.*
+com.christiangp.*
+com.christianheina.communication.*
+com.christianheina.langx.*
+com.christobill.*
+com.christophecvb.elitedangerous.*
+com.christophecvb.touchportal.*
+com.christophecvb.touchportal.Packager.*
+com.christophecvb.touchportal.plugin-packager.*
+com.christophsturm.*
+com.christophsturm.failfast.*
+com.christophsturm.restaurant.*
+com.chrnie.*
+com.chrnie.gdr.*
+com.chromasgaming.*
+com.chromaticnoise.*
+com.chromaticnoise.multiplatform-swiftpackage.*
+com.chrylis.*
+com.chrylis.groovybeans.*
+com.chrylis.lib.*
+com.chtsinc.*
+com.chuangke18.*
+com.chuangshios.*
+com.chuckiefan.*
+com.chuklee.code.*
+com.chungkui.*
+com.chutneytesting.*
+com.chuusai.*
+com.ciaransloan.*
+com.ciaransloan.mediapicker.library.*
+com.ciaranwood.*
+com.cibuddy.*
+com.cifaz.tools.*
+com.ciicgat.open.*
+com.ciicgat.sdk.gconf.*
+com.cinchapi.*
+com.cinetpay.*
+com.cinnober.gradle.*
+com.cinnober.msgcodec.*
+com.circle.*
+com.circleci.*
+com.circonus.*
+com.circuitwall.ml.*
+com.circustar.*
+com.cisco.cognitive.*
+com.cisco.deviot.*
+com.cisco.maven.plugins.*
+com.cisco.oss.foundation.*
+com.cisco.oss.foundation.directory.*
+com.cisco.oss.foundation.queue.*
+com.cisco.oss.foundation.tools.*
+com.cisco.spark.android.*
+com.cisco.trex.*
+com.cisco.vss.foundation.*
+com.ciscospark.*
+com.citahub.cita-ee.*
+com.citahub.cita.*
+com.citcon.sdk.*
+com.citrix.*
+com.citrix.hypervisor.*
+com.citrix.netscaler.nitro.*
+com.citrsw.*
+com.citruspay.sdk.*
+com.citycontext.*
+com.citypay.pos.*
+com.citytechinc.aem.*
+com.citytechinc.aem.apps.ionic.*
+com.citytechinc.aem.bedrock.*
+com.citytechinc.aem.groovy.console.*
+com.citytechinc.aem.groovy.extension.*
+com.citytechinc.aem.prosper.*
+com.citytechinc.cq.clientlibs.*
+com.citytechinc.cq.cq-component-plugin.*
+com.citytechinc.maven.plugins.*
+com.cj.*
+com.cj.fintech.*
+com.cj.jshintmojo.*
+com.cj.qunit-test-driver.*
+com.cj.qunit.mojo.*
+com.cj.restspecs.*
+com.cj.restspecs.mojo.*
+com.cjbooms.*
+com.cjcrafter.*
+com.cjmalloy.*
+com.cjoop.*
+com.cjxch.*
+com.cjxch.supermybatis.*
+com.cjyong.base.*
+com.ckeditor.*
+com.ckjava.*
+com.ckkloverdos.*
+com.cklxl.boot.*
+com.claireneveu.*
+com.clarifai.*
+com.clarifai.clarifai-api2.*
+com.clarolab.*
+com.clarolab.bamboo.*
+com.clarolab.http.*
+com.clarolab.jenkins.*
+com.clarolab.selenium.*
+com.clashinspector.*
+com.classactionpl.tz.*
+com.classpass.oss.flink.kotlin.*
+com.classpass.oss.moderntreasury.*
+com.classpass.oss.protobuf.reflection.*
+com.classpass.oss.task-rate-limiter.*
+com.claudiushauptmann.*
+com.clay-tablet.*
+com.cldellow.*
+com.clearbit.*
+com.clearlydecoded.*
+com.clearnlp.*
+com.clearso.*
+com.clearspring.*
+com.clearspring.analytics.*
+com.clebert.jlingua.*
+com.clebert.maven.*
+com.cleeng.*
+com.clemble.test.*
+com.clertonleal.*
+com.clever-age.*
+com.clever-cloud.*
+com.clever-cloud.pulsar4s.*
+com.clever.*
+com.cleveradssolutions.*
+com.clevergang.libs.*
+com.cleveroad.*
+com.cleverpine.*
+com.cleverpush.*
+com.clevertap.*
+com.clevertap.android.*
+com.clevertap.apns.*
+com.clianz.*
+com.clibing.*
+com.clickconcepts.geb.*
+com.clickconcepts.jira.*
+com.clickconcepts.junit.*
+com.clickconcepts.logging.*
+com.clickconcepts.project.*
+com.clickconcepts.spock.*
+com.clickhouse.*
+com.clickntap.*
+com.clickpaas.apaas.*
+com.clickpaas.arch.*
+com.clickpaas.ipaas.*
+com.clickpaas.ipaas.dfa.*
+com.clicksend.*
+com.clicktale.library.*
+com.clickzetta.*
+com.clientoutlook.sonar.*
+com.clivern.*
+com.clockworksms.*
+com.cloopen.*
+com.clostra.*
+com.clostra.newnode.*
+com.closure-sys.*
+com.cloud273.*
+com.cloudant.*
+com.cloudbees.*
+com.cloudbees.aether.*
+com.cloudbees.clickstack.*
+com.cloudbees.cloud_resource.*
+com.cloudbees.event.*
+com.cloudbees.extras.*
+com.cloudbees.jetty.redis.*
+com.cloudbees.marathon.*
+com.cloudbees.maven.plugins.*
+com.cloudbees.maven.release.*
+com.cloudbees.mtslaves.*
+com.cloudbees.openfeature.*
+com.cloudbees.sdk.*
+com.cloudbees.sdk.plugins.*
+com.cloudbees.thirdparty.*
+com.cloudbees.util.*
+com.cloudblue.*
+com.cloudcamphq.*
+com.cloudcontrolled.*
+com.cloudconvert.*
+com.cloudera.livy.*
+com.cloudera.oryx.*
+com.cloudera.sparkts.*
+com.cloudesire.*
+com.cloudesire.catwatcher.*
+com.cloudesire.platform.*
+com.cloudfiveapp.*
+com.cloudfoundry.tothought.*
+com.cloudhopper.*
+com.cloudhopper.proxool.*
+com.cloudimpl.*
+com.cloudimpl.outstack.*
+com.cloudinary.*
+com.cloudipsp.*
+com.cloudnil.*
+com.cloudofficeprint.*
+com.cloudogu.cb.*
+com.cloudogu.conveyor.*
+com.cloudogu.jaxrs-tie.*
+com.cloudogu.spotter.*
+com.cloudogu.versionName.*
+com.cloudphysics.*
+com.cloudrail.*
+com.cloudseal.client.*
+com.cloudsnorkel.*
+com.cloudsponge.*
+com.cloudwise.mobile.android.distribute.*
+com.cloudwise.mobile.android.plugins.*
+com.cloudwise.mobile.android.rewriter.*
+com.cloudxmx.*
+com.clougence.*
+com.clougence.cloudcanal.*
+com.cloutree.*
+com.clouway.*
+com.clouway.fserve.*
+com.clouway.gateway.*
+com.clouway.http.*
+com.clouway.kcqrs.*
+com.clouway.kcqrs.adapters.*
+com.clouway.kcqrs.example.*
+com.clouway.messaging.*
+com.clouway.oauth2.*
+com.clouway.pcache.*
+com.clouway.search.*
+com.clouway.security.*
+com.clouway.testing.*
+com.clouway.testing.datastore.*
+com.clouway.util.*
+com.clovellytech.*
+com.clover.*
+com.clover.cfp.*
+com.clover.sdk.*
+com.clsaa.rest.result.*
+com.cluehub.*
+com.clumd.projects.*
+com.clusterra.*
+com.clutch.*
+com.clutchproject.*
+com.clxcommunications.*
+com.cm.*
+com.cmcim.uprtc.android.*
+com.cmcim.upush.*
+com.cmcim.upush.android.*
+com.cmcim.urtc.android.*
+com.cmeza.*
+com.cmgapps.*
+com.cmgapps.android.*
+com.cmgapps.licenses.*
+com.cmgapps.logtag.*
+com.cmhteixeira.*
+com.cmonbaby.*
+com.cn-abs.*
+com.cn-langong.*
+com.cnautosoft.silver.*
+com.cnbbx.*
+com.cnhnb.sdk.*
+com.cnlive.*
+com.cnosdb.*
+com.cnscud.xpower.*
+com.cnsecloud.plugins.*
+com.cnstrc.*
+com.cnstrc.client.*
+com.cnuf7.*
+com.coalmine.*
+com.coaxys.*
+com.cobber.fta.*
+com.cocoahero.android.*
+com.cocosw.*
+com.cocosw.accessory.*
+com.cocosw.framework.*
+com.cocosw.query.*
+com.codacy.*
+com.codahale.*
+com.codahale.metrics.*
+com.codangcoding.*
+com.codavel.bolina.*
+com.codbex.aion.*
+com.codbex.chronos.*
+com.codbex.kronos.*
+com.code-beacon.spring.boot.*
+com.code-disaster.steamworks4j.*
+com.code-intelligence.*
+com.code-spotter.*
+com.code-troopers.*
+com.code-troopers.betterpickers.*
+com.code-troopers.play.*
+com.code4people.*
+com.code54.mojo.*
+com.code972.*
+com.code972.hebmorph.*
+com.codeabbot.data.*
+com.codeabbot.springframework.data.aerospike.*
+com.codeablereason.restcompress.provider.*
+com.codeaches.*
+com.codeaddslife.koara.*
+com.codeages.*
+com.codeandweb.physicseditor.*
+com.codebal.cache.*
+com.codebirds.cserver.*
+com.codebits.*
+com.codebootup.code-generator.*
+com.codebootup.compare-directories.*
+com.codeborne.*
+com.codeborne.assertlog.*
+com.codeborne.replay.*
+com.codebrauerei.carbone-render-java-api.*
+com.codebreeze.testing.tools.*
+com.codebreeze.text.*
+com.codebullets.saga-lib.*
+com.codebullets.stateless4j.*
+com.codecommit.*
+com.codedak.*
+com.codedreamplus.*
+com.codedx.*
+com.codegik.*
+com.codeheadsystems.*
+com.codeinchinese.*
+com.codejuice.*
+com.codekeepersinc.*
+com.codekutter.zconfig.*
+com.codelawine.wit4j.*
+com.codellyrandom.*
+com.codellyrandom.hassemble.*
+com.codellyrandom.hassle.*
+com.codellyrandom.wiretypescriptgenerator.*
+com.codelouders.*
+com.codemagi.*
+com.codemettle.*
+com.codemettle.akka-snmp4j.*
+com.codemettle.akka-solr.*
+com.codemettle.jsactor.*
+com.codemettle.reactivemq.*
+com.codemettle.scalajs.*
+com.codeminders.*
+com.codeminders.socketio.*
+com.codeminders.socketio.extension.*
+com.codeminders.socketio.sample.*
+com.codeminer42.*
+com.codemonkeylab.idex.*
+com.codemybrainsout.onboarding.*
+com.codemybrainsout.placesearchdialog.*
+com.codemybrainsout.rating.*
+com.codenameone.*
+com.codenuity.jboss.*
+com.codepath.libraries.*
+com.codepiex.droidlibx.*
+com.codepine.api.*
+com.codeplex.jpa4azure.*
+com.codeplex.wsitbt.*
+com.codepoetics.*
+com.codepulsar.nils.*
+com.coder4.*
+com.coder4j.*
+com.coderdreams.*
+com.codereligion.*
+com.coderhop.*
+com.coderhour.*
+com.coderknock.*
+com.coderplus.maven.plugins.*
+com.coderrush.*
+com.coders-kitchen.*
+com.codersguidebook.*
+com.coderslagoon.*
+com.coderslagoon.crypto.*
+com.codesdancing.libraries.*
+com.codesgood.*
+com.codeslap.*
+com.codesnippets4all.*
+com.codesseur.*
+com.codetaco.*
+com.codevblocks.android.*
+com.codevineyard.*
+com.codewithevans.beer-works.*
+com.codeyaa.*
+com.codezjx.library.*
+com.codiform.*
+com.codigine.*
+com.codigine.easylog.*
+com.coding42.*
+com.codingame.*
+com.codingame.gameengine.*
+com.codingapi.*
+com.codingapi.architecture.*
+com.codingapi.leaf.*
+com.codingapi.security.*
+com.codingapi.springboot.*
+com.codingapi.txlcn.*
+com.codingfeline.buildkonfig.*
+com.codingfeline.kgql.*
+com.codingfeline.twitter4kt.*
+com.codingrodent.*
+com.codingrodent.jackson.crypto.*
+com.codingrodent.microprocessor.*
+com.codingue.koops.*
+com.codinguser.android.*
+com.codingzero.utilities.*
+com.coditory.common.*
+com.coditory.freemarker.*
+com.coditory.logback.*
+com.coditory.quark.*
+com.coditory.sherlock.*
+com.codnos.*
+com.codogenic.*
+com.codoid.products.*
+com.codota.*
+com.codspire.plugins.*
+com.codurance.*
+com.codve.*
+com.coearners.android.*
+com.coekie.gentyref.*
+com.coeuy.*
+com.cognifide.aem.*
+com.cognifide.aet.*
+com.cognifide.apm.*
+com.cognifide.apm.crx.*
+com.cognifide.apmt.*
+com.cognifide.cq.*
+com.cognifide.cq.actions.*
+com.cognifide.maven.plugins.*
+com.cognifide.qa.bb.*
+com.cognifide.qa.bb.mobile.*
+com.cognifide.securecq.*
+com.cognifide.slice-addon.*
+com.cognifide.slice.*
+com.cognite.*
+com.cognite.spark.datasource.*
+com.cognitect.*
+com.cognitect.aws.*
+com.cognodyne.riptide.*
+com.cogpp.*
+com.cogpunk.*
+com.cogvio.*
+com.coherentlogic.*
+com.coherentlogic.cmr.*
+com.coherentlogic.cmr.api.*
+com.coherentlogic.coherent.*
+com.coherentlogic.coherent.data-model.*
+com.coherentlogic.coherent.data.adapter.openfigi.*
+com.coherentlogic.coherent.data.adapter.openfigi.client.*
+com.coherentlogic.coherent.datafeed.*
+com.coherentlogic.coherent.datafeed.client.*
+com.coherentlogic.cusip.global.services.*
+com.coherentlogic.cusip.global.services.client.*
+com.coherentlogic.enterprise-data-adapter.*
+com.coherentlogic.fraser.client.*
+com.coherentlogic.fred.*
+com.coherentlogic.fred.client.*
+com.coherentlogic.gama.*
+com.coherentlogic.gama.client.*
+com.coherentlogic.geofred.client.*
+com.coherentlogic.lei.*
+com.coherentlogic.lei.client.*
+com.coherentlogic.quandl.*
+com.coherentlogic.quandl.client.*
+com.coherentlogic.treasurydirect.*
+com.coherentlogic.treasurydirect.client.*
+com.coherentlogic.usaspending.*
+com.coherentlogic.usaspending.client.*
+com.coherentlogic.wb.*
+com.coherentlogic.wb.client.*
+com.cohesiveintegrations.ddf.*
+com.cohesiveintegrations.ddf.feature.*
+com.cohesiveintegrations.ddf.kar.*
+com.cohesiveintegrations.ddf.postgres.*
+com.coilads.*
+com.coinbase.*
+com.coinbase.android.*
+com.coinbase.api.*
+com.coiney.*
+com.coingi.exchange.*
+com.coinmarketadvisor.*
+com.coinquista.*
+com.coinquista.xchange-coinquista.*
+com.coinzway.*
+com.colinalworth.gwt.websockets.*
+com.colintmiller.*
+com.colisweb.*
+com.collabcompute.*
+com.collabnet.labmanagement.api.*
+com.collaborne.*
+com.collaborne.build.*
+com.collaborne.mail.*
+com.collaborne.maven.*
+com.collaborne.operations.*
+com.collaborne.qa.*
+com.collectiveidea.twirp.*
+com.collector.faqbot.*
+com.colleczion.*
+com.colobu.*
+com.colofabrix.scala.*
+com.colorfulsoftware.*
+com.com2us.android.*
+com.com2us.android.hive.*
+com.comapi.*
+com.comcast.*
+com.comcast.cereal.*
+com.comcast.drivethru.*
+com.comcast.dynocon.*
+com.comcast.ibis.*
+com.comcast.magic-wand.*
+com.comcast.money.*
+com.comcast.pantry.*
+com.comcast.video.*
+com.comcast.video.dawg.*
+com.comcast.zucchini.*
+com.comeon.mojo.*
+com.commercetools.*
+com.commercetools.build.iron-maven-plugin.*
+com.commercetools.build.taglets.*
+com.commercetools.i18n.*
+com.commercetools.maven-archetypes.*
+com.commercetools.payment.*
+com.commercetools.rmf.*
+com.commercetools.sdk.*
+com.commercetools.sdk.jvm.contrib.*
+com.commercetools.sdk.jvm.core.*
+com.commercetools.sdk.jvm.reactive-streams.*
+com.commercetools.sdk.jvm.scala-add-ons.*
+com.commercetools.sdk.jvm.spring.*
+com.commercetools.sunrise.*
+com.commercetools.sunrise.cms.*
+com.commercetools.sunrise.email.*
+com.commercetools.sunrise.payment.*
+com.commit451.*
+com.commongroundpublishing.*
+com.commonwealthrobotics.*
+com.commsen.*
+com.commsen.em.*
+com.commsen.em.contractors.*
+com.commsen.maven.*
+com.commsen.stopwatch.api.*
+com.commsen.wedeploy.*
+com.communicate.*
+com.comoyo.*
+com.comoyo.commons.*
+com.comoyo.maven.plugins.*
+com.comoyo.protobuf.*
+com.comparizen.*
+com.compdf.*
+com.competentum.com.zaxxer.*
+com.compilit.*
+com.complexible.stardog.*
+com.componentcorp.xml.validation.*
+com.composables.*
+com.composum.aem.*
+com.composum.ai.*
+com.composum.assets.*
+com.composum.chatgpt.*
+com.composum.dashboard.*
+com.composum.meta.ist.*
+com.composum.meta.sling.dependencies.*
+com.composum.nodes.*
+com.composum.nodes.osgi.*
+com.composum.nodes.setup.*
+com.composum.nodes.test.*
+com.composum.pages.*
+com.composum.pages.options.*
+com.composum.platform.*
+com.composum.platform.features.*
+com.composum.sling.core.*
+com.composum.sling.core.osgi.*
+com.composum.sling.core.setup.*
+com.composum.sling.parent.*
+com.composum.sling.platform.*
+com.comprotechnologies.*
+com.compscikaran.*
+com.compstak.*
+com.computablefacts.*
+com.computinglaboratory.*
+com.comscore.*
+com.comsysto.buildlight.*
+com.concurrentli.*
+com.concurrentthought.cla.*
+com.conditionallyconvergent.*
+com.conductor.*
+com.conekta.library-java.*
+com.conena.anrdetective.*
+com.conena.nanokt.*
+com.conena.therlock.*
+com.confidentify.*
+com.configcat.*
+com.configx.*
+com.confirmit.mobilesdk.*
+com.confluex.*
+com.confluex.mule.*
+com.conghuahuadan.*
+com.congta.spring.*
+com.conjecto.graphstore.*
+com.connctd.tracing.stackdriver.*
+com.connect-group.*
+com.connectedcooking.opcua.*
+com.connectedinteractive.*
+com.connectedlab.reactnative.*
+com.connectifex.*
+com.connectifier.xero.*
+com.connectsdk.*
+com.connexta.arbitro.*
+com.connexta.arbitro.distribution.*
+com.connexta.arbitro.documentation.*
+com.connexta.arbitro.samples.*
+com.connexta.arbitro.samples.custom.algo.*
+com.connexta.arbitro.samples.hierarchical.resource.*
+com.connexta.arbitro.samples.image.filtering.*
+com.connexta.arbitro.samples.kmarket.trading.*
+com.connexta.arbitro.utils.*
+com.connexta.libera.*
+com.connexta.libero.core.*
+com.connexta.libero.distribution.*
+com.connorgarvey.gradle.*
+com.consol.citrus.*
+com.consol.citrus.archetypes.*
+com.consol.citrus.model.*
+com.consol.citrus.mvn.*
+com.consolefire.*
+com.consoliads.*
+com.constantcontact.*
+com.consultwithcase.patternplus.*
+com.contaazul.*
+com.contactlab.api.*
+com.contactlab.hub.*
+com.contacto.*
+com.contedevel.*
+com.contentful.generator.*
+com.contentful.java.*
+com.contentful.vault.*
+com.contentgrid.opa-java-client.*
+com.contentgrid.spring.*
+com.contentgrid.starter.*
+com.contentgrid.thunx.*
+com.contentsquare.android.*
+com.contentsquare.android.v1.*
+com.contentstack.*
+com.contentstack.persistence.*
+com.contentstack.sdk.*
+com.contextcue.*
+com.contiamo.*
+com.continuuity.*
+com.continuuity.tephra.*
+com.contrastsecurity.*
+com.contrastsecurity.scan.*
+com.control-j.*
+com.control-j.cjlog.*
+com.control-j.xlayout.*
+com.controlsjs.*
+com.controlsjs.controls4j.*
+com.convergencelabs.*
+com.conversantmedia.*
+com.conversantmedia.gdpr.*
+com.conversationkit.*
+com.convertapi.client.*
+com.convertigo.sdk.*
+com.conveyal.*
+com.convious.*
+com.conviva.sdk.*
+com.convolution-ai.*
+com.cookieinformation.*
+com.cookingfox.*
+com.cookpad.puree-kotlin.*
+com.cooladata.android.*
+com.cooldatasoft.*
+com.cooldb.*
+com.coolerfall.*
+com.coopstools.*
+com.copyleaks.sdk.*
+com.coralogix.*
+com.coralogix.sdk.*
+com.coralogix.sdk.appenders.*
+com.coravy.hudson.plugins.github.*
+com.cord.*
+com.cordial.cordialsdk.*
+com.coredot.*
+com.corelightservices.*
+com.coreos.*
+com.coreoz.*
+com.corezoid.gitcall.*
+com.corgibytes.*
+com.cornfluence.*
+com.coronaide.lockdown.*
+com.coroptis.*
+com.coroptis.coidi.*
+com.coroptis.cubiculus.*
+com.corp2world.*
+com.corrily.*
+com.corsano.sdk.*
+com.corundumstudio.socketio.*
+com.corunet.*
+com.coscale.sdk-java.*
+com.cosium.aspirin.*
+com.cosium.code.*
+com.cosium.elasticsearch.testcontainers.*
+com.cosium.hal_mock_mvc.*
+com.cosium.html.*
+com.cosium.jai-imageio.*
+com.cosium.jmx_configurator_for_logback.*
+com.cosium.junixsocket.*
+com.cosium.logging.*
+com.cosium.matrix_communication_client.*
+com.cosium.maven_oss.*
+com.cosium.meta_configuration_spring_extension.*
+com.cosium.murmur.*
+com.cosium.murmur.examples.*
+com.cosium.murmur.extensions.*
+com.cosium.murmur.storage.*
+com.cosium.openapi.*
+com.cosium.openid_connect.*
+com.cosium.spring.data.*
+com.cosium.synapse_junit_extension.*
+com.cosium.vet.*
+com.cosium.web_native_messaging_host.*
+com.cosmian.*
+com.cosmicpush.*
+com.cosminsanda.*
+com.cossacklabs.com.*
+com.cottacush.*
+com.cottsoft.*
+com.cottsoft.thrift.framework.*
+com.couchace.*
+com.couchbase.*
+com.couchbase.cblite.*
+com.couchbase.client.*
+com.couchbase.jdbc.*
+com.couchbase.lite.*
+com.couchbase.mock.*
+com.couchbase.test.*
+com.countvajhula.*
+com.courier.*
+com.coveo.*
+com.coverity.*
+com.coverity.security.*
+com.coverity.security.pie.*
+com.coveros.*
+com.covisint.*
+com.covisint.core.*
+com.covisint.core.http.service.*
+com.covisint.core.support.hibernate.*
+com.covisint.platform.authn.*
+com.covisint.platform.authn.client.*
+com.covisint.platform.authn.core.*
+com.covisint.platform.group.*
+com.covisint.platform.group.client.*
+com.covisint.platform.group.core.*
+com.covisint.platform.legacy.*
+com.covisint.platform.oauth.*
+com.covisint.platform.oauth.client.*
+com.covisint.platform.oauth.core.*
+com.covisint.platform.organization.*
+com.covisint.platform.organization.client.*
+com.covisint.platform.organization.core.*
+com.covisint.platform.service.*
+com.covisint.platform.service.client.*
+com.covisint.platform.service.core.*
+com.covisint.platform.user.*
+com.covisint.platform.user.client.*
+com.covisint.platform.user.core.*
+com.coviu.*
+com.coxautodata.*
+com.coxautodev.*
+com.cpjit.*
+com.cq1080.*
+com.cqsudu.*
+com.cqweh.boot.*
+com.cqweh.cloud.*
+com.cra.figaro.*
+com.craftandtechnology.*
+com.craigburke.*
+com.craigburke.angular.*
+com.craigburke.asset.*
+com.craigburke.document.*
+com.craigburke.gradle.*
+com.crankuptheamps.*
+com.crashinvaders.basisu.*
+com.crashinvaders.lml.*
+com.crashinvaders.vfx.*
+com.crashlytics.sdk.android.*
+com.crashnote.*
+com.crasoftinc.*
+com.craterdog.*
+com.craterdog.bali.*
+com.craterdog.java-security-framework.*
+com.craterdog.maven-parent-poms.*
+com.crawlbase.*
+com.crawljax.*
+com.crawljax.plugins.*
+com.crawljax.plugins.archetypes.*
+com.craxiom.*
+com.crazyitn.*
+com.crazysunj.*
+com.cre8ivelogix.*
+com.crealytics.*
+com.createsend.*
+com.creativa77.*
+com.creativewidgetworks.*
+com.credenza3.credenzapassport.*
+com.credibledoc.*
+com.creditdatamw.labs.*
+com.creditkarma.*
+com.creeaaakk.*
+com.creemama.swingconsole.*
+com.crescendocollective.magnolia.*
+com.crescentflare.bitletsynchronizer.*
+com.crescentflare.datainjector.*
+com.crescentflare.dynamicappconfig.*
+com.crescentflare.jsoninflator.*
+com.crescentflare.simplemarkdownparser.*
+com.crescentflare.smartmock.*
+com.crescentflare.unilayout.*
+com.cribbstechnologies.clients.*
+com.crimsonhexagon.*
+com.crionuke.bolts.*
+com.criteo.*
+com.criteo.carbonara.*
+com.criteo.cuttle.*
+com.criteo.hadoop.*
+com.criteo.java.*
+com.criteo.lolhttp.*
+com.criteo.mediation.google.*
+com.criteo.mediation.mopub.*
+com.criteo.publisher.*
+com.criteo.rundeck.plugin.*
+com.criteo.scala-schemas.*
+com.criteo.socco.*
+com.critizr.*
+com.crittercism.*
+com.crittercism.dexmaker.*
+com.crivano.*
+com.crobox.*
+com.crobox.clickhouse.*
+com.croct.client.*
+com.cronutils.*
+com.crossbowffs.remotepreferences.*
+com.crossbrowsertesting.*
+com.crosstreelabs.*
+com.crowdproj.*
+com.crowdscriber.captions.*
+com.croxel.cxble.*
+com.crswty.kind.*
+com.cruftbusters.*
+com.crunchyjelly.*
+com.crygier.*
+com.cryptape.cita.*
+com.crypteron.*
+com.cryptlex.android.lexactivator.*
+com.cryptlex.android.lexfloatclient.*
+com.cryptlex.lexactivator.*
+com.cryptlex.lexfloatclient.*
+com.cryptomkt.api.*
+com.cryptoregistry.*
+com.csfacturacion.csreporter.*
+com.csicit.ace.*
+com.csicit.thirdparty.*
+com.csitte.*
+com.ctaiot.*
+com.ctc.wstx.*
+com.ctection.*
+com.ctection.CPermManager.*
+com.ctlok.*
+com.ctosb.*
+com.ctp.cdi.query.*
+com.ctrip.ferriswheel.*
+com.ctrip.flight.mmkv.*
+com.ctrip.framework.apollo.*
+com.ctrip.kotlin.*
+com.ctrlflow.aer.client.*
+com.ctrlflow.aer.client.bundles.*
+com.ctrlflow.aer.client.repositories.*
+com.ctrlplusz.*
+com.ctrlplusz.anytextview.*
+com.cuchazinteractive.*
+com.cucumbergoodies.seleium.*
+com.cueker.util.*
+com.cuenca.*
+com.cueup.hegemon.*
+com.cuisongliu.*
+com.cultureamp.*
+com.cuneytayyildiz.*
+com.cupenya.agent.activiti.*
+com.cupenya.agent.common.*
+com.curalate.*
+com.currencycloud.currencycloud-java.*
+com.currencyfair.*
+com.curtrostudios.socialoidlibrary.*
+com.custardsource.*
+com.custardsource.dybdob.*
+com.custardsource.parfait.*
+com.customer-alliance.*
+com.customlbs.android.*
+com.customweb.*
+com.cuubez.*
+com.cvent.*
+com.cwbase.*
+com.cwpad.*
+com.cxense.sdk.*
+com.cxytiandi.*
+com.cyberark.*
+com.cyberark.conjur.api.*
+com.cybercom.logging.*
+com.cybermkd.*
+com.cybersource.*
+com.cybozu.kintone.*
+com.cybozu.labs.*
+com.cyc.*
+com.cyc.aggregate.*
+com.cyc.maven.*
+com.cyc.model.*
+com.cyc.model.maven.*
+com.cyc.ws.client.*
+com.cyc.xml.*
+com.cyclone-technology.*
+com.cynance.*
+com.cyngn.ambient.*
+com.cyngn.vertx.*
+com.cyphercove.coveprefs.*
+com.cyphercove.covetools.*
+com.cyphercove.flexbatch.*
+com.cyphercove.gdx.*
+com.cyphercove.gdxtween.*
+com.cyqdata.*
+com.cyrildever.*
+com.cyrusinnovation.*
+com.cyrusinnovation.computation-engine.*
+com.cyssxt.*
+com.czertainly.*
+com.czetsuyatech.*
+com.d-project.*
+com.d-velop.sdk.*
+com.d0x7.*
+com.d0x7.utils.*
+com.d3xsystems.*
+com.d4iot.oss.plugin.ci.*
+com.d4iot.oss.plugin.packager.*
+com.d4iot.oss.standards.*
+com.daaao.*
+com.daaso-consultancy.*
+com.daasyyds.flink.*
+com.daasyyds.presto.*
+com.daasyyds.spark.*
+com.dadapush.client.*
+com.dadrox.*
+com.daedafusion.*
+com.daedafusion.mitre.*
+com.dafei1288.*
+com.dafruits.*
+com.daftmobile.redukt.*
+com.dagm.*
+com.dahanis.*
+com.dahuatech.harriet.icc.*
+com.dahuatech.icc.*
+com.daikit.*
+com.dailymotion.dailymotion-sdk-android.*
+com.dailymotion.kinta.*
+com.daimajia.*
+com.daimajia.androidanimations.*
+com.daimajia.androidviewhover.*
+com.daimajia.easing.*
+com.daimajia.numberprogressbar.*
+com.daimajia.slider.*
+com.daimajia.swipelayout.*
+com.daimakuai.*
+com.daioWare.collections.*
+com.daioware.*
+com.daioware.ai.*
+com.daioware.collections.*
+com.daioware.file.*
+com.daioware.language.*
+com.daioware.mail.*
+com.daioware.music.*
+com.daioware.net.*
+com.daioware.net.http.*
+com.daioware.repo.*
+com.daioware.repository.*
+com.daioware.security.*
+com.daioware.service.*
+com.daioware.types.*
+com.daioware.web.*
+com.daiyc.lark.*
+com.dajudge.color-diff.*
+com.dajudge.kindcontainer.*
+com.dajudge.proxybase.*
+com.dajudge.yabuto.*
+com.dakuupa.*
+com.dallaslu.*
+com.dallaslu.ioc.*
+com.damavis.*
+com.dameng.*
+com.damick.*
+com.daml.*
+com.daml.extensions.*
+com.daml.java.*
+com.daml.ledger.*
+com.daml.ledger.testtool.*
+com.daml.scala.*
+com.damnhandy.*
+com.dampcake.*
+com.danavalerie.util.*
+com.dancecrane.shadow.core.*
+com.dancecrane.shadow.dynamic.*
+com.dancingcode.*
+com.dangbei.*
+com.dangdang.*
+com.danhaywood.isis.domainservice.*
+com.danhaywood.isis.wicket.*
+com.danhaywood.java.*
+com.danhaywood.mavendeps.*
+com.danhaywood.mavenmixin.*
+com.danidemi.*
+com.danidemi.jlubricant.*
+com.danidemi.obfuscatedids.*
+com.daniel-araujo.byteringbuffer.*
+com.daniel-araujo.wavio.*
+com.danielasfregola.*
+com.danielebachicchi.badgelogk.*
+com.danielfariati.*
+com.danielflower.apprunner.*
+com.danielflower.crickam.*
+com.danielflower.ronin.muserver.*
+com.danielfrak.code.*
+com.danielgmyers.flux.clients.swf.*
+com.danielgmyers.metrics.*
+com.danielsanrocha.*
+com.danielsomerfield.dependencycheck.*
+com.danieltrinh.*
+com.danklco.*
+com.danylchuk.*
+com.danyuanblog.framework.*
+com.daodecode.*
+com.daoxuehao.java.*
+com.darainfo.*
+com.darkrockstudios.*
+com.darksci.*
+com.darrenfang.*
+com.darrinholst.*
+com.darwinsys.*
+com.darylteo.*
+com.darylteo.gradle.*
+com.darylteo.vertx.*
+com.dasasian.chok.*
+com.dasberg.maven.plugins.*
+com.dasburo.*
+com.dashjoin.*
+com.dashx.*
+com.dastanapps.dastanlib.*
+com.data-artisans.*
+com.data-artisans.streamingledger.*
+com.data-scientists.*
+com.dataart.*
+com.databaseflow.*
+com.databasesandlife.*
+com.databend.*
+com.databricks.*
+com.databricks.labs.*
+com.datadoghq.*
+com.datadoghq.okhttp3.*
+com.dataheaps.*
+com.dataliquid.*
+com.dataliquid.maven.*
+com.datalogics.pdfl.*
+com.datameshgroup.fusion.*
+com.datamotion.*
+com.datamountaineer.*
+com.datanew.happyreport.*
+com.datarank.*
+com.datarobot.*
+com.datarpm.sigma.*
+com.datasalt.pangool.*
+com.dataseat.*
+com.datasift.client.*
+com.datasift.dropwizard.*
+com.datasift.dropwizard.scala.*
+com.datasonnet.*
+com.datastax.*
+com.datastax.astra.*
+com.datastax.cassandra.*
+com.datastax.dse.*
+com.datastax.junitpytest.*
+com.datastax.oss.*
+com.datastax.oss.quarkus.*
+com.datastax.oss.simulacron.*
+com.datastax.spark.*
+com.datastax.stargate.*
+com.datastax.wikitext.*
+com.datatheorem.android.trustkit.*
+com.datathings.*
+com.datatiny.tools.*
+com.datatorrent.*
+com.datengaertnerei.test.*
+com.datlinq.*
+com.dato.*
+com.datomic.*
+com.datorama.oss.*
+com.dattack.*
+com.datto.*
+com.datumbox.*
+com.daugeldauge.kinzhal.*
+com.daveanthonythomas.moshipack.*
+com.daveayan.*
+com.davegurnell.*
+com.davemorrissey.labs.*
+com.daveoxley.cbus.*
+com.davfx.*
+com.davfx.ninio.*
+com.davidarvelo.*
+com.davidbracewell.*
+com.davidehrmann.vcdiff.*
+com.davideicardi.*
+com.davidjohnburrowes.*
+com.davidkarlsen.commonstransaction.spring.*
+com.davidlj95.*
+com.dawex.weaver.*
+com.dawninfotek.*
+com.dawnwarriors.*
+com.daxzel.*
+com.day.*
+com.day.commons.*
+com.day.commons.osgi.wrapper.*
+com.day.cq.*
+com.day.cq.collab.*
+com.day.cq.dam.*
+com.day.cq.mcm.*
+com.day.cq.portlet.*
+com.day.cq.wcm.*
+com.day.cq.workflow.*
+com.day.cqfs.*
+com.day.cqse.*
+com.day.crx.*
+com.day.crx.sling.*
+com.day.jcr.vault.*
+com.day.packageshare.*
+com.db-objekts.*
+com.dbdeploy.*
+com.dbhys.*
+com.dbrsn.*
+com.dbrsn.scalajs.react.components.*
+com.dbtsai.lbfgs.*
+com.dbvis.*
+com.dc2f.*
+com.dcsquare.*
+com.dcssn.*
+com.ddfplus.jaws.*
+com.ddswireless.ivt.*
+com.ddubyat.*
+com.de-swaef.*
+com.deadpan-gamez.*
+com.debacharya.*
+com.decafhub.*
+com.decathlon.*
+com.decathlon.phrase.*
+com.decathlon.phraseapp.*
+com.decathlon.tzatziki.*
+com.decathlon.vitamin.*
+com.decathlon.vitamin.compose.*
+com.deciphernow.*
+com.decipherzone.*
+com.decisionlens.*
+com.declarativesystems.*
+com.decodified.*
+com.dedipresta.*
+com.deduce.ingest.*
+com.deep007.*
+com.deepakshankar.*
+com.deepblueai.quixmart.*
+com.deepl.api.*
+com.deepleaper.*
+com.deeplyinc.listen.cloud.sdk.*
+com.deeplyinc.listen.sdk.*
+com.deeplyinc.recorder.*
+com.deepnetts.*
+com.deepoove.*
+com.deere.isg.*
+com.deere.isg.work-tracker.*
+com.deere.isg.work-tracker.examples.*
+com.deevvi.*
+com.defano.jmonet.*
+com.defano.jsegue.*
+com.definesys.mpaas.*
+com.defrimhsn.*
+com.deftlabs.*
+com.degoos.*
+com.degrendel.*
+com.dekayd.*
+com.dekses.*
+com.dekux.*
+com.deliganli.*
+com.deliver8r.*
+com.deliver8r.aws.*
+com.deliveredtechnologies.*
+com.delivereo.*
+com.deliveryhero.litics.*
+com.deliveryhero.whetstone.*
+com.dell.cpsd.*
+com.dell.cpsd.common.client.*
+com.dell.cpsd.common.messaging.*
+com.dell.cpsd.component.*
+com.dell.cpsd.rcm.fitness.keystore.*
+com.dell.doradus.*
+com.dell.isg.smi.*
+com.delphix.*
+com.delprks.*
+com.deltaprojects.*
+com.deltax.tracker.*
+com.demandware.appsec.*
+com.demkada.*
+com.demonwav.hypo.*
+com.demonwav.mcdev.*
+com.denghb.*
+com.dengyuman.*
+com.denimgroup.threadfix.*
+com.denisfesenko.*
+com.deniskonovalyenko.*
+com.denormans.facebook-gwt.*
+com.denormans.google-analytics-gwt.*
+com.dependencysec.*
+com.dependencywatcher.*
+com.deploygate.*
+com.deploymentzone.*
+com.depmesh.*
+com.deptagency.*
+com.deque.*
+com.deque.android.*
+com.deque.html.axe-core.*
+com.derplicity.*
+com.desarrollodroide.*
+com.descope.*
+com.designisdead.*
+com.desmondtzq.ktor.*
+com.desmondyeung.hashing.*
+com.despegar.*
+com.despegar.integration.*
+com.despegar.maven.plugin.*
+com.detectlanguage.*
+com.detmir.recycli.*
+com.detour.*
+com.detrack.elasticroute.*
+com.deusdatsolutions.*
+com.dev-smart.*
+com.dev9.*
+com.devahoy.*
+com.devappliance.ninjadoc.*
+com.devappliance.qdslhbmplugin.*
+com.devbliss.*
+com.devbliss.doctest.*
+com.devbliss.gwtbliss.*
+com.devbliss.risotto.*
+com.devbrackets.android.*
+com.devbury.*
+com.devcycle.*
+com.devdungeon.maven.archetypes.*
+com.devdungeon.tools.*
+com.devebot.jigsaw.*
+com.devebot.opflow.*
+com.develabs.*
+com.develeap.*
+com.develhack.*
+com.developcollect.*
+com.developerdan.*
+com.developersam.*
+com.develophelper.*
+com.developmentsprint.*
+com.develouz.*
+com.develouz.lib.*
+com.develouz.sdk.*
+com.devfigas.*
+com.devgoo.common-commons.*
+com.devhc.*
+com.devialab.*
+com.deviceatlas.*
+com.deviceinsight.*
+com.deviceinsight.azure.*
+com.deviceinsight.helm.*
+com.deviceinsight.kafka.*
+com.devingryu.*
+com.devivo.*
+com.devmate.pub.*
+com.devonfw.*
+com.devonfw.cobigen.*
+com.devonfw.java.boms.*
+com.devonfw.java.doc.*
+com.devonfw.java.modules.*
+com.devonfw.java.starters.*
+com.devonfw.java.templates.*
+com.devonfw.microservices.*
+com.devonfw.modules.*
+com.devonfw.starter.*
+com.devonfw.tools.*
+com.devonfw.tools.ide.*
+com.devontrain.*
+com.devontrain.jaxb.*
+com.devontrain.jex.*
+com.devops4j.common.*
+com.devops4j.embedded.*
+com.devops4j.groundwork.*
+com.devops4j.io.*
+com.devops4j.logtrace.*
+com.devops4j.logtrace4j.*
+com.devops4j.reflection4j.*
+com.devops4j.skeleton.*
+com.devops4j.skeleton4j.*
+com.devpira.colorlibrary.*
+com.devquixote.*
+com.devsisters.*
+com.devskiller.*
+com.devskiller.duramen.*
+com.devskiller.friendly-id.*
+com.devskiller.hbm2ddl-maven-plugin.*
+com.devskiller.infra.*
+com.devskiller.jpa2ddl.*
+com.devsmobile.*
+com.devspan.mojo.javascript.*
+com.devspan.vendor.*
+com.devspan.vendor.aefxx.*
+com.devspan.vendor.envjs.*
+com.devspan.vendor.jack.*
+com.devspan.vendor.jquery.*
+com.devspan.vendor.requirejs.*
+com.devspan.vendor.rfk.*
+com.devspan.vendor.strophejs.*
+com.devsu.*
+com.devtodev.*
+com.devwu.*
+com.dexcoder.*
+com.dexecr.*
+com.dexmatech.styx.*
+com.df4j.*
+com.df4j.boot.*
+com.df4j.cloud.*
+com.df4j.flink.*
+com.dfaris.query.*
+com.dgtlrepublic.*
+com.dgwave.car.*
+com.dheemantech.ta4j.*
+com.dhemery.*
+com.dhemery.runtime-suite.*
+com.dhiwise.*
+com.di3654.*
+com.diabolicallab.*
+com.diabolicallabs.*
+com.diagnal.engage.*
+com.diakogiannis.alexius.security.*
+com.diamondedge.*
+com.diamondfsd.*
+com.diamondq.*
+com.diamondq.common.*
+com.diamondq.common.java.thirdparty.*
+com.diamondq.maven.*
+com.diamondq.osgi.acme4j.*
+com.dianke-aiot.*
+com.dianping.cat.*
+com.diboot.*
+com.dicicip.*
+com.didalgo.*
+com.didiglobal.booster.*
+com.didiglobal.chameleon.*
+com.didiglobal.dreambox.*
+com.didiglobal.thriftmock.*
+com.didiglobal.turbo.*
+com.didispace.*
+com.didiyun.*
+com.diegocarloslima.*
+com.diegoferreiracaetano.*
+com.diegogurgel.*
+com.dieharddev.*
+com.diem.*
+com.dieselpoint.*
+com.dieusoft.dw.*
+com.diffblue.*
+com.diffbot.*
+com.diffplug.*
+com.diffplug.atplug.*
+com.diffplug.durian-globals.*
+com.diffplug.durian.*
+com.diffplug.freshmark.*
+com.diffplug.gradle.*
+com.diffplug.gradle.spotless.*
+com.diffplug.guava.*
+com.diffplug.jscriptbox.*
+com.diffplug.matsim.*
+com.diffplug.osgi.*
+com.diffplug.spotless-changelog.*
+com.diffplug.spotless.*
+com.diffusiondata.*
+com.diffusiondata.diffusion.*
+com.diffusiondata.sample.*
+com.digi-lion.*
+com.digi.xbee.*
+com.digicertdns.*
+com.digitalBorderlands.*
+com.digitalascent.*
+com.digitalasset.*
+com.digitalasset.daml.lf.engine.trigger.*
+com.digitalasset.ledger-api.*
+com.digitalasset.ledger-api.grpc-definitions.*
+com.digitalasset.ledger-service.*
+com.digitalasset.ledger.*
+com.digitalasset.platform.*
+com.digitalbarista.*
+com.digitalcipher.*
+com.digitalcipher.spiked.*
+com.digitaldoodles.*
+com.digitalglobe.gbdx.tools.*
+com.digitalhumani.*
+com.digitalml.plugins.*
+com.digitalpebble.*
+com.digitalpebble.behemoth.*
+com.digitalpebble.stormcrawler.*
+com.digitalpebble.textclassification.*
+com.digitalpetri.enip.*
+com.digitalpetri.fsm.*
+com.digitalpetri.modbus.*
+com.digitalpetri.netty.*
+com.digitalpetri.opcua.*
+com.digitalreasoning.herman.*
+com.digitalreasoning.rstwriter.*
+com.digitalreasoning.sdp.*
+com.digitaltangible.*
+com.digitify.scanx.*
+com.digitolio.*
+com.digium.respoke.*
+com.diglol.crypto.*
+com.diglol.encoding.*
+com.diglol.id.*
+com.digy4.*
+com.diligesoft.*
+com.dilipkumarg.projects.*
+com.diluv.catalejo.*
+com.diluv.clamchowder.*
+com.diluv.confluencia.*
+com.diluv.diluvgradle.*
+com.diluv.inquisitor.*
+com.diluv.nodecdn.*
+com.diluv.schoomp.*
+com.dimafeng.*
+com.dimajix.flowman.*
+com.dimajix.flowman.maven.*
+com.dineshkrish.*
+com.dinglevin.*
+com.dingotiles.*
+com.dingotiles.connectors.*
+com.dingtalk.open.*
+com.dingxiang-inc.*
+com.dinstone.*
+com.dinstone.beanstalkc.*
+com.dinstone.clutch.*
+com.dinstone.focus.*
+com.dinstone.focus.clutch.*
+com.dinstone.focus.compress.*
+com.dinstone.focus.serialize.*
+com.dinstone.jrpc.*
+com.dinstone.loghub.*
+com.dinstone.motor.*
+com.dinstone.photon.*
+com.dinstone.ut.*
+com.dinstone.vertx.*
+com.dinuberinde.*
+com.diogobernardino.*
+com.diogobernardino.williamchart.*
+com.diogonunes.*
+com.diozero.*
+com.dipien.*
+com.dipuce.*
+com.directa24.*
+com.directmediatips.*
+com.directmyfile.*
+com.directual.*
+com.dirkheijnen.*
+com.disanbo.boot.*
+com.discord4j.*
+com.discord4j.immutables.*
+com.discoverydns.*
+com.discoverydns.dnsapi.*
+com.discursive.cas.extend.*
+com.discursive.dao.generic.*
+com.discursive.maven.*
+com.discursive.taglib.prototype.*
+com.discursive.taglib.reference.*
+com.discursive.web.history.*
+com.discursive.wicket.media.*
+com.disdar.*
+com.disney.groovity.*
+com.disney.studio.cucumber.slices.plugin.*
+com.disneystreaming.*
+com.disneystreaming.alloy.*
+com.disneystreaming.neutrino.*
+com.disneystreaming.pg2k4j.*
+com.disneystreaming.smithy.*
+com.disneystreaming.smithy4s.*
+com.dispalt.*
+com.dispalt.pop.*
+com.dispalt.redux.*
+com.dispalt.relay.*
+com.dispalt.slack-scala-client.*
+com.dispalt.vitess.*
+com.displee.*
+com.disruptive-technologies.*
+com.distelli.common.*
+com.distelli.gcr.*
+com.distelli.graphql.*
+com.distelli.monitor.*
+com.distelli.objectStore.*
+com.distelli.persistence.*
+com.distelli.run.*
+com.distelli.utils.*
+com.distelli.ventura.*
+com.distelli.webserver.*
+com.distelli.webserver.proxy.*
+com.distkv.*
+com.distrimind.bcfips.*
+com.distrimind.bouncycastle.*
+com.distrimind.gnu.*
+com.distrimind.madkit.*
+com.distrimind.madkit.gui.swing.*
+com.distrimind.madkitdemos.*
+com.distrimind.ood.*
+com.distrimind.upnp_igd.*
+com.distrimind.util.*
+com.ditavision.*
+com.ditchoom.*
+com.diva-e.parallel-test-runner.*
+com.divconq.*
+com.dividat.*
+com.dividezero.*
+com.divinecloud.*
+com.divpundir.filetools.*
+com.divpundir.mavlink.*
+com.divpundir.websockt.*
+com.dixa.*
+com.diyalotech.*
+com.djdch.log4j.*
+com.dji.*
+com.djrapitops.*
+com.dkamakin.*
+com.dkanejs.maven.plugins.*
+com.dkaresearchcenter.dkaframework.*
+com.dkiriusin.*
+com.dkirrane.groovy.gitflow.*
+com.dkirrane.maven.archetype.*
+com.dkirrane.maven.plugins.*
+com.dlazaro66.qrcodereaderview.*
+com.dlecan.reflections.*
+com.dlg-tec.*
+com.dlmorais.*
+com.dlocal.android.*
+com.dlsc.*
+com.dlsc.afterburner.*
+com.dlsc.formsfx.*
+com.dlsc.gemsfx.*
+com.dlsc.jfxcentral.*
+com.dlsc.keyboardfx.*
+com.dlsc.pdfviewfx.*
+com.dlsc.pickerfx.*
+com.dlsc.preferencesfx.*
+com.dlsc.showcasefx.*
+com.dlsc.unitfx.*
+com.dlsc.workbenchfx.*
+com.dmanchester.*
+com.dmetasoul.*
+com.dmitriy-tarasov.*
+com.dmitryborodin.*
+com.dmitrymalkovich.android.*
+com.dmperium.*
+com.dmperium.sdk.*
+com.dmurph.*
+com.dmurph.mvc.*
+com.dnahodil.groovy.extensions.*
+com.dnanexus.*
+com.dnastack.*
+com.dnbcloud.*
+com.dncomponents.core.*
+com.dnsimple.*
+com.docmosis.*
+com.docraptor.*
+com.docsdk.*
+com.docspring.*
+com.doctusoft.*
+com.documaster.idp.*
+com.documaster.rms.*
+com.documents4j.*
+com.docusign.*
+com.docxmerge.*
+com.dodgeballhq.protect.*
+com.dogiz.*
+com.doinglab.foodlens.*
+com.doist.*
+com.doist.x.*
+com.doist.x.normalize.*
+com.doitnext.*
+com.doku.*
+com.dolatkia.*
+com.dolphindb.*
+com.domain-model.*
+com.domeke.*
+com.domenicseccareccia.*
+com.domingosuarez.boot.*
+com.dominikcebula.archetypes.*
+com.dominikcebula.cloning.*
+com.dominikcebula.hadoop.ftp.*
+com.donaldblodgett.io.*
+com.donaldblodgett.scriptella.*
+com.donderom.*
+com.donghoonyoo.boilerplate.*
+com.dongjinlee.*
+com.dongxiawu.*
+com.dongxiguo.*
+com.dongxiguo.zero-log.*
+com.dooapp.*
+com.dooapp.XStreamFX.*
+com.dooapp.fxform2.*
+com.doodeec.utils.*
+com.doomonafireball.betterpickers.*
+com.doopp.*
+com.doordeck.simplegpio.*
+com.doordeck.websecurity.*
+com.dopsun.bbutils.*
+com.dopsun.chatbot.*
+com.dopsun.mimodispatcher.*
+com.dorkbox.*
+com.dosuv.pay.*
+com.dotdashpay.*
+com.dotdata.*
+com.dotions.*
+com.dotslashlabs.*
+com.dottydingo.async.*
+com.dottydingo.hyperion.*
+com.dottydingo.hyperion.dependency.*
+com.dottydingo.hyperion.module.*
+com.dottydingo.hyperion.spring.*
+com.dottydingo.hyperion.spring.boot.*
+com.dottydingo.plugins.*
+com.dottydingo.service.endpoint.*
+com.dottydingo.service.pipeline.*
+com.dottydingo.tracelog.*
+com.dou361.base64.*
+com.dou361.download.*
+com.dou361.ijkplayer.*
+com.dou361.scan.*
+com.dou361.smsobserver.*
+com.dou361.update.*
+com.douban.*
+com.doublechaintech.*
+com.doublesymmetry.*
+com.douglasjose.tech.*
+com.douglasrlee.*
+com.dougnoel.*
+com.douhulu.bytedance.*
+com.douhulu.open.poly.*
+com.dounine.*
+com.downgoon.*
+com.dp4j.*
+com.dpaycoin.*
+com.dpforge.*
+com.dpkgsoft.*
+com.dplugin.maven.plugins.*
+com.dpxcn.*
+com.draagon.*
+com.dracoon.*
+com.dradest.*
+com.draftable.api.client.*
+com.dragisajevtic.toasttestaplication.*
+com.dragishak.*
+com.dragome.*
+com.dragpools.client.*
+com.dragselectcompose.*
+com.drakeet.about.*
+com.drakeet.drawer.*
+com.drakeet.multitype.*
+com.drakeet.purewriter.*
+com.dream-orm.*
+com.dream-platform.*
+com.dream11.*
+com.dreamgyf.android.plugin.*
+com.dreamgyf.android.ui.*
+com.dreamgyf.android.ui.widget.*
+com.dreamgyf.android.utils.*
+com.dreizak.*
+com.dremio.arrow.gandiva.*
+com.drencak.state-reducer.*
+com.drewnoakes.*
+com.dripower.*
+com.dripstat.*
+com.drissoft.*
+com.drivebuddyapp.*
+com.drivemetadata.*
+com.drivemode.*
+com.driver733.*
+com.driver733.infix-fun-generator.*
+com.driver733.infix-functions-generator.*
+com.driver733.mapstruct-fluent.*
+com.drivetribe.*
+com.drobisch.*
+com.droideep.*
+com.droidkit.*
+com.droidlogix.*
+com.droidtitan.*
+com.dronjax.java.*
+com.dropbox.affectedmoduledetector.*
+com.dropbox.componentbox.*
+com.dropbox.core.*
+com.dropbox.dependency-guard.*
+com.dropbox.differ.*
+com.dropbox.dropshots.*
+com.dropbox.focus.*
+com.dropbox.forester.*
+com.dropbox.forester.plugin.*
+com.dropbox.kaiken.*
+com.dropbox.maven.*
+com.dropbox.mobile.hypershard.*
+com.dropbox.mobile.kotlinsnapshot.*
+com.dropbox.mobile.store.*
+com.dropbox.sign.*
+com.dropbuddies.client.*
+com.dropchop.*
+com.dropchop.quarkus.*
+com.dropchop.recyclone.*
+com.dropsnorz.*
+com.drore.cloud.*
+com.drunkendev.*
+com.dryxtech.*
+com.ds.tools.hudson.*
+com.dslplatform.*
+com.dslplatform.ocd.*
+com.dst-pro.*
+com.dstukalov.*
+com.dstukalov.videoconverter.*
+com.dteoh.*
+com.dtflys.forest.*
+com.dtforce.*
+com.dtguai.*
+com.dtguai.cache.*
+com.dthoffman.tomcatmock.*
+com.dtrules.*
+com.dtsc.bpm.*
+com.dtstack.*
+com.dtstack.dtcenter.*
+com.dtstack.jlogstash.*
+com.dtstack.logstash.*
+com.dtstep.lighthouse.*
+com.dua3.cabe.*
+com.dua3.connect.*
+com.dua3.ekstrak.*
+com.dua3.fx.*
+com.dua3.meja.*
+com.dua3.utility.*
+com.duartbreedt.radialgraph.*
+com.dubsmash.volley.*
+com.dubture.*
+com.duckduckgo.netguard.*
+com.duckduckgo.synccrypto.*
+com.duffel.*
+com.duglasher.secp256k1.*
+com.duglasher.secp256k1.secp256k1-kmp.0.10.2.com.duglasher.secp256k1.*
+com.duitku.*
+com.duiyou360.*
+com.dukescript.*
+com.dukescript.amaronui.*
+com.dukescript.amaronui.layouts.*
+com.dukescript.api.*
+com.dukescript.archetype.*
+com.dukescript.canvas.*
+com.dukescript.charts.*
+com.dukescript.events.*
+com.dukescript.libraries.*
+com.dukescript.nbjavac.*
+com.dukescript.presenters.*
+com.dukeware.*
+com.duoec.*
+com.duoec.doc.*
+com.duoec.duo.*
+com.duoec.graphql.*
+com.duopeak.eevee.*
+com.duopeak.evie.*
+com.duosecurity.*
+com.duowan.android.netroid.*
+com.duprasville.guava.*
+com.duprasville.guava.guava-probably.*
+com.dustinredmond.fxalert.*
+com.dustinredmond.fxtrayicon.*
+com.dustinredmond.groovytime.*
+com.dutate.dutate.*
+com.dute7liang.*
+com.duvalhub.*
+com.dvdkly.*
+com.dvmms.*
+com.dwijnand.*
+com.dwolla.*
+com.dxmdp.android.*
+com.dyescape.*
+com.dylanwuzh.*
+com.dyn.*
+com.dynamicpdf.api.*
+com.dynamicprogrammingsolutions.*
+com.dynamicyield.*
+com.dynamicyield.android.templates.*
+com.dynamicyield.fitemplates.*
+com.dynamixsoftware.intentapi.*
+com.dynamixsoftware.printingsdk.*
+com.dynatrace.*
+com.dynatrace.agent.*
+com.dynatrace.diagnostics.automation.*
+com.dynatrace.dynahist.*
+com.dynatrace.hash4j.*
+com.dynatrace.jmeter.plugins.*
+com.dynatrace.metric.util.*
+com.dynatrace.oneagent.sdk.java.*
+com.dynatrace.openkit.*
+com.dynatrace.protocols.*
+com.dynatrace.ruxit.tools.*
+com.dynatrace.sdk.*
+com.dynatrace.tools.*
+com.dynatrace.tools.android.*
+com.dyngr.*
+com.dyuproject.fbsgen.*
+com.dyuproject.fbsgen.ds.*
+com.dyuproject.jetg.*
+com.dyuproject.protostuff.*
+com.dyuproject.protostuff.archetype.*
+com.dyuproject.protostuffdb.*
+com.dzikoysk.sqiffy.*
+com.dzodi.*
+com.e-gineering.*
+com.e-movimento.tinytools.*
+com.ea.agentloader.*
+com.ea.async.*
+com.ea.gatling.*
+com.ea.orbit.*
+com.ea.orbit.actors.tests.*
+com.ea.orbit.samples.*
+com.eagerlogic.*
+com.eagerlogic.cubee.*
+com.eaio.uuid.*
+com.ealva.*
+com.ean.config.*
+com.ean.log.*
+com.ean.mobile.*
+com.earldouglas.*
+com.easemob.*
+com.easemob.im.*
+com.easilydo.*
+com.eastedu.boot.*
+com.easy-query.*
+com.easycodebox.*
+com.easyinnova.*
+com.easyliteorm.*
+com.easymybatis.freamwork.*
+com.easypayx.*
+com.easypost.*
+com.easypre.*
+com.easyrong.*
+com.easyvaas.*
+com.eatthepath.*
+com.ebay.*
+com.ebay.api.*
+com.ebay.auth.*
+com.ebay.bascomtask.*
+com.ebay.bsonpatch.*
+com.ebay.data.encoding.*
+com.ebay.developer.*
+com.ebay.ejmask.*
+com.ebay.jetstream.*
+com.ebay.jetstream.archetype.*
+com.ebay.jsoncoder.*
+com.ebay.nst.*
+com.ebay.opentracing.*
+com.ebay.parallec.*
+com.ebay.pulsar.*
+com.ebay.pulsar.replay.*
+com.ebay.sd.commons.*
+com.ebay.taskgraph.*
+com.ebendal.*
+com.ebgolden.*
+com.ebiznext.*
+com.ebiznext.sbt.plugins.andromda.*
+com.ebiznext.soapui.*
+com.ebuddy.cassandra.*
+com.ecallcen.*
+com.eccyan.*
+com.ecertic.otpsecure.*
+com.ecfeed.*
+com.ecfront.*
+com.ecfront.dew.*
+com.ech0s7r.android.*
+com.echemi.maven.plugin.*
+com.echobox.*
+com.echsylon.atlantis.*
+com.eclecticlogic.*
+com.eclipsesource.*
+com.eclipsesource.glsp.*
+com.eclipsesource.j2v8.*
+com.eclipsesource.j2v8.foo.*
+com.eclipsesource.jaxrs.*
+com.eclipsesource.minimal-json.*
+com.eclipsesource.tabris.*
+com.eclipsesource.tycho.karaf.bridge.*
+com.ecommpay.*
+com.ecsteam.cloudfoundry.*
+com.ecwid.*
+com.ecwid.apiclient.*
+com.ecwid.clickhouse.*
+com.ecwid.consul.*
+com.ecyrd.simplejmx.*
+com.ecyrd.speed4j.*
+com.edb.os.*
+com.edbplus.*
+com.edgedb.*
+com.edgeros.cloud.*
+com.edgewonk.*
+com.editframe.*
+com.editorbar.*
+com.edmodo.*
+com.edmunds.*
+com.edmunds.databricks.*
+com.edriving.commons.*
+com.edropple.jregex.*
+com.edugility.*
+com.edusoho.live.*
+com.eduworks.*
+com.edwardraff.*
+com.edwardstock.*
+com.edwardstock.android.*
+com.edwardstock.cmakebuild.*
+com.eed3si9n.*
+com.eed3si9n.coursier.*
+com.eed3si9n.eval.*
+com.eed3si9n.expecty.*
+com.eed3si9n.fix.*
+com.eed3si9n.jarjar.*
+com.eed3si9n.jarjarabrams.*
+com.eed3si9n.starlark.*
+com.eed3si9n.verify.*
+com.eeeeeric.*
+com.eeeffff.*
+com.eeeffff.hasentinel.*
+com.eeeffff.limiter.*
+com.eeeffff.yapidoc.*
+com.eelot.*
+com.efeichong.*
+com.effectiveosgi.*
+com.effektif.*
+com.efindi.*
+com.efluid.oss.*
+com.efsavage.jquery.*
+com.efsavage.twitter.bootstrap.*
+com.eftimoff.*
+com.eggwifi.*
+com.eggybytes.*
+com.eginnovations.agent.android.*
+com.eginnovations.android.*
+com.eginnovations.android.agent.*
+com.egoiapp.egoipushlibrary.*
+com.egzosn.*
+com.eharmony.*
+com.eharmony.pho.*
+com.ehehdada.*
+com.ehsanmsz.*
+com.ehsy.*
+com.ehsy.docking.*
+com.ehsy.edi.*
+com.eidu.*
+com.eiipii.*
+com.eimapi.*
+com.eincs.build.*
+com.eiryu.*
+com.eisenvault.*
+com.ejdoc.*
+com.ejlchina.*
+com.ekeitho.uni.*
+com.ekino.oss.converter.*
+com.ekino.oss.crypto.*
+com.ekino.oss.gradle.plugin.*
+com.ekino.oss.gradle.plugin.docker.*
+com.ekino.oss.gradle.plugin.java.*
+com.ekino.oss.gradle.plugin.quality.*
+com.ekino.oss.jcv-db.*
+com.ekino.oss.jcv.*
+com.ekino.oss.spring.*
+com.ekino.oss.wiremock.*
+com.ekkohao.*
+com.ekndev.gaugelibrary.*
+com.ekotrope.*
+com.ekuefler.supereventbus.*
+com.ekuy.*
+com.elanion.aem.connector.*
+com.elanion.cms.*
+com.elarian.*
+com.elarib.*
+com.elasticemail.api.*
+com.elasticemail.app.*
+com.elasticpath.*
+com.elasticpath.json.*
+com.elastisys.*
+com.elastisys.scale.*
+com.elderresearch.*
+com.eldrix.*
+com.electrit.*
+com.electronicmuse.*
+com.electronwill.*
+com.electronwill.night-config.*
+com.elefana.*
+com.elega9t.*
+com.elegantmonkeys.*
+com.elemica.cloudsearch.*
+com.elephantdrummer.*
+com.elepy.*
+com.elevenetc.*
+com.elevenpaths.almaraz.*
+com.elevenware.*
+com.elevenware.felson.*
+com.elevenware.felson.examples.*
+com.elevup.*
+com.elfinitiy.*
+com.elibaxin.*
+com.elibaxin.test.*
+com.elibom.*
+com.eligible.*
+com.elihullc.*
+com.eljavatar.*
+com.elkozmon.*
+com.ellipticsecure.*
+com.ellucian.*
+com.ellucian.ethos.integration.sdk.*
+com.ellucian.xalan.*
+com.elm-software.*
+com.elmakers.math.*
+com.elmakers.mine.bukkit.*
+com.elo7.*
+com.elo7.nightfall.*
+com.elogiclab.guardbee.*
+com.elouyi.*
+com.elpassion.android.commons.*
+com.elrond.*
+com.elsevier.*
+com.eltropy.*
+com.elusive-code.newsboy.*
+com.eluvio.*
+com.elveum.*
+com.elvishew.*
+com.elypia.*
+com.elypia.elypiai.*
+com.em248.*
+com.emaginalabs.*
+com.emailage.*
+com.emaraic.*
+com.emarsys.*
+com.embeddedunveiled.*
+com.embedler.moon.graphql.*
+com.embedly.*
+com.emc.cdp.*
+com.emc.documentum.*
+com.emc.documentum.spring.*
+com.emc.ecs.*
+com.emc.ia.*
+com.emc.vipr.*
+com.emcoo.ef.*
+com.emerchantpay.gateway.*
+com.emergetools.snapshots.*
+com.emergetools.test.*
+com.emiperez.*
+com.emiperez.commons.*
+com.emiperez.repeson.*
+com.emitrom.*
+com.emmacanhelp.*
+com.emnify.sdk.*
+com.empowerops.*
+com.empyr.*
+com.emretufekci.*
+com.emsoft.*
+com.enbatis.*
+com.enchainte.sdk.*
+com.encoway.*
+com.end-points.*
+com.endercrest.uwaterlooapi.*
+com.eneco.*
+com.enegate.*
+com.energizedwork.*
+com.enfore.*
+com.engagelab.*
+com.engagelab.plugin.*
+com.engagetech.dropwizard.modules.*
+com.enginious-dev.*
+com.englishtown.*
+com.englishtown.vertigo.*
+com.englishtown.vertx.*
+com.enigmabridge.*
+com.enigmastation.*
+com.enioka.jqm.*
+com.enioka.scanner.*
+com.enixyu.*
+com.enjin.*
+com.enniovisco.*
+com.enocklubowa.*
+com.enofex.*
+com.enonic.lib.*
+com.enonic.xp.*
+com.enragedginger.*
+com.enriquegrodrigo.*
+com.ensarsarajcic.kotlinx.*
+com.ensarsarajcic.neovim.http.*
+com.ensarsarajcic.neovim.java.*
+com.ensighten.android.*
+com.ensighten.plugin.android.*
+com.ensime.*
+com.ensody.reactivestate.*
+com.enterprisecoding.*
+com.enterprisedb.*
+com.enterprisedt.*
+com.enterprisemath.*
+com.entityassist.*
+com.entitystream.*
+com.entopix.*
+com.envimate.*
+com.envimate.httpmate.*
+com.envimate.httpmate.integrations.*
+com.envimate.mapmate.*
+com.envimate.mapmate.integrations.*
+com.envimate.message-mate.*
+com.envimate.webmate.*
+com.envimate.webmate.integrations.*
+com.envisioniot.*
+com.envisioniot.enos.third_party_protocol.*
+com.envisioniot.event.*
+com.envisioniot.sub.*
+com.envoisolutions.sxc.*
+com.enzoic.*
+com.eoniantech.*
+com.eoniantech.build.*
+com.eonliu.packer.*
+com.eorionsolution.camunda.*
+com.eowise.*
+com.eoysky.*
+com.epagagames.*
+com.epages.*
+com.epam.*
+com.epam.deltix.*
+com.epam.dep.esp.*
+com.epam.drill.*
+com.epam.drill.agent.*
+com.epam.drill.agent.runner.*
+com.epam.drill.agent.runner.app.*
+com.epam.drill.agent.runner.autotest.*
+com.epam.drill.dsm.*
+com.epam.drill.gradle.plugin.*
+com.epam.drill.gradle.plugin.kni.*
+com.epam.drill.hook.*
+com.epam.drill.interceptor.*
+com.epam.drill.knasm.*
+com.epam.drill.kni.*
+com.epam.drill.ktor.*
+com.epam.drill.logger.*
+com.epam.drill.plugins.*
+com.epam.drill.plugins.test2code.*
+com.epam.drill.simulator.*
+com.epam.drill.ts.*
+com.epam.eco.*
+com.epam.eco.kafkamanager.*
+com.epam.eco.schemacatalog.*
+com.epam.healenium.*
+com.epam.indigo.*
+com.epam.jdi.*
+com.epam.jdi.tools.*
+com.epam.jsdmx.*
+com.epam.reportportal.*
+com.epam.uitest.*
+com.epam.wilma.*
+com.epion-t3.*
+com.episode6.hackit.android.inject.*
+com.episode6.hackit.auto.factory.*
+com.episode6.hackit.chop.*
+com.episode6.hackit.deployable.*
+com.episode6.hackit.disposable.*
+com.episode6.hackit.gdmc.*
+com.episode6.hackit.groovykit.*
+com.episode6.hackit.mockspresso.*
+com.episode6.hackit.nestable.*
+com.episode6.hackit.typed.*
+com.episode6.mockspresso2.*
+com.episode6.redux.*
+com.episode6.reflectivemockk.*
+com.episode6.typed2.*
+com.eportfolium.karuta.*
+com.epsagon.*
+com.eqela.*
+com.eqixiac.equinix.*
+com.equinix.pulumi.*
+com.ergonlabs.*
+com.ericchee.*
+com.ericktijerou.koleton.*
+com.ericsson.bss.cassandra.ecaudit.*
+com.ericsson.bss.cassandra.ecchronos.*
+com.ericsson.commonlibrary.*
+com.ericsson.jenkinsci.hajp.*
+com.ericsson.research.trap.*
+com.ericsson.research.trap.packaging.*
+com.ericsson.research.trap.tests.*
+com.ericsson.research.trap.transports.*
+com.ericyl.utils.*
+com.erigir.*
+com.erikagtierrez.multiple_media_picker.*
+com.erikandcolleen.*
+com.erinors.*
+com.eriwen.*
+com.erlitech.*
+com.ernestoyaquello.drag-drop-swipe-recyclerview.*
+com.ernestoyaquello.dragdropswiperecyclerview.*
+com.ernestoyaquello.stepperform.*
+com.eroelf.*
+com.erpya.*
+com.errplane.*
+com.ersione.*
+com.erudika.*
+com.erutulco.utils.*
+com.esamir.osalt.*
+com.esanwoo.eview.*
+com.esaulpaugh.*
+com.escalableapps.framework.*
+com.escalatesoft.subcut.*
+com.escape-technology-llc.*
+com.esentri.oss.*
+com.eshioji.hotvect.*
+com.esmartwave.analytics.androidsdk.*
+com.esmartwave.analytics.javasdk.*
+com.esmartwave.tracking.javasdk.*
+com.esotericsoftware.*
+com.esotericsoftware.kryo.*
+com.esotericsoftware.minlog.*
+com.esotericsoftware.reflectasm.*
+com.esotericsoftware.spine.*
+com.esotericsoftware.yamlbeans.*
+com.espace-safer.*
+com.espertech.*
+com.espreccino.*
+com.esri.geoevent.sdk.*
+com.esri.geometry.*
+com.esri.hadoop.*
+com.essaid.poms.*
+com.essie-cho.*
+com.estafet.microservices.scrum.*
+com.estepsoftwareforensics.*
+com.estimote.*
+com.estmob.android.*
+com.esyfur.*
+com.etalio.*
+com.etebase.*
+com.eternitywall.*
+com.etesync.*
+com.ethanruffing.preferenceabstraction.*
+com.etherealscope.*
+com.ethlo.*
+com.ethlo.cache.*
+com.ethlo.clackshack.*
+com.ethlo.dachs.*
+com.ethlo.geodata.*
+com.ethlo.gs1.*
+com.ethlo.json2xsd.*
+com.ethlo.jsons2xsd.*
+com.ethlo.keyvalue.*
+com.ethlo.kfka.*
+com.ethlo.kviksilver.*
+com.ethlo.lamebda.*
+com.ethlo.my2ch.*
+com.ethlo.openapi-tools.*
+com.ethlo.persistence.tools.*
+com.ethlo.qjc.*
+com.ethlo.schematools.*
+com.ethlo.spring.*
+com.ethlo.time.*
+com.ethlo.unece.*
+com.ethlo.zally.*
+com.ethteck.decodetect.*
+com.etolmach.spring.*
+com.etraveli.oss.codestyle.*
+com.etraveli.oss.codestyle.annotations.*
+com.etraveli.oss.codestyle.poms.*
+com.etraveli.oss.codestyle.poms.java.*
+com.etraveli.oss.codestyle.poms.kotlin.*
+com.etsy.*
+com.etsy.android.grid.*
+com.etsy.sahale.*
+com.eu.mediahub.android.exoplayer.*
+com.euclidolap.*
+com.eurodyn.qlack.*
+com.eurodyn.qlack.common.*
+com.eurodyn.qlack.commons.*
+com.eurodyn.qlack.extras.*
+com.eurodyn.qlack.fuse.*
+com.eurodyn.qlack.fuse.commons.*
+com.eurodyn.qlack.fuse.commons.dto.*
+com.eurodyn.qlack.fuse.jumpstart.*
+com.eurodyn.qlack.fuse.libs.*
+com.eurodyn.qlack.fuse.modules.*
+com.eurodyn.qlack.fuse.modules.auditinglogging.*
+com.eurodyn.qlack.fuse.modules.lexicon.*
+com.eurodyn.qlack.fuse.modules.mailing.*
+com.eurodyn.qlack.fuse.modules.scheduler.*
+com.eurodyn.qlack.util.*
+com.eurodyn.qlack2.*
+com.eurodyn.qlack2.be.*
+com.eurodyn.qlack2.common.*
+com.eurodyn.qlack2.fuse.*
+com.eurodyn.qlack2.patches.*
+com.eurodyn.qlack2.util.*
+com.eurodyn.qlack2.webdesktop.*
+com.eurodyn.qlack2.webdesktop.apps.*
+com.eurodyn.qp.*
+com.euvmp.*
+com.evanlennick.*
+com.evanwht.*
+com.evanwht.simple-sql-builder.*
+com.evanzeimet.wirecucumber.*
+com.evaserver.*
+com.evasion.*
+com.evasion.flex.*
+com.eve-engine.*
+com.eveningsamurai.*
+com.eveningsamurai.symphony.*
+com.eventarelli.syslog.*
+com.eventflit.*
+com.eventsourcing.*
+com.eventstore.*
+com.everalbum.roliedex.*
+com.evergage.android.*
+com.everlaw.*
+com.everli.*
+com.evernote.*
+com.evernym.vdrtools.*
+com.evernym.verity.*
+com.evervault.*
+com.evervault.sdk.*
+com.everwhimsical.*
+com.everysport.*
+com.evimetry.aff4.*
+com.evinced.*
+com.evinceframework.*
+com.evojam.*
+com.evokly.*
+com.evoleap.licensing.*
+com.evolution.*
+com.evolvedbinary.appbundler.*
+com.evolvedbinary.cql.*
+com.evolvedbinary.j8fu.*
+com.evolvedbinary.maven.jvnet.*
+com.evolvedbinary.maven.mfrey.*
+com.evolvedbinary.maven.mojohaus.*
+com.evolvedbinary.multilock.*
+com.evolvedbinary.thirdparty.com.xmlmind.*
+com.evolvedbinary.thirdparty.org.apache.httpd.*
+com.evolvedbinary.thirdparty.org.apache.xmlrpc.*
+com.evolvedbinary.thirdparty.org.codehaus.mojo.*
+com.evolvedbinary.thirdparty.org.deucestm.*
+com.evolvedbinary.xpath.*
+com.evoupsight.*
+com.evrone.*
+com.evrythng.*
+com.ewaypayments.*
+com.ewise.*
+com.eworkcloud.*
+com.eworkcloud.plugins.*
+com.eworkcloud.starter.*
+com.exactpro.mina.*
+com.exactpro.mvel.*
+com.exactpro.quickfixj.*
+com.exactpro.remotehand.*
+com.exactpro.sailfish-gradle-plugin.*
+com.exactpro.sf.*
+com.exactpro.test.*
+com.exactpro.th2.*
+com.exactpro.webchannels.*
+com.exacttarget.*
+com.exadatum.xsuit.xmaven.*
+com.exadatum.xsuite.*
+com.exadatum.xsuite.xmaven.*
+com.exadel.aem.*
+com.exadel.etoolbox.*
+com.exadel.flamingo.*
+com.exadel.flamingo.flamingoapp.projects.*
+com.exadel.flamingo.flex.*
+com.exadel.flamingo.javafx.*
+com.exadel.flamingo.maven.plugin.*
+com.exadel.security.*
+com.exaroton.*
+com.exasol.*
+com.exc-led.thirdparty.*
+com.excelbdd.*
+com.exceljava.*
+com.excelsecu.iot.*
+com.excelsiorjet.*
+com.exceptionfactory.jagged.*
+com.exceptionfactory.socketbroker.*
+com.exceptionless.*
+com.excilys.ebi.spring-dbunit.*
+com.excilys.ebi.utils.*
+com.exec8.*
+com.exini.*
+com.exmertec.dummie.*
+com.exmertec.yaz.*
+com.exonum.binding.*
+com.exonum.client.*
+com.exonum.messages.*
+com.exortions.*
+com.exostrive.cassandra.*
+com.exp-blog.*
+com.expanset.*
+com.expanset.hk2.*
+com.expanset.jersey.*
+com.expanset.samples.*
+com.expanset.utils.*
+com.expedia.*
+com.expedia.apiary.*
+com.expedia.dsp.*
+com.expedia.tesla.*
+com.expedia.www.*
+com.expediagroup.*
+com.expediagroup.apiary.*
+com.expediagroup.beans.*
+com.expediagroup.dropwizard.*
+com.expediagroup.dropwizard.bundle.*
+com.expediagroup.graphql.*
+com.expediagroup.molten.*
+com.expediagroup.openworld.sdk.*
+com.expediagroup.photon.*
+com.expediagroup.streamplatform.*
+com.experij.*
+com.experitest.*
+com.experlog.*
+com.experoinc.*
+com.expleague.*
+com.explodingart.*
+com.explodingpixels.*
+com.expofp.*
+com.exponam.*
+com.exponea.sdk.*
+com.exsoinn.*
+com.exsoinn.ie.*
+com.exsoloscript.challonge.*
+com.ext-ext.*
+com.extjs.*
+com.extole.consumer.*
+com.extole.mobile.*
+com.extollit.*
+com.extollit.gaming.*
+com.extrawest.*
+com.extrinsec.*
+com.extscreen.*
+com.extscreen.sdk.*
+com.exubero.jbehave.*
+com.exyte.*
+com.exyui.android.*
+com.eyeem.chips.*
+com.eyeem.potato.*
+com.eyeem.zeppelin.*
+com.eyeofcloud.ab.*
+com.eygraber.*
+com.eygraber.conventions-android-library.*
+com.eygraber.conventions-compose-jetbrains.*
+com.eygraber.conventions-compose-jetpack.*
+com.eygraber.conventions-compose.*
+com.eygraber.conventions-dependencies.*
+com.eygraber.conventions-detekt.*
+com.eygraber.conventions-kotlin-library.*
+com.eygraber.conventions-kotlin-multiplatform.*
+com.eygraber.conventions-ktlint.*
+com.eygraber.conventions-project-common.*
+com.eygraber.conventions-project-dependencies.*
+com.eygraber.conventions-publish-github.*
+com.eygraber.conventions-publish-maven-central.*
+com.eygraber.conventions-publish-spm.*
+com.eygraber.conventions.*
+com.eygraber.conventions.settings.*
+com.eygraber.detekt.rules.*
+com.eygraber.ejson.*
+com.eygraber.github.packages.repository.*
+com.eygraber.gradle-android-library.*
+com.eygraber.gradle-compose-jetbrains.*
+com.eygraber.gradle-compose-jetpack.*
+com.eygraber.gradle-compose.*
+com.eygraber.gradle-dependencies.*
+com.eygraber.gradle-detekt.*
+com.eygraber.gradle-kotlin-library.*
+com.eygraber.gradle-kotlin-multiplatform.*
+com.eygraber.gradle-publish-github.*
+com.eygraber.gradle-publish-maven-central.*
+com.eygraber.gradle-publish-spm.*
+com.eygraber.gradle.dependency-attribution-android.*
+com.eygraber.gradle.dependency-attribution-jvm.*
+com.eygraber.gradle.utils.*
+com.eygraber.gradle.utils.base.*
+com.eygraber.gradle.utils.detekt.*
+com.eygraber.gradle.utils.kotlin.*
+com.eygraber.gradle.utils.settings.*
+com.eyougo.*
+com.eyousefi.*
+com.ezhiyang.*
+com.ezoky.*
+com.ezormnow.*
+com.eztier.*
+com.ezware.oxbow.*
+com.ezylang.*
+com.f2prateek.*
+com.f2prateek.bundler.*
+com.f2prateek.checkstyle.*
+com.f2prateek.cloak.*
+com.f2prateek.dart.*
+com.f2prateek.dart.migration.*
+com.f2prateek.javafmt.*
+com.f2prateek.ln.*
+com.f2prateek.progressbutton.*
+com.f2prateek.robin.*
+com.f2prateek.rx.preferences.*
+com.f2prateek.rx.preferences2.*
+com.f2prateek.rx.receivers.*
+com.f2prateek.segment.*
+com.f5bc.*
+com.faacets.*
+com.faasadmin.*
+com.fab1an.*
+com.fabdelgado.*
+com.fabiendevos.*
+com.fabiogouw.*
+com.fabrizioiacobucci.android.*
+com.facebook.*
+com.facebook.ads.sdk.*
+com.facebook.airlift.*
+com.facebook.airlift.discovery.*
+com.facebook.android.*
+com.facebook.api.*
+com.facebook.battery.*
+com.facebook.business.sdk.*
+com.facebook.conceal.*
+com.facebook.delegatedrecovery.*
+com.facebook.device.yearclass.*
+com.facebook.diffkt.*
+com.facebook.drift.*
+com.facebook.fbjni.*
+com.facebook.fbui.textlayoutbuilder.*
+com.facebook.flipper.*
+com.facebook.fresco.*
+com.facebook.giraph.hive.*
+com.facebook.hadoop.*
+com.facebook.hive.*
+com.facebook.hiveio.*
+com.facebook.infer.annotation.*
+com.facebook.jcommon.*
+com.facebook.keyframes.*
+com.facebook.kotlin.compilerplugins.dataclassgenerate.*
+com.facebook.litho.*
+com.facebook.mojo.*
+com.facebook.network.connectionclass.*
+com.facebook.nifty.*
+com.facebook.portal.*
+com.facebook.presto.*
+com.facebook.presto.cassandra.*
+com.facebook.presto.hadoop.*
+com.facebook.presto.hive.*
+com.facebook.presto.orc.*
+com.facebook.presto.pinot.*
+com.facebook.presto.ranger.*
+com.facebook.presto.spark.*
+com.facebook.react.*
+com.facebook.rebound.*
+com.facebook.shimmer.*
+com.facebook.soloader.*
+com.facebook.spectrum.*
+com.facebook.stetho.*
+com.facebook.swift.*
+com.facebook.testing.screenshot.*
+com.facebook.thirdparty.*
+com.facebook.thirdparty.yourkit-api.*
+com.facebook.yoga.*
+com.facebook.yoga.android.*
+com.facecto.code.*
+com.facekom.*
+com.faceture.*
+com.factati.*
+com.factern.*
+com.factor10.*
+com.factor18.oss.*
+com.factorymarket.memo.*
+com.factorymarket.rxelm.*
+com.factset.analyticsapi.*
+com.factset.protobuf.*
+com.factset.sdk.*
+com.factset.sdk.eventdriven.*
+com.factual.*
+com.fadada.api.*
+com.faendir.*
+com.faendir.acra.*
+com.faendir.asl.*
+com.faendir.awscdkkt.*
+com.faendir.discord4j-command-parser.*
+com.faendir.jraw.*
+com.faendir.kotlin.autodsl.*
+com.faendir.lightninglauncher.*
+com.faendir.liquibase.*
+com.faendir.maven.*
+com.faendir.om.*
+com.faendir.proguard.*
+com.faendir.rhino.*
+com.faendir.rhino_android.*
+com.faendir.vaadin.*
+com.faendir.ziplet.*
+com.fairanswers.*
+com.faire.*
+com.faire.gradle.*
+com.fairmatic.*
+com.fairychar.*
+com.faithcomesbyhearing.*
+com.faithlife.*
+com.faizpay.*
+com.fakerandroid.tools.build.*
+com.falkonry.*
+com.fallabs.*
+com.faltenreich.*
+com.faltenreich.skeletonlayout.*
+com.famaridon.*
+com.famfamfam.*
+com.fancydsp.*
+com.fancyfon.mobile.android.verification.*
+com.faner4cloud.excel.*
+com.faner4cloud.plugin.*
+com.fangcloud.*
+com.fangcloud.sdk.*
+com.fangdd.*
+com.fangdd.graphql.*
+com.fangfaze.*
+com.fanmei.*
+com.fantasyfang.*
+com.fanxuankai.boot.*
+com.fanxuankai.zeus.*
+com.farao-community.farao.*
+com.farao-community.ortools.*
+com.farcsal.dql.*
+com.farerboy.*
+com.fareyeconnect.*
+com.farsunset.*
+com.farukcankaya.*
+com.fast-dao.*
+com.fastasyncvoxelsniper.*
+com.fastasyncworldedit.*
+com.fastchar.*
+com.fasterpay.*
+com.fasterxml.*
+com.fasterxml.clustermate.*
+com.fasterxml.jackson.*
+com.fasterxml.jackson.core.*
+com.fasterxml.jackson.dataformat.*
+com.fasterxml.jackson.datatype.*
+com.fasterxml.jackson.jakarta.rs.*
+com.fasterxml.jackson.jaxrs.*
+com.fasterxml.jackson.jr.*
+com.fasterxml.jackson.module.*
+com.fasterxml.mama.*
+com.fasterxml.staxmate.*
+com.fasterxml.storemate.*
+com.fasterxml.transistore.*
+com.fasterxml.util.*
+com.fasterxml.uuid.*
+com.fasterxml.woodstox.*
+com.fastjrun.archetype.*
+com.fastjrun.codeg.*
+com.fastjrun.codeg.apibase.*
+com.fastjrun.codeg.apiworld.*
+com.fastjrun.codeg.eladmin.*
+com.fastjrun.codeg.example.*
+com.fastjrun.codeg.jeecgboot.*
+com.fastjrun.share.*
+com.fastpdfservice.*
+com.fastviewx.*
+com.fatboyindustrial.crowd-control.*
+com.fatboyindustrial.gson-javatime-serialisers.*
+com.fatboyindustrial.gson-jodatime-serialisers.*
+com.fatboyindustrial.logback-raygun.*
+com.fatboyindustrial.omnium.*
+com.fatfalcon.*
+com.fathzer.*
+com.fatihgiris.composePPT.*
+com.fatsecret4j.*
+com.faunadb.*
+com.favext.*
+com.fayelau.*
+com.fazecast.*
+com.fbksoft.*
+com.fcibook.*
+com.fcibook.quick.*
+com.fdflib.*
+com.fdsapi.*
+com.feathersui.maven.plugins.*
+com.featureprobe.*
+com.fedapay.*
+com.fedepaolapps.postman.*
+com.fedepot.*
+com.feedad.android.*
+com.feedhenry.*
+com.feedhenry.gitlabshell.*
+com.feedzai.*
+com.feedzai.ansible.*
+com.feedzai.commons.tracing.*
+com.feedzai.fos.*
+com.feedzai.openml.lightgbm.*
+com.feedzai.openml.lightgbm.meta.*
+com.feelercloud.*
+com.feingto.*
+com.feingto.cloud.*
+com.feiniaojin.*
+com.feiniaojin.ddd.ecosystem.*
+com.feiniaojin.grh.*
+com.feiniaojin.naaf.*
+com.feiniaojin.naaf.ngr.*
+com.feiyilin.*
+com.feiynn.*
+com.feizhaiyou.encrypt.*
+com.felipebz.flr.*
+com.felipebz.zpa.*
+com.felipecsl.*
+com.felipecsl.asymmetricgridview.*
+com.felipecsl.kales.*
+com.felipecsl.quickreturn.*
+com.femastudios.*
+com.fenbi.*
+com.fenbi.mp4j.*
+com.fenghongzhang.*
+com.fengjx.maven.cdn.*
+com.fenglinga.*
+com.fenglinga.tinyspring.*
+com.fengshihao.xlistener.*
+com.fengwenyi.*
+com.fengzijk.*
+com.fenlibao.security.sdk.client.*
+com.fenlibao.security.sdk.ws.client.*
+com.fenlisproject.elf.*
+com.ferdinandsilva.sdlcontroller.*
+com.ferega.procrun.*
+com.ferega.props.*
+com.fererlab.*
+com.fermyon.*
+com.fernsroth.easyio.*
+com.ferrous-corp.cognito.*
+com.ferrous-corp.storm.*
+com.fervort.babycorn.*
+com.festo.aas.*
+com.feth.*
+com.ff5k.*
+com.ffbit.maven.plugins.*
+com.fgrutsch.*
+com.fgrutsch.emergence.*
+com.fhoster.livebase.*
+com.fhs-opensource.*
+com.fhtiger.utils.*
+com.fhuertas.*
+com.fiatjaf.*
+com.fibanez.*
+com.fidesmo.*
+com.fidzup.android.cmp.*
+com.fiestacabin.dropwizard.guice.*
+com.fiestacabin.dropwizard.quartz.*
+com.fiestacabin.model.*
+com.fifesoft.*
+com.fifesoft.rtext.*
+com.fifty-five.cargo.*
+com.fiftyonezero.eel.*
+com.fiftyonred.*
+com.figtreelake.*
+com.figure.classification.asset.*
+com.figure.infrastructure.libraries.*
+com.files.*
+com.filez.astyanax.*
+com.filez.jta.*
+com.filez.netmag.*
+com.filez.scala.*
+com.filez.scala.akka.*
+com.filez.scala.kuro.*
+com.filippodeluca.*
+com.fillr.*
+com.fillumina.*
+com.filmon.maven.*
+com.fimtra.*
+com.finalhints.*
+com.finbourne.*
+com.fincity.nocode.*
+com.findinpath.*
+com.findwise.hydra.*
+com.fineely.*
+com.finfosoft.db.*
+com.fing.fourmc.*
+com.finiotech.*
+com.finix.*
+com.finix.payments.processing.client.*
+com.finmatics.et.*
+com.finnternet.*
+com.finovertech.*
+com.fintecsystems.*
+com.fintonic.*
+com.fiorano.openesb.*
+com.fire.*
+com.firebase.*
+com.firebase.client.*
+com.firebaseui.*
+com.firedrum.*
+com.fireflyhoo.*
+com.fireflysource.*
+com.firenio.*
+com.firework.*
+com.firework.android.exoplayer.*
+com.firework.core.*
+com.firework.core.di.*
+com.firework.core.fwVastParser.*
+com.firework.core.network.*
+com.firework.external.imageloading.*
+com.firework.external.livestream.*
+com.firework.feature.*
+com.firework.feature.player.*
+com.firework.service.*
+com.firstbird.*
+com.firstbird.emergence.*
+com.firstdata.cgo.*
+com.firstdata.cgo.sai.*
+com.firstdata.clovergo.*
+com.firstdata.payeezy.*
+com.firstwicket.*
+com.fishbyby.*
+com.fishbyby.sharkchili.*
+com.fiskaly.kassensichv.*
+com.fiskaly.sdk.*
+com.fit2cloud.*
+com.fit2cloud.starters.*
+com.fitanalytics.*
+com.fitbur.*
+com.fitbur.core.*
+com.fitbur.external.*
+com.fitbur.jersey.*
+com.fitbur.test.*
+com.fitbur.testify.*
+com.fitbur.testify.archetype.*
+com.fitbur.testify.client.*
+com.fitbur.testify.di.*
+com.fitbur.testify.examples.*
+com.fitbur.testify.junit.*
+com.fitbur.testify.level.*
+com.fitbur.testify.need.*
+com.fitbur.testify.server.*
+com.fitbur.testify.tests.*
+com.fitzhi.*
+com.fixedorgo.*
+com.fixiu.*
+com.fizz-buzz.*
+com.fizzed.*
+com.fizzgate.*
+com.fizzyapple12.javadi.*
+com.fizzyapple12.wpilibdi.*
+com.fjordnet.autoreceiver.*
+com.fjordnet.groundcontrol.*
+com.fjordnet.tether.*
+com.fjutxiake.*
+com.flacito.jamstack.*
+com.flagsense.*
+com.flagsmith.*
+com.flagstone.*
+com.flagstonesoftware.*
+com.flamenk.*
+com.flandep.android.*
+com.flarestarsoftware.*
+com.flash3388.*
+com.flash3388.flashlib.*
+com.flash3388.tracer.*
+com.flash3388.util.*
+com.flashflexpro.*
+com.flaviofaria.*
+com.flaviofaria.catalog.*
+com.fleetpin.*
+com.fleshgrinder.kotlin.*
+com.flexdms.*
+com.flexiblewebsolutions.xdriveunit.*
+com.flexiblewebsolutions.xmlstringparser.*
+com.flextrade.jfixture.*
+com.flextrade.pojobuilder.*
+com.flickr4java.*
+com.flightstats.*
+com.flipboard.goldengate.*
+com.flipkart.*
+com.flipkart.connekt.*
+com.flipkart.fdp.ml.*
+com.flipkart.utils.*
+com.flipkart.zjsonpatch.*
+com.flipthebird.gwt-hashcode-equals.*
+com.fliptoo.*
+com.flockinger.*
+com.floern.castingcsv.*
+com.floragunn.*
+com.floreysoft.*
+com.flotype.bridge.*
+com.flowcentraltech.flowcentral.*
+com.flowkode.*
+com.flowkode.thorntail.jgroups.*
+com.flowlogix.*
+com.flowplayer.android.player.*
+com.flowpowered.*
+com.flowtick.*
+com.flowyun.*
+com.flozano.metrics.*
+com.flozano.notnoop.apns.*
+com.flozano.sendgrid.*
+com.flozano.statsd-netty.*
+com.fluenda.*
+com.fluffyluffs.*
+com.fluffypeople.*
+com.fluidbpm.*
+com.flurry.android.*
+com.flutterwave.*
+com.fluxchess.jcpi.*
+com.fluxchess.pulse.*
+com.fluxcorp.plugins.*
+com.fluxninja.aperture.*
+com.fluxtion.*
+com.fluxtion.core.*
+com.fluxtion.csv-compiler.*
+com.fluxtion.example.*
+com.fluxtion.extension.*
+com.fluxtion.integration.*
+com.flyberrycapital.*
+com.flybotix.*
+com.flydax.archetype.*
+com.flyobjectspace.*
+com.flyworkspace.*
+com.fmarslan.*
+com.fmarslan.struct-spring.*
+com.fmarslan.tools.*
+com.fmpwizard.*
+com.fmsbeekmans.*
+com.fmsirvent.*
+com.fnicollet.*
+com.fnklabs.*
+com.fnklabs.draenei.*
+com.fnklabs.mt5-client.*
+com.fnklabs.nast.*
+com.fnklabs.smsaero.*
+com.fnproject.fn.*
+com.fnproject.fn.examples.*
+com.fo2rist.cadabra.*
+com.focframework.*
+com.foerster-technologies.*
+com.foilen.*
+com.foldright.auto-pipeline.*
+com.folio-sec.*
+com.folioreader.*
+com.foloosi.*
+com.fomjar.*
+com.fommil.*
+com.fonedynamics.*
+com.fonepay.*
+com.fonrouge.fsLib.*
+com.foodpanda.*
+com.fooock.*
+com.force.*
+com.force.api.*
+com.force.sdk.*
+com.forceai.*
+com.forceai.android.aoplization.*
+com.forceai.android.componentization.*
+com.forceai.glide.*
+com.foreach.across.*
+com.foreach.across.modules.*
+com.foreach.cwb.*
+com.foreach.imageserver.*
+com.foreach.libs.*
+com.foreks.*
+com.foresee.platform.*
+com.forest-interactive.*
+com.forest10.*
+com.foreveross.*
+com.forgerock.*
+com.forgerock.openbanking.*
+com.forio.epicenter.*
+com.forkingcode.androidjunitparams.*
+com.forkingcode.espresso.contrib.*
+com.forlazydevs.*
+com.formance.*
+com.formdev.*
+com.formkiq.*
+com.formkiq.client.*
+com.formkiq.stacks.*
+com.formulasearchengine.*
+com.formulasearchengine.mathmltools.*
+com.fortanix.*
+com.forticode.cipherise.*
+com.fortify.*
+com.fortify.client.api.*
+com.fortify.fod.*
+com.fortify.plugin.*
+com.fortify.ssc.parser.util.*
+com.fortitudetec.*
+com.fortix-lab.*
+com.fortuityframework.*
+com.fortysevendeg.*
+com.fortytwobinary.*
+com.foryouandyourcustomers.*
+com.fossgalaxy.common.*
+com.fossgalaxy.games.*
+com.fossgalaxy.games.tbs.*
+com.fossgalaxy.util.*
+com.fotonauts.*
+com.foundationdb.*
+com.fourpool.autoresizinglistview.*
+com.foursoft.harness.*
+com.foursoft.harness.compatibility.*
+com.foursoft.harness.kbl.*
+com.foursoft.harness.navext.*
+com.foursoft.harness.vec.*
+com.foursoft.jaxb.*
+com.foursoft.jaxb.navext.*
+com.foursoft.jaxb2.*
+com.foursoft.kblmodel.*
+com.foursoft.vecmodel.*
+com.foursquare.*
+com.foxinmy.*
+com.foxnicweb.*
+com.foxnicweb.web.*
+com.fpliu.ndk.pkg.prefab.android.21.*
+com.fragula2.*
+com.fraktalio.fmodel.*
+com.framework-x.*
+com.francescocervone.*
+com.franciscocalaca.*
+com.francoara.*
+com.frankegan.*
+com.franklinchen.*
+com.franz.*
+com.franzwong.app.dropwizard.bundle.*
+com.fraudlabspro.*
+com.fredericboisguerin.excel.*
+com.fredhopper.environment.*
+com.fredhopper.server.*
+com.fredporciuncula.*
+com.free-now.apis.*
+com.free-now.maven.plugins.*
+com.free-now.multirabbit.*
+com.free-now.sauron.*
+com.free-now.sauron.plugins.*
+com.free2move.*
+com.freecharge.co.*
+com.freedii.app.spike.utilslibrary.*
+com.freedomotic.*
+com.freedtechnologies.*
+com.freeletics.coredux.*
+com.freeletics.flow.test.*
+com.freeletics.flowredux.*
+com.freeletics.fork.paparazzi.*
+com.freeletics.gradle.*
+com.freeletics.gradle.app-base.*
+com.freeletics.gradle.app-publishable.*
+com.freeletics.gradle.app.*
+com.freeletics.gradle.base.android.*
+com.freeletics.gradle.base.common.*
+com.freeletics.gradle.base.jvm.*
+com.freeletics.gradle.common.android.*
+com.freeletics.gradle.common.android.app.*
+com.freeletics.gradle.common.gradle.*
+com.freeletics.gradle.common.jvm.*
+com.freeletics.gradle.common.multiplatform.*
+com.freeletics.gradle.common.publish.internal.*
+com.freeletics.gradle.common.publish.oss.*
+com.freeletics.gradle.core-android.*
+com.freeletics.gradle.core-kotlin.*
+com.freeletics.gradle.domain-android.*
+com.freeletics.gradle.domain-kotlin.*
+com.freeletics.gradle.feature.*
+com.freeletics.gradle.legacy-android.*
+com.freeletics.gradle.legacy-kotlin.*
+com.freeletics.gradle.nav.*
+com.freeletics.gradle.root.*
+com.freeletics.gradle.settings.*
+com.freeletics.khonshu.*
+com.freeletics.mad.*
+com.freeletics.migrator.*
+com.freeletics.rxredux.*
+com.freeletics.rxsmartlock.*
+com.freeletics.statelayout.*
+com.freemanan.*
+com.freetmp.*
+com.freewayso.*
+com.frejo.*
+com.freshcodelimited.*
+com.freshdbcache.*
+com.frightanic.*
+com.frimastudio.*
+com.friskysoft.*
+com.frogermcs.androiddevmetrics.*
+com.frogermcs.dagger2metrics.*
+com.frogermcs.gactions.*
+com.frogfront.*
+com.frograms.*
+com.frojasg1.*
+com.frontangle.*
+com.frontegg.*
+com.frontegg.sdk.*
+com.frontegg.sdk.spring.*
+com.frostdeveloper.api.*
+com.frostphyr.*
+com.frostwire.*
+com.frox.opendpm.*
+com.frugalmechanic.*
+com.frybits.harmony.*
+com.frybits.rx.preferences.*
+com.fsist.*
+com.fsryan.gradle.*
+com.fsryan.gradle.coverage.*
+com.fsryan.gradle.smc.*
+com.fsryan.testtools.android.*
+com.fsryan.testtools.jvm.*
+com.fsryan.tools.*
+com.ft.*
+com.ft.membership.*
+com.ftc11392.sequoia.*
+com.ftpix.*
+com.fudeco.hudson.*
+com.fudok.*
+com.fujieid.*
+com.fujieid.jap.http.*
+com.fujieid.jap.http.adapter.*
+com.fujitsu.launcher.*
+com.fulcrumgenomics.*
+com.full360.*
+com.fullcontact.*
+com.fullcontact.client.*
+com.fullcontact.grpc-jersey.*
+com.fullfacing.*
+com.fully-automated.*
+com.fulmicoton.*
+com.fun90.webjars.*
+com.funbasetools.*
+com.functortech.*
+com.fundebug.*
+com.funixproductions.api.*
+com.funixproductions.api.client.*
+com.funixproductions.api.core.*
+com.funixproductions.api.encryption.*
+com.funixproductions.api.encryption.client.*
+com.funixproductions.api.encryption.service.*
+com.funixproductions.api.google.*
+com.funixproductions.api.google.auth.*
+com.funixproductions.api.google.auth.client.*
+com.funixproductions.api.google.auth.service.*
+com.funixproductions.api.google.gmail.*
+com.funixproductions.api.google.gmail.client.*
+com.funixproductions.api.google.gmail.service.*
+com.funixproductions.api.google.recaptcha.*
+com.funixproductions.api.google.recaptcha.client.*
+com.funixproductions.api.google.recaptcha.service.*
+com.funixproductions.api.payment.*
+com.funixproductions.api.payment.paypal.*
+com.funixproductions.api.payment.paypal.client.*
+com.funixproductions.api.payment.paypal.service.*
+com.funixproductions.api.service.*
+com.funixproductions.api.twitch.*
+com.funixproductions.api.twitch.auth.*
+com.funixproductions.api.twitch.auth.client.*
+com.funixproductions.api.twitch.auth.service.*
+com.funixproductions.api.twitch.eventsub.*
+com.funixproductions.api.twitch.eventsub.client.*
+com.funixproductions.api.twitch.eventsub.service.*
+com.funixproductions.api.twitch.reference.*
+com.funixproductions.api.twitch.reference.client.*
+com.funixproductions.api.twitch.reference.service.*
+com.funixproductions.api.user.*
+com.funixproductions.api.user.client.*
+com.funixproductions.api.user.service.*
+com.funixproductions.core.*
+com.funixproductions.core.crud.*
+com.funixproductions.core.exceptions.*
+com.funixproductions.core.files.*
+com.funixproductions.core.test.*
+com.funixproductions.core.tools.*
+com.funnelback.*
+com.fuqqqq.*
+com.fuqssi.boot.*
+com.furgore.*
+com.furkanakdemir.*
+com.fusioncharts.fusionexport.*
+com.futeh.*
+com.futeh.PosNG.*
+com.futunn.openapi.*
+com.future94.*
+com.futureble.*
+com.futureble.bom.*
+com.futureble.design.*
+com.futureble.native.*
+com.futureble.security.*
+com.futuremind.*
+com.futureplatforms.kirin.*
+com.futureplatforms.kirin.android.*
+com.futureplatforms.kirin.console.*
+com.futureplatforms.kirin.core.*
+com.futureplatforms.kirin.gwt.*
+com.futureplatforms.kirin.gwtstub.*
+com.futureplatforms.kirin.ios.*
+com.fuzhutech.*
+com.fuzzylite.*
+com.fxytb.*
+com.fyber.*
+com.fyber.fairbid-sdk-plugin.*
+com.fyber.omsdk.*
+com.fyber.vamp.*
+com.g2forge.alexandria.*
+com.g2forge.bulldozer.*
+com.g2forge.enigma.*
+com.g2forge.gearbox.*
+com.g2forge.habitat.*
+com.g2forge.joint.*
+com.g2forge.reassert.*
+com.ga2230.*
+com.gabechurch.*
+com.gaborpihaj.*
+com.gabrielfeo.*
+com.gabrielittner.auto.value.*
+com.gabrielittner.binder.*
+com.gabrielittner.github-diff.*
+com.gabrielittner.ktlint.*
+com.gabrielittner.renderer.*
+com.gabrielittner.sqlite.*
+com.gabrielittner.threetenbp.*
+com.gabstudios.*
+com.galarzaa.*
+com.galencloud.sdk.*
+com.galenframework.*
+com.gamemorefun.*
+com.gamergrotte.*
+com.gametathya.sdk.*
+com.gammapeit.*
+com.gammarer.*
+com.ganpengyu.*
+com.ganshane.*
+com.ganshane.centipede.*
+com.ganshane.lichen.*
+com.ganshane.monad.*
+com.ganshane.roar.*
+com.ganshane.specs.*
+com.ganshane.stark.*
+com.gantzgulch.tools.*
+com.ganwhat.hummingbird.*
+com.ganyo.*
+com.gaoap.mvc.*
+com.gaoding.imageeditor.*
+com.gaoice.*
+com.garagze.*
+com.garethahealy.*
+com.garethahealy.amq6-dual-jaas-plugin.*
+com.garethahealy.camel-dynamic-loadbalancer.*
+com.garethahealy.camel-file-loadbalancer.*
+com.garethahealy.elastawatch.*
+com.garethahealy.elastic-postman.*
+com.garethahealy.filetransfer-bridge.*
+com.garethahealy.fuse-setup.*
+com.garethahealy.fuse.*
+com.garethahealy.gatling.*
+com.garethahealy.ibmq-to-amq-bridge.*
+com.garethahealy.jboss-fuse-setup.*
+com.garethahealy.jon-plugins.*
+com.garethahealy.karaf-commands.*
+com.garethahealy.loadbalancer-healthchecks.*
+com.garethahealy.poms.*
+com.garethahealy.quota-limits-generator.*
+com.garethevans.plugin.*
+com.garlicg.*
+com.garmin.*
+com.garmin.connectiq.*
+com.garrettheel.*
+com.gartapar.*
+com.garyclayburg.*
+com.garygregory.*
+com.gate6.loginmodule.*
+com.gauravbhola.ripplepulsebackground.*
+com.gauravvats.*
+com.gavinflood.fpl.api.*
+com.gavinmogan.*
+com.gavinmogan.digitalocean.*
+com.gbandsmith.*
+com.gboxsw.*
+com.gboxsw.acpmod.*
+com.gboxsw.miniac.*
+com.gccloud.*
+com.gccloud.uc.*
+com.gcctgroup.*
+com.gdetotut.*
+com.gdxsoft.*
+com.gdxsoft.easyweb.*
+com.gdxsoft.ffmpeg.*
+com.ge.predix.*
+com.ge.predix.mobile.*
+com.ge.pw.*
+com.ge.research.semtk.*
+com.ge.snowizard.*
+com.geared-minds.*
+com.gearitforward.gearlib.*
+com.geccocrawler.*
+com.geckotechnology.*
+com.geekinasuit.micro.*
+com.geektastes.*
+com.geektcp.common.*
+com.geely.gbop.*
+com.geeoz.*
+com.geeoz.atom.*
+com.geeoz.ean.*
+com.geeoz.pawl.*
+com.geeoz.travelport.*
+com.geercode.elehall.*
+com.geetask.*
+com.geetest.android.*
+com.geetest.captcha.*
+com.geetest.sensebot.*
+com.geetools.geemodule.*
+com.geetools.geemvc.*
+com.geirsson.*
+com.geishatokyo.*
+com.geishatokyo.jetty.*
+com.geishatokyo.jetty.tests.*
+com.geishatokyo.tools.*
+com.gelerion.spark.skecthes.*
+com.gelerion.spark.sketches.*
+com.gemecosystem.gemjar.*
+com.gemnasium.*
+com.gempukku.libgdx.graph.*
+com.gempukku.libgdx.lib.*
+com.gemserk.animation4j.*
+com.gemserk.resources.*
+com.genability.*
+com.gene-play.*
+com.geneea.*
+com.geneea.celery.*
+com.generallycloud.*
+com.generativists.*
+com.genestalker.springscreen.*
+com.genesys.*
+com.genesys.gms.*
+com.genesys.gms.android.*
+com.genexus.*
+com.genexus.android.*
+com.genexus.gxserver.*
+com.gengoai.*
+com.geniussports.*
+com.geniusver.*
+com.genmymodel.emf.gwt.*
+com.gennitor.system.*
+com.gensetgo.*
+com.gensler.*
+com.genxiaogu.*
+com.genyherrera.performancelog.*
+com.genzis.filtro.*
+com.geodesk.*
+com.geodevv.testing.*
+com.geophile.*
+com.georgebindragon.*
+com.geosiris.*
+com.geoste.server.*
+com.geotab.*
+com.geoxp.oss.*
+com.geraldoyudo.kweeri.*
+com.gerritdrost.libs.mathie.*
+com.gerritforge.*
+com.gestalt.common.injection.*
+com.gestalt.jbi.components.common.*
+com.gestalt.jbi.mock.*
+com.gestalt.sip.*
+com.gestalt.sip.utilities.*
+com.getbase.*
+com.getbase.android.autoprovider.*
+com.getbase.android.db.*
+com.getbase.android.forger.*
+com.getbase.android.schema.*
+com.getbouncer.*
+com.getcatch.*
+com.getchute.android.libs.photopickerplus.*
+com.getchute.android.sdk.v2.*
+com.getconvey.*
+com.getconvey.oss.*
+com.getehour.connector.jortt.*
+com.geteit.*
+com.geteventstore.*
+com.getfront.*
+com.gethalfpint.*
+com.getinch.retrogram.*
+com.getindata.*
+com.getindata.streaming.*
+com.getjenny.*
+com.getkeepsafe.*
+com.getkeepsafe.android.multistateanimation.*
+com.getkeepsafe.cashier.*
+com.getkeepsafe.dexcount.*
+com.getkeepsafe.relinker.*
+com.getkeepsafe.taptargetview.*
+com.getkluck.*
+com.getmati.*
+com.getout-tlv.brigand.*
+com.getpebble.*
+com.getperka.*
+com.getperka.cli.*
+com.getperka.client.*
+com.getperka.flatpack.*
+com.getperka.sea.*
+com.getphyllo.*
+com.getpinwheel.*
+com.getsentry.raven.*
+com.getshoutout.shoutout.sdk.*
+com.gettyimages.*
+com.gettyio.*
+com.getui.push.*
+com.getupside.*
+com.getupside.dropwizard.*
+com.getwandup.*
+com.getwemap.*
+com.getyourguide.openapi.validation.*
+com.gevamu.corda.*
+com.geyifeng.*
+com.geyifeng.immersionbar.*
+com.gfearthsolution.*
+com.gfk.senbot.*
+com.gframework.boot.*
+com.ggasoftware.*
+com.ggasoftware.indigo.*
+com.ggasoftware.uitest.*
+com.ghdiri.abdallah.*
+com.ghgande.*
+com.ghostchu.*
+com.ghostchu.crowdin.*
+com.ghosthack.*
+com.ghunteranderson.*
+com.ghunteranderson.nexus.*
+com.giancarlobuenaflor.*
+com.gianluz.*
+com.giannivanhoecke.oauth.*
+com.giantheadsoftware.*
+com.gibello.*
+com.giffing.bucket4j.spring.boot.starter.*
+com.giffing.easyxml.*
+com.giffing.wicket.spring.boot.starter.*
+com.giladam.*
+com.gilcloud.fs2.*
+com.gilecode.yagson.*
+com.giljulio.*
+com.giljulio.sneakpeek.*
+com.gilt.*
+com.gilt.apidoc.*
+com.gilt.jdbi-scala.*
+com.gilt.urbanairship4s.*
+com.gimbal.android.*
+com.gimbal.android.v2.*
+com.gimbal.android.v3.*
+com.gimbal.android.v4.*
+com.gingerpayments.*
+com.gingersoftware.*
+com.ginsberg.*
+com.gintechsystems.libs.*
+com.giphy.sdk.*
+com.giraone.imaging.*
+com.giraone.io.*
+com.giraone.rules.*
+com.gistlabs.*
+com.git-floater.*
+com.gitblit.fanout.*
+com.gitblit.fathom.*
+com.gitblit.iciql.*
+com.gitblit.ohmdb.*
+com.gitblit.pippo.*
+com.gitblit.sysinfo.*
+com.gitee.*
+com.gitee.2016Young.*
+com.gitee.AlbertZyc.*
+com.gitee.Biubiuyuyu.*
+com.gitee.Jmysy.*
+com.gitee.PeppaKing.*
+com.gitee.RabbitNoTeeth.*
+com.gitee.TcLi.*
+com.gitee.aachen0.*
+com.gitee.ainilili.*
+com.gitee.alicom-cpass.*
+com.gitee.anwena.*
+com.gitee.archermind-ti.*
+com.gitee.ayezs.*
+com.gitee.baapeng.*
+com.gitee.backflow.*
+com.gitee.baijuncheng-open-source.*
+com.gitee.baikun2017.*
+com.gitee.baixiaol.*
+com.gitee.baixwyai.*
+com.gitee.beiding.*
+com.gitee.bigbirdpeng.*
+com.gitee.blackcows.*
+com.gitee.blacol.*
+com.gitee.blueskyliu.*
+com.gitee.bluesweeter.*
+com.gitee.bodboy.*
+com.gitee.bomeng.*
+com.gitee.booting.*
+com.gitee.burried.*
+com.gitee.cardoon.*
+com.gitee.ccxp123.*
+com.gitee.chenjiangbo.*
+com.gitee.chentaoah.*
+com.gitee.china-yan.*
+com.gitee.chinasoft_ohos.*
+com.gitee.chunjies.*
+com.gitee.cloudangel.*
+com.gitee.cmcc-iot-api.*
+com.gitee.cn9750wang.*
+com.gitee.cn_yaojin.*
+com.gitee.cnbamboo.*
+com.gitee.cnlongdb.*
+com.gitee.cnlongs.*
+com.gitee.code2roc.*
+com.gitee.coldmethod.*
+com.gitee.coolio79.*
+com.gitee.cqdevops.*
+com.gitee.dasikong.*
+com.gitee.denger.*
+com.gitee.dfdiot.*
+com.gitee.dgut-sai.*
+com.gitee.douxxxd.*
+com.gitee.dqhm.*
+com.gitee.duannamei.*
+com.gitee.dushougudu.*
+com.gitee.easy4use.*
+com.gitee.easyzone.*
+com.gitee.empty_null.*
+com.gitee.feizns.*
+com.gitee.flying-cattle.*
+com.gitee.flyzing.*
+com.gitee.freakchicken.*
+com.gitee.freakchicken.dbapi.*
+com.gitee.free2free.*
+com.gitee.freyya-zero.*
+com.gitee.fubluesky.*
+com.gitee.fubluesky.kernel.*
+com.gitee.fufu669.*
+com.gitee.fyw.*
+com.gitee.gps-pro.*
+com.gitee.grassprogramming.*
+com.gitee.gsocode.*
+com.gitee.gtman.*
+com.gitee.haison.*
+com.gitee.hedingwei.*
+com.gitee.heididi.*
+com.gitee.helioz.*
+com.gitee.hengboy.*
+com.gitee.heresz.*
+com.gitee.hifong45.*
+com.gitee.hjj520.*
+com.gitee.hljdrl.*
+com.gitee.hpiot.*
+com.gitee.hsg77.*
+com.gitee.htfx-cloud.*
+com.gitee.huohuzhihui.*
+com.gitee.ian4hu.*
+com.gitee.ibyte.*
+com.gitee.ice_king.*
+com.gitee.icefairy.*
+com.gitee.ijero.*
+com.gitee.iteam.*
+com.gitee.jacksonliao.*
+com.gitee.jarvis-tech.*
+com.gitee.jason024.*
+com.gitee.jastee.*
+com.gitee.jdy2002.*
+com.gitee.jiachuang-nanjing.*
+com.gitee.jinfei602917226.*
+com.gitee.jinxiaohui123.*
+com.gitee.jitatauncle.*
+com.gitee.joonchiu.*
+com.gitee.juanda.*
+com.gitee.jwds666.*
+com.gitee.kamismile.*
+com.gitee.kancy666.*
+com.gitee.karys.*
+com.gitee.kinbug.*
+com.gitee.l0km.*
+com.gitee.lawlietpersonal.*
+com.gitee.lcm742320521.*
+com.gitee.leefj.*
+com.gitee.lei0719.*
+com.gitee.lgsg.*
+com.gitee.libcsp.*
+com.gitee.lin-mt.*
+com.gitee.linxiaozhun.*
+com.gitee.little-miser.*
+com.gitee.liujieyuuuu.*
+com.gitee.liuzhihai520.*
+com.gitee.lokiy.*
+com.gitee.loocao.boot.*
+com.gitee.lopssh.*
+com.gitee.loyo.*
+com.gitee.luancx.*
+com.gitee.luosl.*
+com.gitee.lutao1726.*
+com.gitee.lutao1726.hjsj-api-agent.*
+com.gitee.luyu-community.*
+com.gitee.lwpwork.*
+com.gitee.lwydyby.*
+com.gitee.lzyg.*
+com.gitee.mankel.li.*
+com.gitee.maskit.*
+com.gitee.melin.bee.*
+com.gitee.mic001.*
+com.gitee.micro-service-eco.*
+com.gitee.morilys.jsmile.*
+com.gitee.mrxiao746.*
+com.gitee.mykite.*
+com.gitee.newki123456.*
+com.gitee.nianhua-jiang.*
+com.gitee.nowtd.*
+com.gitee.nuliing.*
+com.gitee.nwalk.*
+com.gitee.oeoe.*
+com.gitee.opensource4clive.*
+com.gitee.osc33.*
+com.gitee.osinn.*
+com.gitee.oumingyuan.*
+com.gitee.peigenlpy.*
+com.gitee.phaeris.*
+com.gitee.pifeng.*
+com.gitee.pomo.*
+com.gitee.practice-pine.*
+com.gitee.primexpy.*
+com.gitee.primxia.*
+com.gitee.pulanos.pangu.*
+com.gitee.pyqone.*
+com.gitee.qdbp.*
+com.gitee.qdbp.thirdparty.*
+com.gitee.qinxianzhong.*
+com.gitee.qiudaozhang.*
+com.gitee.rabbitnoteeth.*
+com.gitee.randomobject.*
+com.gitee.reger.*
+com.gitee.ricardoliu.*
+com.gitee.roow.*
+com.gitee.rslai.base.commons.*
+com.gitee.rslai.base.commons.util.*
+com.gitee.rslai.base.tool.*
+com.gitee.rslai.base.tool.autotest.*
+com.gitee.rslai.commons.*
+com.gitee.rslai.commons.validator.*
+com.gitee.ruanzy.*
+com.gitee.ruge1.*
+com.gitee.rumeng.*
+com.gitee.saianfu_peicl.*
+com.gitee.sdk.*
+com.gitee.sdlszjb.*
+com.gitee.sean-framework.*
+com.gitee.secretopen.*
+com.gitee.sergius.*
+com.gitee.sevenday.*
+com.gitee.shareware.*
+com.gitee.shawn_lxc.*
+com.gitee.sheepedu.*
+com.gitee.sherlockholmnes.*
+com.gitee.sherryon.*
+com.gitee.silentdoer.*
+com.gitee.smiletou.*
+com.gitee.sohnny.*
+com.gitee.song666.*
+com.gitee.sophis.*
+com.gitee.sshhzz.*
+com.gitee.ssyujay1.*
+com.gitee.starblues.*
+com.gitee.steven-jefferson.*
+com.gitee.summer9102.*
+com.gitee.summer_lj.*
+com.gitee.sunchenbin.*
+com.gitee.sunchenbin.mybatis.actable.*
+com.gitee.sunlu.*
+com.gitee.sunyunlin.*
+com.gitee.suveng.*
+com.gitee.swsk33.*
+com.gitee.sywd.*
+com.gitee.tanjunshui.*
+com.gitee.tanxianbo.*
+com.gitee.taotaojs.*
+com.gitee.target123.*
+com.gitee.the-best-riven.*
+com.gitee.tiamosu.*
+com.gitee.tinyservices.*
+com.gitee.topfine.*
+com.gitee.ts_ohos.*
+com.gitee.vae1324.*
+com.gitee.vanting.*
+com.gitee.visionalsun.*
+com.gitee.visionalsun.vsframe.*
+com.gitee.w-whf.*
+com.gitee.w-whf.mybatis-generator-develop.*
+com.gitee.wang_yong_ji.*
+com.gitee.wangjiangwen.*
+com.gitee.wangjkui.*
+com.gitee.wangxinhome.*
+com.gitee.wangzhang.*
+com.gitee.wenbo0.*
+com.gitee.whzzone.*
+com.gitee.windsound.*
+com.gitee.wuyuanwufeng.*
+com.gitee.wxtoos.*
+com.gitee.wy3366.*
+com.gitee.wzJun1.*
+com.gitee.xiezengcheng.*
+com.gitee.xinjump.*
+com.gitee.xiyuan-lgz.*
+com.gitee.xlzhao.*
+com.gitee.xu_qing_lei.*
+com.gitee.xuan_zheng.*
+com.gitee.xuankaicat.*
+com.gitee.xuankaicat.kmnkt.*
+com.gitee.xuankaicat.kmnkt.aliyun.iot.*
+com.gitee.xuankaicat.kmnkt.mqtt.enhance.*
+com.gitee.xuankaicat.kmnkt.socket.*
+com.gitee.xvang.*
+com.gitee.yanfanvip.*
+com.gitee.yangqy.validator.*
+com.gitee.yegetaier.*
+com.gitee.yongzhuzl.*
+com.gitee.ypq2018_admin.*
+com.gitee.yusugar.*
+com.gitee.yvesevy.*
+com.gitee.zaiqiang231.*
+com.gitee.zcx7878.*
+com.gitee.zhan5.*
+com.gitee.zhangchenyan.*
+com.gitee.zhao-baolin.*
+com.gitee.zhaohuihua.*
+com.gitee.zhaoliuwei.*
+com.gitee.zhb9103.*
+com.gitee.zhibi.*
+com.gitee.zhongyuns.*
+com.gitee.zhousiwei.*
+com.gitee.zhtt.*
+com.gitee.zhuimengshaonian.*
+com.gitee.zimmor.*
+com.gitee.ziro.*
+com.gitee.zjkxtech.*
+com.gitee.zodiacstack.*
+com.gitee.zxkxc.*
+com.gitee.zycra.*
+com.gitee.zzhhz.*
+com.gitee.zzt_rex.*
+com.gitegg.platform.*
+com.gitenter.*
+com.github.*
+com.github.000haitham000.*
+com.github.03.*
+com.github.0312birdzhang.*
+com.github.05nelsonm.*
+com.github.0604hx.*
+com.github.0x4096.*
+com.github.0xe1f.*
+com.github.0xshamil.*
+com.github.100sms.*
+com.github.1137095129.*
+com.github.11dong.*
+com.github.120011676.*
+com.github.123avi.*
+com.github.123leo.*
+com.github.13162576590.*
+com.github.13872095752.*
+com.github.13h3r.sqlmaster.*
+com.github.1510460325.*
+com.github.15706058532.*
+com.github.17640410053.*
+com.github.1991wangliang.*
+com.github.1abhishekpandey.*
+com.github.1forge.*
+com.github.1ssqq1lxr.*
+com.github.230093521.*
+com.github.2447007062.*
+com.github.247-ai.*
+com.github.24kpure.*
+com.github.250767Liu.test.*
+com.github.28Smiles.*
+com.github.28Smiles.jasync-sql-extensions.*
+com.github.28Smiles.jdbi-modules.*
+com.github.28v7.fedex-webservice.*
+com.github.2captcha.*
+com.github.2chilled.*
+com.github.2gis.winium.*
+com.github.2ndlines.*
+com.github.347255699.*
+com.github.379753498.*
+com.github.3cpj.*
+com.github.3mph4515.*
+com.github.3tty0n.*
+com.github.4-Eyes.lastfm-library.*
+com.github.514687572.*
+com.github.618lf.*
+com.github.668mt.mos.*
+com.github.668mt.web.*
+com.github.695067018.*
+com.github.714273725.*
+com.github.759434091.*
+com.github.785175323.*
+com.github.7moor-tech.*
+com.github.819548945.*
+com.github.83945105.*
+com.github.876415840.*
+com.github.911992.*
+com.github.9215095360.*
+com.github.92tonywills.*
+com.github.935237604.*
+com.github.937447974.*
+com.github.ASKabanets.*
+com.github.AVE-cesar.*
+com.github.Abhilashpn.*
+com.github.Adetunjii.*
+com.github.Adilbek12.*
+com.github.Alex-2713-GitHub.*
+com.github.Alex-2713.*
+com.github.AmalH.*
+com.github.AmalLibs.*
+com.github.Andy-Shao.*
+com.github.AniketDevloper1.*
+com.github.AnonymousMister.*
+com.github.AnonymousMister.plugin.*
+com.github.ApploverSoftware.*
+com.github.ArcticLampyrid.KtJsonRpcPeer.*
+com.github.AxelUA95.*
+com.github.Azim.*
+com.github.BaekGeunYoung.*
+com.github.BagyaNuwanthi.*
+com.github.BaicProject.*
+com.github.BeFabulousJia12.*
+com.github.BonaparteDawn.*
+com.github.Boyceee.*
+com.github.BraianIDeRoo.*
+com.github.ByungJun25.*
+com.github.CCweixiao.*
+com.github.Caesaryun.*
+com.github.CedrickFlocon.*
+com.github.ChenChiaHung.*
+com.github.ChenHaoHu.*
+com.github.ChristianNHenriksen.*
+com.github.Cka3o4Huk.*
+com.github.DDLoveWorld.*
+com.github.DNAProject.*
+com.github.DataSystemsGroupUT.*
+com.github.DaviddeMiguel.*
+com.github.DeepseaPlatform.*
+com.github.Despical.*
+com.github.DigioAndroid.*
+com.github.DilvanLab.*
+com.github.Dorae132.*
+com.github.Drjacky.*
+com.github.EDM-zhou.*
+com.github.EmergentOrder.*
+com.github.EmmanueleBollino.*
+com.github.Esaldino.*
+com.github.FabAsset.*
+com.github.FeiChaoyu.*
+com.github.FrestoBar.*
+com.github.G0-Software.*
+com.github.GBSEcom.*
+com.github.GG-A.*
+com.github.GitHub-Xzhi.*
+com.github.Gr1f0n6x.*
+com.github.HaneYin.*
+com.github.Hector1990.*
+com.github.Hookz.*
+com.github.IdeaUniverse.*
+com.github.IndiscriminateCoding.*
+com.github.Isshss.*
+com.github.Jakob-G.Sorting-Library.*
+com.github.Jakob-G.SortingLibrary.*
+com.github.Jntmkk.*
+com.github.JoaquinVte.*
+com.github.JoeKerouac.*
+com.github.JokerLee-9527.*
+com.github.JulienPeloton.*
+com.github.K0zka.*
+com.github.Karthikk15.*
+com.github.KeithSSmith.*
+com.github.KhaldAttya.*
+com.github.Kim-YeongJin.*
+com.github.L-kaxy.*
+com.github.LQliuqiang.*
+com.github.LiCo13.*
+com.github.LinYuanBaoBao.*
+com.github.Ling2099.*
+com.github.Lozitsky.*
+com.github.MDingas.*
+com.github.Ma27.*
+com.github.MadaraFsl.*
+com.github.MalaysiaKeropok.*
+com.github.Maomisc.*
+com.github.Maskedlaodi.*
+com.github.Microsoft.AdaptiveCards.*
+com.github.MissThee.*
+com.github.MoebiusSolutions.avro-registry-in-source.*
+com.github.MoebiusSolutions.jacle.*
+com.github.MostafaGazar.*
+com.github.Mr-lin.*
+com.github.MrThanksgiving.*
+com.github.MyEclipse1214.*
+com.github.Navisayslisten.*
+com.github.NicholasMolyneaux.*
+com.github.NoamShaish.*
+com.github.Nublo.*
+com.github.NyBatis.*
+com.github.OrangeGangsters.*
+com.github.OriolLopezMassaguer.*
+com.github.Osama-O5.*
+com.github.PetrIlya.*
+com.github.PuspenduBanerjee.*
+com.github.QaReport.*
+com.github.Raonitish.*
+com.github.RealWanYue.*
+com.github.RomanKhachko.fsp.*
+com.github.Rydgel.*
+com.github.Sanjeev139.*
+com.github.Shouheng88.*
+com.github.ShubhamGang.*
+com.github.SideeX.*
+com.github.SilentSamurai.*
+com.github.Silwings-git.*
+com.github.Simonwep.*
+com.github.SnipyJulmy.*
+com.github.SriMaddy.*
+com.github.SubhrajyotiSen.*
+com.github.SujataDarekar.*
+com.github.SureshCS-50.*
+com.github.TooLazyy.*
+com.github.ToolUtils.*
+com.github.Trans88.*
+com.github.Tumbler0809.*
+com.github.TurquoiseSpace.*
+com.github.USTC-INFINITELAB.*
+com.github.UncleCatMySelf.*
+com.github.ValerioLeite.*
+com.github.VipulKumarSinghTech.*
+com.github.VyacheslavShmakin.*
+com.github.WCH996600.*
+com.github.WHUTzju.*
+com.github.WangJi92.*
+com.github.WojtekKowaluk.*
+com.github.XDean.*
+com.github.XandrMaster.*
+com.github.Y292450104.*
+com.github.YassKnight.*
+com.github.Zardozz.*
+com.github.ZhangNYG.*
+com.github.ZhouFan1111.*
+com.github.a-langer.*
+com.github.a-nigredo.*
+com.github.a-pz.*
+com.github.a14e.*
+com.github.a2mz.*
+com.github.a404318964.*
+com.github.a497771654.*
+com.github.a524631266.*
+com.github.a578977626.*
+com.github.a64adam.*
+com.github.a870368162.*
+com.github.a982338665.*
+com.github.aaitmouloud.*
+com.github.aakash-agsft.*
+com.github.aalbul.*
+com.github.aalobaidi.*
+com.github.aaricchen.*
+com.github.aaronp.*
+com.github.aaronshan.*
+com.github.aarsy.googlemapsanimations.*
+com.github.aarsy.googlemapsrippleeffect.*
+com.github.aarsy.vcard-androidParser.*
+com.github.aartikov.*
+com.github.aasthalife.*
+com.github.abagabagon.*
+com.github.abarhub.filerw.*
+com.github.abashev.*
+com.github.abduegal.*
+com.github.abdvel.*
+com.github.abejoy.*
+com.github.abel533.*
+com.github.abelmarkus.*
+com.github.abhijithpradeep.*
+com.github.abhinavmishra14.*
+com.github.abhishek8908.*
+com.github.abirmingham.*
+com.github.abj351r7.*
+com.github.abola.*
+com.github.abrarsyed.gmcp.*
+com.github.abrarsyed.jastyle.*
+com.github.absysgroup.jeco.*
+com.github.abyu.*
+com.github.acavailhez.*
+com.github.acc15.*
+com.github.acc15.htmlres.*
+com.github.acemerlin.*
+com.github.acflorea.*
+com.github.achatain.*
+com.github.achnly.*
+com.github.achrafamil.*
+com.github.acidelk.*
+com.github.acierto.*
+com.github.acionescu.*
+com.github.acmi.*
+com.github.acodrx.*
+com.github.acrisci.*
+com.github.acsgh.common.gradle.*
+com.github.acsgh.common.scala.*
+com.github.acsgh.mad.scala.*
+com.github.acsgh.mad.scala.converter.json.*
+com.github.acsgh.mad.scala.converter.template.*
+com.github.acsgh.mad.scala.examples.*
+com.github.acsgh.mad.scala.examples.server.*
+com.github.acsgh.mad.scala.provider.*
+com.github.acsgh.mad.scala.router.*
+com.github.acsgh.mad.scala.server.*
+com.github.acsgh.mad.scala.server.converter.json.*
+com.github.acsgh.mad.scala.server.converter.template.*
+com.github.acsgh.mad.scala.server.provider.*
+com.github.acsgh.mad.scala.server.support.*
+com.github.acsgh.mad.scala.support.*
+com.github.acsgh.metrics.scala.*
+com.github.acsgh.metrics.scala.publisher.*
+com.github.acsgh.spark.scala.*
+com.github.acsgh.spark.scala.converter.json.*
+com.github.acsgh.spark.scala.converter.template.*
+com.github.acsgh.spark.scala.support.*
+com.github.acshmily.*
+com.github.acwatson.*
+com.github.adamyork.*
+com.github.adangel.liquibase.ext.*
+com.github.adangel.org.mongeez.*
+com.github.adben002.testdatabuilder.*
+com.github.adchilds.*
+com.github.adedayo.eclipse.sdk.*
+com.github.adedayo.intellij.sdk.*
+com.github.adefarge.kosm.*
+com.github.adejanovski.*
+com.github.adejanovski.cassandra.policies.*
+com.github.adenza.*
+com.github.adesigns.*
+com.github.adetiamarhadi.*
+com.github.adevone.summer.*
+com.github.adiralashiva8.*
+com.github.admincaofuqiang.*
+com.github.adminfaces.*
+com.github.admuing.*
+com.github.adorow.*
+com.github.adowrath.*
+com.github.adrianboimvaser.*
+com.github.adriankuta.*
+com.github.adrmal.*
+com.github.adrninistrator.*
+com.github.adroit007.*
+com.github.advantageous.*
+com.github.advisedtesting.*
+com.github.adyliu.*
+com.github.aenniw.*
+com.github.aeonlucid.hvaapi.*
+com.github.afarion1.*
+com.github.afbjorklund.gradle.caching.memcached.*
+com.github.afester.javafx.*
+com.github.affandes.hamzah.*
+com.github.afflya.*
+com.github.afkbrb.*
+com.github.afpdev.*
+com.github.agadar.*
+com.github.agadar.javacommander.*
+com.github.agaro1121.*
+com.github.agfsapi4j.*
+com.github.agile-ai.*
+com.github.agilesteel.*
+com.github.agliznetsov.swagger-tools.*
+com.github.aglover.*
+com.github.agmenc.*
+com.github.agogs.*
+com.github.agolubev.*
+com.github.agourlay.*
+com.github.agrosner.*
+com.github.agustinmiani.*
+com.github.agzamovr.*
+com.github.ahant-pabi.*
+com.github.ahenteti.*
+com.github.ahjohannessen.*
+com.github.ahjszhx.*
+com.github.ahmadmo.*
+com.github.ahmadsayeed3.*
+com.github.ahmadshadab.*
+com.github.ahmed-eissa.*
+com.github.ahmerafzal1.*
+com.github.ahodanenok.maven.plugins.*
+com.github.aidensuen.*
+com.github.aiderpmsi.*
+com.github.aifeinik.*
+com.github.ailyenko.*
+com.github.aimate.*
+com.github.aimind.*
+com.github.ainoha-framework.*
+com.github.aiosign.*
+com.github.aiowang.*
+com.github.air-project.*
+com.github.airfer.*
+com.github.airk000.*
+com.github.aiseno.*
+com.github.aishfenton.*
+com.github.aistomin.*
+com.github.aivancioglo.*
+com.github.aizuzi.*
+com.github.ajalt.*
+com.github.ajalt.clikt.*
+com.github.ajalt.colormath.*
+com.github.ajalt.colormath.extensions.*
+com.github.ajalt.mordant.*
+com.github.ajaver-baiku.*
+com.github.ajitsing.*
+com.github.ajkaanbal.*
+com.github.ajoecker.*
+com.github.ajozwik.*
+com.github.ajrnz.*
+com.github.ajurasz.*
+com.github.ak98neon.*
+com.github.akabulniyazov.*
+com.github.akarazhev.*
+com.github.akarnokd.*
+com.github.akarnokd.rxjava3.*
+com.github.akashandroid90.*
+com.github.akashandroid90.googlesupport.*
+com.github.akashandroid90.vectorsupportview.*
+com.github.akaskywolf.*
+com.github.akbar1621.*
+com.github.akhasoft.*
+com.github.akiellor.jasmine.*
+com.github.akileev.*
+com.github.akinaru.*
+com.github.akiraly.reusable-poms.*
+com.github.akman.*
+com.github.akmo03.*
+com.github.aknuth.*
+com.github.akosbordas.*
+com.github.akovac35.*
+com.github.akshay0709.*
+com.github.akunzai.*
+com.github.akurilov.*
+com.github.akvast.*
+com.github.akvone.*
+com.github.akwei.*
+com.github.alaisi.nalloc.*
+com.github.alaisi.pgasync.*
+com.github.alamkanak.*
+com.github.alanverbner.*
+com.github.alaptseu.*
+com.github.albahrani.*
+com.github.albaker.*
+com.github.albanseurat.*
+com.github.alberto-hernandez.*
+com.github.alberto-mr.*
+com.github.albertoanguita.*
+com.github.albertopires.utils.*
+com.github.albertosh.*
+com.github.albertosh.expandablerecyclerviewwithreordering.*
+com.github.albertosh.infininitefragmentpageradapter.*
+com.github.albfernandez.*
+com.github.albfernandez.richfaces.*
+com.github.albfernandez.richfaces.cdk.*
+com.github.albfernandez.richfaces.cdk.test.*
+com.github.albfernandez.seam.*
+com.github.albfernandez.struts.*
+com.github.albfernandez.test-jsf.*
+com.github.albocoder.*
+com.github.aldearle.*
+com.github.alei121.*
+com.github.aleksandarskrbic.*
+com.github.aleksandy.*
+com.github.alenfive.*
+com.github.alesms.*
+com.github.alessandroargentieri.*
+com.github.alessandrozamberletti.*
+com.github.alessio-santacroce.*
+com.github.alex-2713.*
+com.github.alex-pumpkin.*
+com.github.alex-zuy.boilerplate.*
+com.github.alex079.*
+com.github.alex1304.*
+com.github.alexakis97.*
+com.github.alexanderbezverhni.*
+com.github.alexanderwe.*
+com.github.alexandrnikitin.*
+com.github.alexandrustana.*
+com.github.alexarchambault.*
+com.github.alexarchambault.ammonium.*
+com.github.alexarchambault.artifact.*
+com.github.alexarchambault.jove.*
+com.github.alexarchambault.jupyter.*
+com.github.alexarchambault.play22sbt.*
+com.github.alexarchambault.tmp.*
+com.github.alexarchambault.tmp.ammonite.*
+com.github.alexarchambault.tmp.ipcsocket.*
+com.github.alexburlton.*
+com.github.alexcojocaru.*
+com.github.alexdlaird.*
+com.github.alexdochioiu.*
+com.github.alexey-anufriev.*
+com.github.alexey-lapin.*
+com.github.alexey-lapin.sbapsd.*
+com.github.alexeykorshun.*
+com.github.alexeypodolian.*
+com.github.alexeyr.pcg.*
+com.github.alexfalappa.*
+com.github.alexgianq.*
+com.github.alexheretic.*
+com.github.alexisjehan.*
+com.github.alexkolpa.*
+com.github.alexliesenfeld.*
+com.github.alexmao86.*
+com.github.alexmojaki.*
+com.github.alexp11223.*
+com.github.alexsandrospecht.*
+com.github.alexsniffin.*
+com.github.alexvictoor.*
+com.github.alexwibowo.*
+com.github.alfonso-presa.restflow.*
+com.github.alfonsoLeandro.*
+com.github.alfredxiao.*
+com.github.ali-rezaei.android.client.customview.*
+com.github.aliabozaid.slick.*
+com.github.aliakhtar.*
+com.github.alice52.*
+com.github.alim-akbashev.*
+com.github.alinvasile.jsla.*
+com.github.alishtory.*
+com.github.aliteralmind.*
+com.github.alittlehuang.*
+com.github.aljoshakoecher.*
+com.github.alkedr.*
+com.github.alkurop.*
+com.github.all3fox.*
+com.github.allantl.*
+com.github.allenxuan.*
+com.github.allocate-mutate-compact.*
+com.github.allthecodes.*
+com.github.almasb.*
+com.github.almex.*
+com.github.almondbranch.*
+com.github.almondbranch.command-line-parser.*
+com.github.almondtools.*
+com.github.aloiscochard.*
+com.github.aloiscochard.sindi.*
+com.github.alonsodomin.*
+com.github.alonsodomin.colog.*
+com.github.alonsodomin.cron4s.*
+com.github.aloomaio.*
+com.github.aloomaio.androidsdk.*
+com.github.alorma.*
+com.github.alorma.compose-drawer.*
+com.github.alotuser.*
+com.github.alperenp.*
+com.github.alperkurtul.*
+com.github.alphemsoft.*
+com.github.alterego7.*
+com.github.alterego7.alphabet-soup-macros_sjs1_2.12.0.4.0.com.github.alterego7.*
+com.github.alteryx.*
+com.github.altuncu.*
+com.github.alvaro72.*
+com.github.alvazz.*
+com.github.alvinqq.*
+com.github.alxgrk.blendedbackground.*
+com.github.aly8246.*
+com.github.amado-saladino.*
+com.github.aman-1995.*
+com.github.aman400.*
+com.github.amanasatija.*
+com.github.amanganiello90.*
+com.github.amanv8060.*
+com.github.amap-demo.*
+com.github.amaranthsoftware.*
+com.github.amigold.fundapter.*
+com.github.amigold.fundapter2.*
+com.github.aminmb37.beerworks.*
+com.github.amitkhosla.*
+com.github.amitrei.*
+com.github.amjadnas.*
+com.github.amlcurran.showcaseview.*
+com.github.amo-com.*
+com.github.ampedandwired.*
+com.github.amr.*
+com.github.amreenshaikh.*
+com.github.amuguelove.*
+com.github.amuyu.*
+com.github.amwayjava.*
+com.github.anadea.*
+com.github.analogdevicesinc.*
+com.github.analytics-java.*
+com.github.anandhababu-k.*
+com.github.anandvarkeyphilips.*
+com.github.anastaciocintra.*
+com.github.anastr.*
+com.github.ancane.*
+com.github.ancienter.*
+com.github.andkulikov.*
+com.github.andr83.*
+com.github.andrasbeni.*
+com.github.andreas-maier-ntt.*
+com.github.andrebonna.*
+com.github.andreidore.*
+com.github.andreivo.*
+com.github.andrejlukasevic.*
+com.github.andreldsr.*
+com.github.andremion.*
+com.github.andrepnh.*
+com.github.andreptb.*
+com.github.andresmerida.*
+com.github.andrestejero.*
+com.github.andretbm.*
+com.github.andrewjc.kheera.*
+com.github.andrewlord1990.*
+com.github.andrewoma.dexx.*
+com.github.andrewoma.kommon.*
+com.github.andrewoma.kwery.*
+com.github.andrewthehan.*
+com.github.andrezimmermann.*
+com.github.andriydruk.*
+com.github.andriykuba.*
+com.github.androflo.*
+com.github.android-password-store.*
+com.github.android-password-store.android-application.*
+com.github.android-password-store.android-common.*
+com.github.android-password-store.android-library.*
+com.github.android-password-store.binary-compatibility.*
+com.github.android-password-store.bouncycastle-dependency.*
+com.github.android-password-store.crowdin-plugin.*
+com.github.android-password-store.git-hooks.*
+com.github.android-password-store.kotlin-android.*
+com.github.android-password-store.kotlin-common.*
+com.github.android-password-store.kotlin-kapt.*
+com.github.android-password-store.kotlin-library.*
+com.github.android-password-store.psl-plugin.*
+com.github.android-password-store.published-android-library.*
+com.github.android-password-store.rename-artifacts.*
+com.github.android-password-store.sentry.*
+com.github.android-password-store.spotless.*
+com.github.android-password-store.versioning-plugin.*
+com.github.android-s14.*
+com.github.android-tools.*
+com.github.androidbus.*
+com.github.androidop.*
+com.github.androidsocialnetworks.*
+com.github.andtankian.*
+com.github.andy-a-coder.*
+com.github.andy2003.*
+com.github.andyb129.*
+com.github.andycandy-de.*
+com.github.andyczy.*
+com.github.andyglow.*
+com.github.andygoossens.*
+com.github.andyken.*
+com.github.andylke.*
+com.github.andysundar.*
+com.github.anerdib.*
+com.github.aneureka.*
+com.github.angads25.*
+com.github.angelndevil2.*
+com.github.angelowolf.*
+com.github.angiolep.*
+com.github.angleshq.*
+com.github.angry1980.*
+com.github.anhem.*
+com.github.anicolaspp.*
+com.github.aniketwadkar78.*
+com.github.anilganipineni.*
+com.github.anilople.*
+com.github.anirudhvarma12.*
+com.github.anirudhvyas.*
+com.github.anish7kumar.*
+com.github.anji-plus.*
+com.github.ankitgupta210790.*
+com.github.ankurcha.*
+com.github.ankurpathak.password.*
+com.github.ankurpathak.primitive.*
+com.github.ankurpathak.springframework.orm.jpa.*
+com.github.ankurpathak.username.*
+com.github.ankzz.*
+com.github.annchain.*
+com.github.anno4j.*
+com.github.annypatel.allopen-annotations.*
+com.github.annypatel.databinding.*
+com.github.annypatel.image-assert.*
+com.github.annypatel.retrocrawler.*
+com.github.anonymousmister.gradle.plugin.*
+com.github.anotherjavacoder.*
+com.github.anrosca.*
+com.github.anrwatchdog.*
+com.github.ansell.*
+com.github.ansell.abstract-service-loader.*
+com.github.ansell.aterms.*
+com.github.ansell.concurrent.*
+com.github.ansell.csv.*
+com.github.ansell.csv.sum.*
+com.github.ansell.csvsum.*
+com.github.ansell.dwca.*
+com.github.ansell.hermit.*
+com.github.ansell.jdefaultdict.*
+com.github.ansell.jjtraveler.*
+com.github.ansell.oas.*
+com.github.ansell.owlapi.*
+com.github.ansell.pellet.*
+com.github.ansell.property-util.*
+com.github.ansell.rdf4j-schema-generator.*
+com.github.ansell.restlet-utils.*
+com.github.ansell.semargl.*
+com.github.ansell.sesame-rio-extensions.*
+com.github.ansell.shp.*
+com.github.anshulbajpai.*
+com.github.anshuljayn.*
+com.github.anskarl.*
+com.github.answerail.*
+com.github.answerzdigital.*
+com.github.antdo.*
+com.github.antechrestos.*
+com.github.antelopeframework.*
+com.github.antennaesdk.*
+com.github.antennaesdk.common.*
+com.github.antennaesdk.server.*
+com.github.antezovko23.*
+com.github.anthony-o.*
+com.github.antideveloppeur.*
+com.github.antkudruk.*
+com.github.antlrjavaparser.*
+com.github.anton-fomin.*
+com.github.anton-novikau.*
+com.github.antonio-it-lab.*
+com.github.antonioazambuja.*
+com.github.antoniobarbuzzi.*
+com.github.antoniobg0.*
+com.github.antoniomacri.*
+com.github.antonpopoff.*
+com.github.antonsjava.*
+com.github.antrew.*
+com.github.ants-double.*
+com.github.anupcowkur.*
+com.github.anuragashok.*
+com.github.anvirego.*
+com.github.anwesh43.*
+com.github.anylogic.*
+com.github.anymaker.*
+com.github.anyzm.*
+com.github.aoiroaoino.*
+com.github.aoreshin.*
+com.github.aoshiguchen.framework.*
+com.github.aoudiamoncef.*
+com.github.aowoWolf.*
+com.github.apachedx.*
+com.github.apanimesh061.*
+com.github.apavlidi.*
+com.github.apercova.*
+com.github.apetrelli.*
+com.github.apetrelli.gwtintegration.*
+com.github.apetrelli.samplegwt.*
+com.github.apetrelli.scafa.*
+com.github.apiggs.*
+com.github.apmasell.flabbergast.*
+com.github.apolselli.*
+com.github.appayy.*
+com.github.appiumtestdistribution.*
+com.github.applesline.*
+com.github.applikey.*
+com.github.applikeysolutions.*
+com.github.appthings.*
+com.github.appundefined.*
+com.github.apuex.*
+com.github.apuex.cmcc-cint3.*
+com.github.apuex.cmcc-cint4.*
+com.github.apuex.event-source.*
+com.github.apuex.jee.saaj.*
+com.github.apuex.jms.*
+com.github.apuex.pa.*
+com.github.apuex.protobuf.*
+com.github.apuex.springbootsolution.*
+com.github.aq0706.*
+com.github.aqiu202.*
+com.github.aqiu202.aliyun.*
+com.github.aqiu202.api.*
+com.github.aqiu202.aurora.*
+com.github.aqiu202.huawei.*
+com.github.aqiu202.wechat.*
+com.github.aquality-automation.*
+com.github.arachnidium.*
+com.github.arachnidium.util.*
+com.github.aracwong.*
+com.github.aravindaw.*
+com.github.aravinu19.*
+com.github.archongum.*
+com.github.arcizon.*
+com.github.ardenliu.*
+com.github.arekbee.*
+com.github.argedor.*
+com.github.argherna.grundy.*
+com.github.argherna.tazewell.*
+com.github.arguslab.*
+com.github.arielf-camacho.*
+com.github.arimorty.*
+com.github.arinyaho.*
+com.github.ariordan.*
+com.github.armay.*
+com.github.arnabk.*
+com.github.arnaudroger.*
+com.github.aro-tech.*
+com.github.arockiarajv.*
+com.github.arosini.*
+com.github.arqisoft.*
+com.github.artcousan.*
+com.github.arteam.*
+com.github.artemkorsakov.*
+com.github.artfultom.*
+com.github.arthur-bit-monnot.*
+com.github.arthurtira.*
+com.github.artislong.*
+com.github.arttom.*
+com.github.artur-tamazian.*
+com.github.arturogutierrez.*
+com.github.arturopala.*
+com.github.artus.*
+com.github.artyomcool.*
+com.github.arucard21.simplyrestful.*
+com.github.arulrajnet.*
+com.github.arunsoman.ipc.*
+com.github.arvyy.*
+com.github.aryan9234.*
+com.github.asaas.*
+com.github.asaokawasaki.*
+com.github.asasas234.*
+com.github.aschet.*
+com.github.asdw741111.*
+com.github.aselab.*
+com.github.aserg-ufmg.*
+com.github.asevans48.*
+com.github.asher-stern.*
+com.github.ashish29agre.*
+com.github.ashwindmk.*
+com.github.asifmujteba.*
+com.github.asilvestre.*
+com.github.aslakhellesoy.*
+com.github.asm0dey.*
+com.github.asne.*
+com.github.asne.facebook.*
+com.github.asne.library.*
+com.github.assemblits.*
+com.github.asteraether.tomlib.*
+com.github.astonbitecode.*
+com.github.astrolabsoftware.*
+com.github.asuslennikov.*
+com.github.asyl.animation.*
+com.github.atais.*
+com.github.atdixon.*
+com.github.athi.*
+com.github.athieriot.*
+com.github.atomashpolskiy.*
+com.github.atool.*
+com.github.atshow.*
+com.github.atsushi130.*
+com.github.attemper.*
+com.github.attiand.*
+com.github.attt.*
+com.github.aug04.*
+com.github.auryc-inc.*
+com.github.austinc.*
+com.github.autermann.*
+com.github.auties00.*
+com.github.autoexsel.*
+com.github.autofixture.*
+com.github.autograder.*
+com.github.automain.*
+com.github.automatedowl.*
+com.github.automately.*
+com.github.autoscaler.*
+com.github.autostyle.*
+com.github.avaliani.snapshot.*
+com.github.avarabyeu.*
+com.github.avarabyeu.jashing.*
+com.github.avarabyeu.jashing.extensions.*
+com.github.avasin.*
+com.github.avatar21.*
+com.github.avenwu.*
+com.github.avinandi.*
+com.github.avonengel.*
+com.github.avro-kotlin.avro4k.*
+com.github.avvero.*
+com.github.awakebymyself.*
+com.github.aweo.*
+com.github.awesome-it-ternopil.*
+com.github.awfun.*
+com.github.axdotl.*
+com.github.axel22.*
+com.github.axet.*
+com.github.axet.fbreader.*
+com.github.axet.litedb.*
+com.github.axet.play.*
+com.github.axet.sqlite4java.*
+com.github.axway-api-management-plus.apim-cli.*
+com.github.axway-api-management-plus.swagger-promote.*
+com.github.ayberkcansever.*
+com.github.ayongw.*
+com.github.aytchell.*
+com.github.azakordonets.*
+com.github.azapen6.*
+com.github.azazar.*
+com.github.azbh111.*
+com.github.b3er.*
+com.github.b3er.rxfirebase.*
+com.github.babylikebird.*
+com.github.bachelor-thesis-project-gruppun.*
+com.github.backtrace-labs.backtrace-android.*
+com.github.backtrace-labs.backtrace-java.*
+com.github.backtrace-labs.backtrace-log4j.*
+com.github.backtrace-labs.backtrace-log4j2.*
+com.github.bad-pop.*
+com.github.badamowicz.*
+com.github.badoualy.*
+com.github.baev.*
+com.github.baileykm.*
+com.github.bairdli.*
+com.github.bajiraoandroid.*
+com.github.bakenezumi.*
+com.github.bakerln.*
+com.github.bakerln.framework.*
+com.github.balachandarsv.*
+com.github.balajeetm.*
+com.github.balchua.*
+com.github.balintrudas.*
+com.github.bamboo-cn.*
+com.github.banana-j.*
+com.github.bancolombia.*
+com.github.baneizalfe.pulltodismisspager.*
+com.github.bangarharshit.*
+com.github.baniuk.*
+com.github.banjowaza.*
+com.github.bannmann.*
+com.github.bannmann.labs.*
+com.github.bannmann.labs.carriers.*
+com.github.bannmann.maven.cdi.*
+com.github.bannmann.maven.probe.*
+com.github.bannmann.maven.silverchain.*
+com.github.bannmann.restflow.*
+com.github.bannmann.trako.*
+com.github.bannmann.whisperjson.*
+com.github.barakb.*
+com.github.barambani.*
+com.github.barismeral.*
+com.github.barismeral.quickio.*
+com.github.barteksc.*
+com.github.bartlomiej-gora.*
+com.github.basavaraj1985.*
+com.github.basking2.*
+com.github.bassman5.*
+com.github.bastiaanjansen.*
+com.github.bata19.*
+com.github.batkinson.*
+com.github.batkinson.plugins.*
+com.github.batmanwannab.*
+com.github.batmanwannab.try.*
+com.github.batscream.*
+com.github.battermann.*
+com.github.battlesteed.*
+com.github.bayounesamine.*
+com.github.bazar-nazar.*
+com.github.bbottema.*
+com.github.bboxlab.*
+com.github.bcolyn.ajtest.*
+com.github.bcruts.*
+com.github.bdelville.*
+com.github.bdeneuter.*
+com.github.bderancourt.*
+com.github.bdkosher.*
+com.github.bdoepf.*
+com.github.bdpiparva.plugin.base.*
+com.github.bdqfork.*
+com.github.bduisenov.*
+com.github.bdwashbu.*
+com.github.beOkWithAnything.*
+com.github.beanio.*
+com.github.becauseQA.*
+com.github.becausetesting.*
+com.github.bednar.*
+com.github.bedrin.*
+com.github.beetlestance.*
+com.github.beetlestance.android-extensions.*
+com.github.beingcoder.*
+com.github.beinn.*
+com.github.bekannax.*
+com.github.beksomega.*
+com.github.belaso.*
+com.github.belhadj-haythem.*
+com.github.belhe001.*
+com.github.bellam.*
+com.github.belyiz.*
+com.github.ben-manes.*
+com.github.ben-manes.caffeine.*
+com.github.benchdoos.*
+com.github.benefactor-org.*
+com.github.benfradet.*
+com.github.benfromchina.*
+com.github.bengolder.*
+com.github.benhutchison.*
+com.github.benniekrijger.*
+com.github.bennylut.*
+com.github.benoitdion.ln.*
+com.github.benoitlouy.*
+com.github.bentorfs.*
+com.github.beothorn.*
+com.github.berkesa.*
+com.github.bernardpletikosa.*
+com.github.bernerbits.*
+com.github.berry120.JCSPGenerator.*
+com.github.berry120.VueLoop.*
+com.github.berry120.ac500.*
+com.github.berry120.jfizzy.*
+com.github.berry120.jopenlyrics.*
+com.github.berry120.ssd1306.*
+com.github.bertrand31.*
+com.github.besherman.*
+com.github.besmaze18.*
+com.github.bespalovdn.*
+com.github.bessemHmidi.*
+com.github.betacatcode.*
+com.github.bettehem.*
+com.github.bettehem.androidtools.*
+com.github.betterJ1995.*
+com.github.bex1111.*
+com.github.bezsias.*
+com.github.bfg.eureka.*
+com.github.bfsmith.*
+com.github.bgalek.security.svg.*
+com.github.bgalek.spring.boot.*
+com.github.bgalek.utils.*
+com.github.bgqrjf.*
+com.github.bharat23.jmeter.*
+com.github.bharatmicrosystems.*
+com.github.bhatiarishabh.*
+com.github.bhautikkoladiya.*
+com.github.bhokumar.framework.*
+com.github.bhokumar.plugins.*
+com.github.bi-geek.*
+com.github.biboudis.*
+com.github.bibsysdev.*
+com.github.bicoco.*
+com.github.biconou.*
+com.github.biegleux.*
+com.github.bieliaievays.*
+com.github.biezhi.*
+com.github.bigbigzhan.*
+com.github.bigfishcat.android.*
+com.github.bigwheel.*
+com.github.bigyan123.*
+com.github.bijukunjummen.*
+com.github.bilderherunterlader.*
+com.github.billybichon.*
+com.github.billyjulius.*
+com.github.billzabob.*
+com.github.bilthon.*
+com.github.binarylei.*
+com.github.binarywang.*
+com.github.binarywang.tools.*
+com.github.binbin0915.*
+com.github.bingoohuang.*
+com.github.binmagic.*
+com.github.binodnme.*
+com.github.biopet.*
+com.github.birdasaur.litfx.*
+com.github.bishoku.*
+com.github.biticcf.*
+com.github.bitmc.*
+com.github.bittokazi.*
+com.github.biyanwen.*
+com.github.biyusir.*
+com.github.bj-tydic.*
+com.github.bjansen.*
+com.github.bjht0112357.*
+com.github.bjlhx15.*
+com.github.bjoern2.*
+com.github.bjoernjacobs.*
+com.github.bjoernpetersen.*
+com.github.bjoernq.*
+com.github.bjtoon-uia.*
+com.github.bjuvensjo.*
+com.github.bkenn.*
+com.github.black-ox.*
+com.github.blackbk.*
+com.github.blackdark.*
+com.github.blackfizz.*
+com.github.blackrose01.*
+com.github.blackshadowwalker.spring.*
+com.github.blackshadowwalker.spring.distributelock.*
+com.github.blagerweij.*
+com.github.blahord.*
+com.github.blakepettersson.*
+com.github.blankhang.*
+com.github.blasd.apex.*
+com.github.bld-commons.*
+com.github.bld-commons.excel.*
+com.github.bleeding182.sharedpreferences.*
+com.github.blemale.*
+com.github.bleumi.*
+com.github.blindpirate.*
+com.github.blink-ai.*
+com.github.bliplink.*
+com.github.bliveinhack.*
+com.github.blockjon.flaptastic.*
+com.github.blockwiseph.*
+com.github.bloder.*
+com.github.bloodshura.*
+com.github.bluebillywig.*
+com.github.bluebillywig.bbnativeplayersdk.*
+com.github.blueeyes.*
+com.github.bluejamesbond.*
+com.github.bluejoe2008.*
+com.github.bluelink8888.*
+com.github.blutorange.*
+com.github.bmaggi.*
+com.github.bmaggi.checks.*
+com.github.bmaguireibm.*
+com.github.bmelnychuk.*
+com.github.bmob.*
+com.github.bmsantos.*
+com.github.bnottingham.*
+com.github.bnsd55.*
+com.github.bob007abc.*
+com.github.bobdeng.*
+com.github.bogad.*
+com.github.bogdan5555556.*
+com.github.bogdanlivadariu.*
+com.github.bogdanlivadariu.integrations.*
+com.github.bogdanovmn.cmdline.*
+com.github.bogdanovmn.common.*
+com.github.bogdanovmn.common.core.*
+com.github.bogdanovmn.common.log.*
+com.github.bogdanovmn.common.spring.*
+com.github.bogdanovmn.httpclient.*
+com.github.bogdanovmn.httpclient.core.*
+com.github.bogdanovmn.httpclient.diskcache.*
+com.github.bogdanovmn.httpclient.phantomjs.*
+com.github.bogdanovmn.httpclient.selenium.*
+com.github.bogdanovmn.httpclient.simple.*
+com.github.bogdanovmn.humanreadablevalues.*
+com.github.bogdanovmn.jaclin.*
+com.github.bogdanovmn.projecteuler.framework.*
+com.github.bogdanovmn.txtparser.*
+com.github.bogie-clj.*
+com.github.bohnman.*
+com.github.bohrqiu.dubbo.*
+com.github.boiyun.*
+com.github.bolthelmet.*
+com.github.boly38.*
+com.github.bomberjin.*
+com.github.bomiyr.ekho.*
+com.github.bonnguyen.*
+com.github.bookmenow.*
+com.github.bookong.*
+com.github.bordertech.buildtools.*
+com.github.bordertech.common.*
+com.github.bordertech.config.*
+com.github.bordertech.didums.*
+com.github.bordertech.lde.*
+com.github.bordertech.mailcheck.*
+com.github.bordertech.mrz.*
+com.github.bordertech.restfriends.*
+com.github.bordertech.sanitizer.*
+com.github.bordertech.taskmaster.*
+com.github.bordertech.wcomponents.*
+com.github.bordertech.webfriends.*
+com.github.borisbrodski.*
+com.github.boriswaguia.*
+com.github.born2go.*
+com.github.born2snipe.*
+com.github.borsch.*
+com.github.bosphere.*
+com.github.bosphere.android-fadingedgelayout.*
+com.github.bosphere.android-filelogger.*
+com.github.bosphere.android-horizontaltaillayout.*
+com.github.bosphere.android-ratiofilllayout.*
+com.github.bostaapp.*
+com.github.botaruibo.*
+com.github.bottomless-archive-project.*
+com.github.bottyivan.*
+com.github.bournecui.*
+com.github.boxuanjia.*
+com.github.boyaframework.*
+com.github.boyazuo.*
+com.github.boybeak.*
+com.github.boylong12.*
+com.github.boyundefeated.*
+com.github.bpark.cdi.*
+com.github.bpazy.*
+com.github.bpearce89.*
+com.github.bpg.*
+com.github.bradleywood.*
+com.github.braginxv.*
+com.github.brainlag.*
+com.github.brainydigital.*
+com.github.braisdom.*
+com.github.brake.smart_card.*
+com.github.brake.threegpp.*
+com.github.brandtg.*
+com.github.branflake2267.*
+com.github.branislavlazic.*
+com.github.brian-watkins.*
+com.github.brianPlummer.*
+com.github.briandilley.joraph.*
+com.github.briandilley.jsonrpc4j.*
+com.github.brianolsen87.*
+com.github.brianway.*
+com.github.bric3.maven.*
+com.github.bringking.*
+com.github.britooo.*
+com.github.britter.*
+com.github.brnunes.*
+com.github.broadinstitute.*
+com.github.bruce-cloud.*
+com.github.bruneli.phyqty.*
+com.github.bruneli.scalaopt.*
+com.github.brunoabdon.*
+com.github.brunoabdon.domino.*
+com.github.brunoabdon.m2.herokuds.*
+com.github.brunoais.*
+com.github.brunodutr.*
+com.github.brunomndantas.*
+com.github.brunopessanha.*
+com.github.brunothg.*
+com.github.brunotl.*
+com.github.brutils.*
+com.github.bryan0919lin.*
+com.github.bryanser.*
+com.github.brymck.*
+com.github.brzozasr.*
+com.github.bsideup.jabel.*
+com.github.btheu.estivate.*
+com.github.btheu.futurefit.*
+com.github.btheu.futurefit2.*
+com.github.btheu.settesting.*
+com.github.btheu.table-mapper.*
+com.github.bthink-bgu.*
+com.github.btrapp.*
+com.github.buckelieg.*
+com.github.buckle.*
+com.github.bufferings.*
+com.github.bumptech.glide.*
+com.github.bun133.*
+com.github.bunyod.*
+com.github.burningwave.*
+com.github.burrunan.multi-cache.*
+com.github.burrunan.multicache.*
+com.github.burrunan.s3-build-cache.*
+com.github.burrunan.s3cache.*
+com.github.bustapipes.*
+com.github.bustapipes.clj-influxdb-metrics-reporter.*
+com.github.buster84.*
+com.github.busti.*
+com.github.butterflycoder.*
+com.github.buzztaiki.*
+com.github.bvanseg.*
+com.github.bvdaakster.viewmodelinjector.*
+com.github.bwfdm.*
+com.github.bwhyman.*
+com.github.bwsoft.iris.*
+com.github.bxforce.*
+com.github.byakkili.*
+com.github.byeongukchoi.*
+com.github.byronlin13.*
+com.github.bytegriffin.*
+com.github.bytelimit.*
+com.github.bytom.*
+com.github.bzacar.*
+com.github.bzumhagen.*
+com.github.caciocavallosilano.*
+com.github.cafapi.*
+com.github.cafapi.cipher.*
+com.github.cafapi.codec.*
+com.github.cafapi.config.*
+com.github.cafapi.correlation.*
+com.github.cafapi.decoder.*
+com.github.cafapi.election.*
+com.github.cafapi.logging.*
+com.github.cafapi.util.*
+com.github.cafapi.util.flywayinstaller.*
+com.github.cafaudit.*
+com.github.cafdataprocessing.*
+com.github.cafdataprocessing.elastic.*
+com.github.cafeduke.*
+com.github.cage.*
+com.github.cage433.*
+com.github.caijh.*
+com.github.caijh.auth.*
+com.github.caijh.commons.*
+com.github.caijh.framework.*
+com.github.caijh.framework.demo.*
+com.github.caldav4j.*
+com.github.calimero.*
+com.github.callthink.*
+com.github.calmking.*
+com.github.calzam.*
+com.github.camaral.*
+com.github.cambierr.*
+com.github.camel-labs.*
+com.github.camel-tooling.*
+com.github.camel1984.*
+com.github.camelion.*
+com.github.cameroncan.*
+com.github.campagile.*
+com.github.camque.*
+com.github.canhuaqianchang.*
+com.github.caofangkun.*
+com.github.caojiantao.*
+com.github.caoyuhub.*
+com.github.captain-miao.*
+com.github.captainmaximo.*
+com.github.carl-xiao.*
+com.github.carl-zk.*
+com.github.carlkuesters.*
+com.github.carlopantaleo.*
+com.github.carlosbritojun.*
+com.github.carlosmenezes.*
+com.github.carlosvin.archetype.*
+com.github.carrot-vitamin.*
+com.github.carteryh.*
+com.github.carueda.*
+com.github.caryyu.*
+com.github.cas-side.*
+com.github.cascala.*
+com.github.casmi.*
+com.github.casmi.archetypes.*
+com.github.caspar-chen.*
+com.github.casperjs.*
+com.github.casterkkk.*
+com.github.castorflex.manifestreplace.*
+com.github.castorflex.playservicesstrip.*
+com.github.castorflex.smoothprogressbar.*
+com.github.castorflex.verticalviewpager.*
+com.github.castorm.*
+com.github.catalpaflat.*
+com.github.catalpas.*
+com.github.catalystcode.*
+com.github.catchitcozucan.*
+com.github.catdou.*
+com.github.cb372.*
+com.github.cbfmai.*
+com.github.cbismuth.*
+com.github.cbuschka.optional-backport.*
+com.github.cbuschka.zipdiff.*
+com.github.ccenyo.*
+com.github.ccguyka.*
+com.github.cchacin.*
+com.github.ccob.*
+com.github.cd-butterfly.*
+com.github.cdefgah.*
+com.github.cecchisandrone.*
+com.github.cedar12.*
+com.github.cedrickring.*
+com.github.ceilfors.maven.plugin.*
+com.github.celadari.*
+com.github.celeskyking.*
+com.github.celldynamics.*
+com.github.celldynamics.quimp.*
+com.github.cemyeniceri.*
+com.github.cenbylin.*
+com.github.centrifugal.*
+com.github.cerbur.*
+com.github.cern.narlibs.*
+com.github.cerst.*
+com.github.cerveada.*
+com.github.cesarbr.*
+com.github.cfengdev.*
+com.github.cflint.*
+com.github.cfparser.*
+com.github.cgdon.*
+com.github.ch-muhammad-adil.*
+com.github.ch3cho.*
+com.github.ch4vi.*
+com.github.chacojack.*
+com.github.chainables.*
+com.github.chajath.*
+com.github.chameleontartu.*
+com.github.chandra-prakash-reddy.*
+com.github.chandu0101.*
+com.github.chandu0101.scalajs-react-components.*
+com.github.chandu0101.scalajs-react-native.*
+com.github.chandu0101.scalajs.*
+com.github.chandu0101.sri-extra.*
+com.github.chandu0101.sri.*
+com.github.changvvb.*
+com.github.chanhohang.*
+com.github.chanmratekoko.*
+com.github.channguyen.*
+com.github.channingbj.*
+com.github.chaojunzi.*
+com.github.chaoohua.*
+com.github.chaosfirebolt.converter.*
+com.github.chaosfirebolt.generator.*
+com.github.charbgr.*
+com.github.charithe.*
+com.github.charlemaznable.*
+com.github.charlesjean.*
+com.github.charleslzq.*
+com.github.charlie-cityu.archetypes.*
+com.github.charroch.*
+com.github.chaudhryfaisal.*
+com.github.checkmarx-ltd.*
+com.github.checkmarx-ts.*
+com.github.cheergoivan.*
+com.github.chekhwastaken.*
+com.github.chen-jiangbo.*
+com.github.chen0040.*
+com.github.chenchongli.*
+com.github.chendb.*
+com.github.chenfenli.*
+com.github.chengpohi.*
+com.github.chengtaiheng.*
+com.github.chengtengfei.*
+com.github.chengyuxing.*
+com.github.chengzh100.*
+com.github.chenhaiyangs.*
+com.github.chenjianjx.*
+com.github.chenjianjx.wads4j.*
+com.github.chenjunbiao.*
+com.github.chenjunlong.*
+com.github.chenlei2.*
+com.github.chenliang15405.*
+com.github.chenlijia1111.*
+com.github.chenmingq.*
+com.github.chenrenfei.*
+com.github.chensl5566.*
+com.github.chentianming11.*
+com.github.chenupt.android.*
+com.github.chenyoca.*
+com.github.cherrythefatbunny.*
+com.github.cheukbinli.*
+com.github.chewiebug.*
+com.github.chhh.*
+com.github.chhorz.*
+com.github.chhsiao90.*
+com.github.chiangho.*
+com.github.chimmhuang.*
+com.github.chinayinman.*
+com.github.chisui.translate.*
+com.github.chitralverma.*
+com.github.chivorns.*
+com.github.chocoboxxf.*
+com.github.chocolatecw.*
+com.github.chocpanda.*
+com.github.choelea.*
+com.github.choonchernlim.*
+com.github.choppythelumberjack.*
+com.github.chouheiwa.*
+com.github.chqiuu.*
+com.github.chrbayer84.*
+com.github.chris2018998.*
+com.github.chrisbanes.actionbarpulltorefresh.*
+com.github.chrisbanes.bitmapcache.*
+com.github.chrisbanes.photoview.*
+com.github.chrisbanes.pulltorefresh.*
+com.github.chrisbas.*
+com.github.chrisbrenton.*
+com.github.chrischristo.*
+com.github.chrisdchristo.*
+com.github.chrisgleissner.*
+com.github.chrisgleissner.config.*
+com.github.chrisgleissner.jutil.*
+com.github.chrislmy.*
+com.github.chrislusf.*
+com.github.chrisprice.*
+com.github.chrisruffalo.*
+com.github.christapley.*
+com.github.christiangda.*
+com.github.christiangroth.*
+com.github.christianlacerda.*
+com.github.christmasjason.*
+com.github.christokios.*
+com.github.christophersmith.*
+com.github.christopheversieux.*
+com.github.chrisvest.*
+com.github.chriswhite199.*
+com.github.chriweis.querydsl-util.*
+com.github.chrix75.*
+com.github.chronosone.*
+com.github.chuangwu.*
+com.github.chuanlikecode.*
+com.github.chuanzh.*
+com.github.chubbard.*
+com.github.chuckerteam.chucker.*
+com.github.chuckiefan.*
+com.github.chujianyun.*
+com.github.chunfulandu.*
+com.github.chungkwong.*
+com.github.chunjies.*
+com.github.churchtao.*
+com.github.chwagnlucid.*
+com.github.chyrta.*
+com.github.chytreg.*
+com.github.ci-cd.*
+com.github.cianfree.*
+com.github.cico216.*
+com.github.cilki.*
+com.github.cimpress-mcp.*
+com.github.cims-bioko.*
+com.github.cinnes.*
+com.github.cioccarellia.*
+com.github.cioccarellia.ksprefs.*
+com.github.cirola2000.*
+com.github.cirorizzo.*
+com.github.cirrus-up-cloud.*
+com.github.ciscodevnet.*
+com.github.citux.*
+com.github.civitz.viper.*
+com.github.ciweigg.*
+com.github.cjbdi.*
+com.github.cjgmj.*
+com.github.cjhit.*
+com.github.cjmx.*
+com.github.cjnygard.*
+com.github.cjyican.*
+com.github.ckpoint.*
+com.github.cla9.*
+com.github.claasahl.*
+com.github.claassen.*
+com.github.clans.*
+com.github.claremontqualitymanagement.*
+com.github.claremontqualitymanagement.LoggingSeleniumWebDriver.*
+com.github.claremontqualitymanagement.TestAutomationFramework.*
+com.github.claremontqualitymanagement.seleniumextensions.*
+com.github.clarkstore.*
+com.github.claucookie.miniequalizer.*
+com.github.claymantwinkle.*
+com.github.clazz666.*
+com.github.clearcube.*
+com.github.clemp6r.futuroid.*
+com.github.cletty.*
+com.github.clicksend.*
+com.github.cliftonlabs.*
+com.github.clinmanc.*
+com.github.cliuff.*
+com.github.clockbyte.*
+com.github.clockworm.*
+com.github.cloneagain.*
+com.github.cloudbow.*
+com.github.cloudecho.*
+com.github.cloudfoundry-community.*
+com.github.cloudgyb.*
+com.github.cloudml.zen.*
+com.github.cloudsharl.*
+com.github.cloudyrock.*
+com.github.cloudyrock.changock.*
+com.github.cloudyrock.dimmer.*
+com.github.cloudyrock.http.*
+com.github.cloudyrock.mongock.*
+com.github.cloudyrock.proxy.*
+com.github.cloveros.*
+com.github.cm-heclouds.*
+com.github.cmc00022.*
+com.github.cmfs.*
+com.github.cmhdave.*
+com.github.cmhuynh.*
+com.github.cmis4j.*
+com.github.cmlbeliever.*
+com.github.cnlinjie.*
+com.github.cnsvili.*
+com.github.cnzhoutao.*
+com.github.cobrijani.*
+com.github.code-cubic.*
+com.github.code2358.*
+com.github.codechapin.*
+com.github.codechimp-org.apprater.*
+com.github.codedrinker.*
+com.github.codefabrikgmbh.*
+com.github.codeframes.*
+com.github.codefrogcc.*
+com.github.codegerm.*
+com.github.codeinghelper.*
+com.github.codemonkeyfactory.test.logging.*
+com.github.codemonstur.*
+com.github.coder-Ah-fei.*
+com.github.coderepositories.*
+com.github.codesorcery.*
+com.github.codestickers.*
+com.github.codeteapot.ironhoist.*
+com.github.codeteapot.maven.plugin-testing.*
+com.github.codeteapot.maven.plugins.*
+com.github.codeteapot.tools.*
+com.github.codezee.*
+com.github.codingandcoding.*
+com.github.codingdebugallday.*
+com.github.codinghck.*
+com.github.codingricky.*
+com.github.codingsoldier.*
+com.github.cogman.*
+com.github.cohesive-concepts.*
+com.github.coinsuperapi.*
+com.github.colin-lee.*
+com.github.colincatsu.*
+com.github.collinalpert.*
+com.github.colopezfuentes.*
+com.github.colorgmi.*
+com.github.com-github-javabdd.*
+com.github.combineads.*
+com.github.combinedmq.*
+com.github.common-dependency.*
+com.github.commons-rdf.*
+com.github.complate.*
+com.github.comsince.*
+com.github.comthings.*
+com.github.concept-not-found.*
+com.github.concrete-cp.*
+com.github.congnt24.*
+com.github.congyh.*
+com.github.conhea.*
+com.github.connollyst.*
+com.github.connyscode.ctils.*
+com.github.conserveorm.*
+com.github.containersolutions.*
+com.github.continuity-project.*
+com.github.continuousperftest.*
+com.github.cook-r.*
+com.github.corese4rch.*
+com.github.coreycaplan3.*
+com.github.cormoran-io.pepper.*
+com.github.corneliouzbett.*
+com.github.corner.*
+com.github.cornerman.*
+com.github.coronium-framework.*
+com.github.corydoras.*
+com.github.costin3141.*
+com.github.costing.*
+com.github.cosycode.*
+com.github.cosysoft.*
+com.github.couchbaselabs.*
+com.github.coveo.*
+com.github.cowwoc.*
+com.github.cowwoc.pouch.*
+com.github.cowwoc.requirements.*
+com.github.cowwoc.token-bucket.*
+com.github.coyarzun89.*
+com.github.cp-profiler.*
+com.github.cpfniliu.*
+com.github.cqjjjzr.*
+com.github.cqowl.*
+com.github.cquiroz.*
+com.github.cr0wbar.bananarama.*
+com.github.crab2died.*
+com.github.crabime.*
+com.github.crabs-hue.commons.*
+com.github.cradloff.*
+com.github.crashvb.*
+com.github.crawler-commons.*
+com.github.crazyclownsola.*
+com.github.crazyfrozenpenguin.*
+com.github.crazyorr.*
+com.github.crazyshaquishi.*
+com.github.crazyxxl.*
+com.github.credify-pte-ltd.*
+com.github.creepyao.*
+com.github.cretz.asmble.*
+com.github.cretz.kastree.*
+com.github.cretz.pbandk.*
+com.github.cretz.pgnio.*
+com.github.criccomini.*
+com.github.crisposs.*
+com.github.cristianoperez.*
+com.github.crmepham.*
+com.github.crob1140.*
+com.github.croesch.*
+com.github.crownwangguan.*
+com.github.crs-tool.*
+com.github.cryptocurrency-testing.*
+com.github.cryptomorin.*
+com.github.crystalservice.*
+com.github.cs125-illinois.*
+com.github.cs4j.*
+com.github.csabasulyok.*
+com.github.cschabl.cdi-unit-junit5.*
+com.github.cschen1205.*
+com.github.cschoell.*
+com.github.csongradyp.*
+com.github.cssoftwarellc.*
+com.github.cstoku.*
+com.github.cstroe.*
+com.github.csueiras.acme.*
+com.github.csutorasa.wiclax4j.*
+com.github.ctalau.*
+com.github.ctiao.*
+com.github.cubing.*
+com.github.cuipengfei.*
+com.github.cukedoctor.*
+com.github.cukespace.*
+com.github.curious-odd-man.*
+com.github.curioustechizen.android-ago.*
+com.github.curtcox.*
+com.github.cutedeer.*
+com.github.cuzfrog.*
+com.github.cvazer.*
+com.github.cverges.*
+com.github.cverges.expect4j.*
+com.github.cwac.*
+com.github.cwdtom.*
+com.github.cwilper.*
+com.github.cwilper.fcrepo-cloudsync.*
+com.github.cwilper.fcrepo-misc.*
+com.github.cyan-blue.*
+com.github.cybertron-framework.*
+com.github.cyborgmg.*
+com.github.cybortronik.*
+com.github.cybuch.*
+com.github.cycladessoa.*
+com.github.cycladessoa.nyxlets.*
+com.github.cyfonly.*
+com.github.cynaith.*
+com.github.czgov.*
+com.github.czietsman.lz4.*
+com.github.czy1024.*
+com.github.czyzby.*
+com.github.d-max.*
+com.github.d3no.sms-sdk-java.*
+com.github.d925529.*
+com.github.daanvdh.javadataflow.*
+com.github.daanvdh.javaforger.*
+com.github.dabasan.*
+com.github.dabump.*
+com.github.dactiv.*
+com.github.dactiv.showcase.*
+com.github.daddykotex.*
+com.github.dadeo.*
+com.github.dadiyang.*
+com.github.dadrus.jpa-unit.*
+com.github.daemontus.*
+com.github.dafutils.*
+com.github.daggerok.*
+com.github.daggerok.sonar.*
+com.github.daggerok.sonar.examples.*
+com.github.dagnelies.*
+com.github.dahaka934.*
+com.github.daida459031925.*
+com.github.daihy8759.*
+com.github.daiksy.*
+com.github.dailystudio.*
+com.github.daishy.*
+com.github.daixuyang.*
+com.github.dakatso.*
+com.github.dakatsuka.*
+com.github.daknin.*
+com.github.dakusui.*
+com.github.daleasberry.*
+com.github.dalet-oss.*
+com.github.damage-control.report.*
+com.github.damianmcdonald.*
+com.github.damiansheldon.*
+com.github.damianwajser.*
+com.github.damienbiggs.*
+com.github.damiencarol.*
+com.github.dancarpenter21.*
+com.github.dandelion.*
+com.github.daniel-sc.*
+com.github.daniel-sc.podio-java-codegen.*
+com.github.daniel-shuy.*
+com.github.danielbell.*
+com.github.danielemaddaluno.androidupdatechecker.*
+com.github.danielfelgar.*
+com.github.danielflower.mavenplugins.*
+com.github.danielgindi.*
+com.github.danielkorzekwa.*
+com.github.danielpacak.jenkins.ci.*
+com.github.danielpacak.osgi.swingconsole.*
+com.github.danielwegener.*
+com.github.danielwegener.xjc.*
+com.github.danilos1.*
+com.github.danisimov.*
+com.github.danitutu.*
+com.github.dannil.*
+com.github.danny02.*
+com.github.dannywe.*
+com.github.dano.*
+com.github.danshan.*
+com.github.danshannon.*
+com.github.danskemarkets.*
+com.github.danslapman.*
+com.github.dantebarba.*
+com.github.dantwining.whitespace-maven-plugin.*
+com.github.danymarialee.*
+com.github.danysantiago.*
+com.github.daote.*
+com.github.dapeng-soa.*
+com.github.dapicard.elasticsearch.curator.*
+com.github.dapperware.*
+com.github.darekxan.*
+com.github.dargiri.*
+com.github.dariusl.*
+com.github.dark-escape.*
+com.github.darkice1.*
+com.github.darkjedi9922.*
+com.github.darkredz.*
+com.github.darrachequesne.*
+com.github.darren-fu.*
+com.github.darrenjw.*
+com.github.darumaddc.*
+com.github.darwin-evolution.*
+com.github.dasniko.*
+com.github.dataanon.*
+com.github.database-rider.*
+com.github.datalking.*
+com.github.datalorax.populace.*
+com.github.datastax-oss.*
+com.github.datatables4j.*
+com.github.datatechnology.jraft.core.*
+com.github.datatechnology.jraft.exts.*
+com.github.dathlin.*
+com.github.dave99galloway.*
+com.github.daveo5887.*
+com.github.davgeek.*
+com.github.david-bouyssie.*
+com.github.david-wei.*
+com.github.david402.*
+com.github.davidb.*
+com.github.davidbolet.jpascalcoin.*
+com.github.davidburkett.*
+com.github.davidcana.*
+com.github.davidcarboni.*
+com.github.davide-maestroni.*
+com.github.davidepastore.*
+com.github.davidfantasy.*
+com.github.davidgenn.*
+com.github.davidgutierrezrubio.*
+com.github.davidhoyt.*
+com.github.davidmarquis.*
+com.github.davidmc24.gradle.plugin.*
+com.github.davidmc24.gradle.plugin.avro-base.*
+com.github.davidmc24.gradle.plugin.avro.*
+com.github.davidmoten.*
+com.github.davidmoten.xuml-compiler.*
+com.github.davidmoten.xuml-compiler.examples.*
+com.github.davidpdp.*
+com.github.davidpizarro.*
+com.github.davidpolaniaac.*
+com.github.davidrobbo.*
+com.github.daviszhao.dubbo-ext.*
+com.github.davityle.*
+com.github.dawn1iu.*
+com.github.dawn9117.*
+com.github.dawnyangcat.*
+com.github.dayan888.*
+com.github.daytron.*
+com.github.dbfit.*
+com.github.dblock.*
+com.github.dblock.waffle.*
+com.github.dblock.waffle.demo.*
+com.github.dbmdz.flusswerk.*
+com.github.dbmdz.pathfinder.*
+com.github.dbottillo.*
+com.github.dbrach77.*
+com.github.dbunit-rules.*
+com.github.dcais.*
+com.github.dcendents.*
+com.github.dcf82.*
+com.github.dchanhk2017.*
+com.github.dchauhan-ic.*
+com.github.dcrissman.*
+com.github.dcshock.*
+com.github.dcsolutions.kalinka.*
+com.github.dcy421.*
+com.github.ddemin.*
+com.github.ddevore.*
+com.github.ddewaele.*
+com.github.ddlatham.test.*
+com.github.ddm4j.*
+com.github.ddnosh.*
+com.github.ddphin.*
+com.github.ddth.*
+com.github.deaktator.*
+com.github.dealermade.*
+com.github.deanjameseverett.*
+com.github.deansquirrel.*
+com.github.dearaison.*
+com.github.debop.*
+com.github.debugthug.*
+com.github.decioamador.*
+com.github.deenbenedictjohnson.*
+com.github.deepaktwr.*
+com.github.deepexi.*
+com.github.deinok.*
+com.github.dejv78.commons.*
+com.github.dejv78.commons.config.*
+com.github.dejv78.commons.jfx.*
+com.github.dejv78.jfx.zoomfx.*
+com.github.dekobon.*
+com.github.dekoservidoni.*
+com.github.delegacy.youngbot.*
+com.github.dellb.*
+com.github.demansh.*
+com.github.dementhius.*
+com.github.demidenko05.*
+com.github.democratati.*
+com.github.demon214.*
+com.github.deng0515001.*
+com.github.dengshiwei.*
+com.github.denis-zhuravlev.*
+com.github.denisdou.*
+com.github.denisidoro.*
+com.github.deniswsrosa.*
+com.github.dennisit.*
+com.github.deprosun.*
+com.github.depsypher.*
+com.github.dercilima.*
+com.github.derekjw.*
+com.github.derekmorr.*
+com.github.derjust.*
+com.github.desmond1121.*
+com.github.destinyd.android.archetypes.*
+com.github.detentor.*
+com.github.detro.*
+com.github.detro.ghostdriver.*
+com.github.deutschebank.symphony.*
+com.github.devahamed.test.*
+com.github.devcsrj.*
+com.github.developeraravinth.*
+com.github.developermobile.*
+com.github.developerpaul123.analogsticklibrary.*
+com.github.developerpaul123.filepickerlibrary.*
+com.github.developerpaul123.simplebluetoothlibrary.*
+com.github.developframework.*
+com.github.devgcoder.*
+com.github.devilyaos.*
+com.github.devit951.*
+com.github.devkumarL.*
+com.github.devlab-umontp.*
+com.github.devmix.*
+com.github.devnexmosms.*
+com.github.devnied.*
+com.github.devnied.AndroidBitmapTransform.*
+com.github.devnied.emvnfccard.*
+com.github.devswork.*
+com.github.dewxin.*
+com.github.dexafree.*
+com.github.dexecutor.*
+com.github.dextorer.*
+com.github.dfabulich.*
+com.github.dfqin.*
+com.github.dgawlik.*
+com.github.dgdevel.*
+com.github.dgrandemange.*
+com.github.dgrlucky.*
+com.github.dgroup.*
+com.github.dhaeb.*
+com.github.dhbw-timetable.*
+com.github.dhiraj072.*
+com.github.dhorions.*
+com.github.diagnal.*
+com.github.diaimm.*
+com.github.dianduiot.*
+com.github.dibyaranjan.*
+com.github.dice-project.*
+com.github.didi1150.*
+com.github.diegopacheco.*
+com.github.diegosep.*
+com.github.dieterdepaepe.*
+com.github.differentway.*
+com.github.digital-wonderland.*
+com.github.digital-wonderland.sling-metrics.*
+com.github.digitaldan.*
+com.github.dijkstraj.*
+com.github.dikhan.*
+com.github.dileber.*
+com.github.dilyar85.*
+com.github.dimadake.*
+com.github.dimlt.*
+com.github.dimosr.*
+com.github.dimovelev.*
+com.github.dimsuz.*
+com.github.dine11101.*
+com.github.dineshbotcha.*
+com.github.ding-guohang.*
+com.github.dingey.*
+com.github.dingxin.*
+com.github.dinuta.estuary.*
+com.github.diogosmendonca.*
+com.github.dionmcm.*
+com.github.diorthosete.*
+com.github.dirkraft.*
+com.github.dirkraft.GetURI.*
+com.github.dirkraft.dropwizard-file-assets.*
+com.github.dirkraft.dropwizard.*
+com.github.dirkraft.gradle.*
+com.github.dirksm.*
+com.github.distortsm.*
+com.github.dita-ot.*
+com.github.diwakar1988.*
+com.github.djbing85.*
+com.github.djeang.*
+com.github.dkellenb.formulaevaluator.*
+com.github.dkhalansky.*
+com.github.dkharrat.nexusdata.*
+com.github.dkharrat.nexusdialog.*
+com.github.dkschlos.*
+com.github.dkubiak.*
+com.github.dkzwm.*
+com.github.dlstonedl.*
+com.github.dmarcous.*
+com.github.dmgcodevil.*
+com.github.dmillett.*
+com.github.dmitraver.*
+com.github.dmkwon.*
+com.github.dmn1k.*
+com.github.dmulcahey.*
+com.github.dmytrodanylyk.android-process-buton.*
+com.github.dmytrodanylyk.android-process-button.*
+com.github.dmytrodanylyk.circular-progress-button.*
+com.github.dmytrodanylyk.realm-browser.*
+com.github.dmytrodanylyk.shadow-layout.*
+com.github.dmytromitin.*
+com.github.dnault.*
+com.github.dnaumenko.*
+com.github.dnbn.submerge.*
+com.github.dnvriend.*
+com.github.docker-java.*
+com.github.docker-production-aws.*
+com.github.dockerunit.*
+com.github.doctoror.aspectratiolayout.*
+com.github.doctoror.circularviewpager.*
+com.github.doctoror.geocoder.*
+com.github.doctoror.gifimageloader.*
+com.github.doctoror.imagefactory.*
+com.github.doctoror.particlesdrawable.*
+com.github.doctoror.rxcursorloader.*
+com.github.document-analysis.*
+com.github.dogonthehorizon.*
+com.github.dolphinai.cqrsframework.*
+com.github.dolphineor.*
+com.github.domala.*
+com.github.domgold.*
+com.github.domgold.doctools.asciidoctor.*
+com.github.domino-osgi.*
+com.github.dongfg.plugin.*
+com.github.dongyajie.*
+com.github.donhac.*
+com.github.donmor.*
+com.github.doobo.*
+com.github.doohochang.*
+com.github.doraig.*
+com.github.dotengine.*
+com.github.dotxyteam.*
+com.github.dou2.*
+com.github.double-bin.*
+com.github.douglashiura.*
+com.github.douglasom.*
+com.github.douglasorr.*
+com.github.doutingltd.*
+com.github.dov-vlaanderen.*
+com.github.downgoon.*
+com.github.doyaaaaaken.*
+com.github.dozermapper.*
+com.github.dozermapper.tests.*
+com.github.dozmus.*
+com.github.dozzatq.*
+com.github.dpaukov.*
+com.github.dpimkin.systemd.*
+com.github.dpsm.*
+com.github.dq2020.android.*
+com.github.dragoon000320.*
+com.github.dragos.*
+com.github.dragspace.*
+com.github.dral.*
+com.github.dramer.*
+com.github.drapostolos.*
+com.github.dravyan.*
+com.github.draylar.*
+com.github.drcarter.*
+com.github.drczearot.reaper.*
+com.github.dreamhead.*
+com.github.dreampie.*
+com.github.dreamroute.*
+com.github.dreamyoung.*
+com.github.dredwardhyde.*
+com.github.drepic26.*
+com.github.drinkjava2.*
+com.github.driox.*
+com.github.dritonshoshi.*
+com.github.drmercer.*
+com.github.drnkn.*
+com.github.droidlabour.*
+com.github.droidpl.*
+com.github.dronox.*
+com.github.droxy.*
+com.github.drstefanfriedrich.f2blib.*
+com.github.drtrang.*
+com.github.druidgreeneyes.*
+com.github.drumge.*
+com.github.drvisor.*
+com.github.dryganets.*
+com.github.dsc-cmt.*
+com.github.dsibenik.*
+com.github.dslaveykov.*
+com.github.dsrees.*
+com.github.dsulimchuk.dynamicquery.*
+com.github.dt209.*
+com.github.dtaniwaki.*
+com.github.dtmo.jfiglet.*
+com.github.dtreskunov.*
+com.github.dtrunk90.*
+com.github.dttxrep.*
+com.github.duanhong169.*
+com.github.duanxinyuan.*
+com.github.duanyashu.*
+com.github.duband.*
+com.github.dubasdey.*
+com.github.ducheng.*
+com.github.ducna01598.*
+com.github.ducoral.*
+com.github.dufafei.*
+com.github.duffqiu.*
+com.github.duhemm.*
+com.github.duongphanhoai.*
+com.github.duorourou.*
+com.github.durre.*
+com.github.dushixiang.*
+com.github.duwanqiebi.*
+com.github.dux-king.*
+com.github.duxvfeng.*
+com.github.dvdandroid.*
+com.github.dvdme.*
+com.github.dvrvrm.*
+com.github.dweidenfeld.*
+com.github.dwickern.*
+com.github.dwrm.rapidftp.*
+com.github.dxee.*
+com.github.dxee.dject.*
+com.github.dylanz666.*
+com.github.dylon.*
+com.github.dynamobee.*
+com.github.dynckathline.*
+com.github.dynodao.*
+com.github.dyorgio.runtime.*
+com.github.dzhaughnroth.*
+com.github.dzhey.*
+com.github.dzieciou.testing.*
+com.github.dziga.*
+com.github.dzmipt.*
+com.github.dzsessona.*
+com.github.dzuvic.*
+com.github.dzwicker.dart.*
+com.github.dzwicker.stjs.gradle.*
+com.github.dzwicker.wicket.*
+com.github.dzy5639313.*
+com.github.dzygroup.*
+com.github.e-alharbi.*
+com.github.e-rikov.*
+com.github.eacasanovaspedre.fluk.*
+com.github.eagle6688.*
+com.github.eaglecs.*
+com.github.eagoo.*
+com.github.eakonovalov.*
+com.github.ealenxie.*
+com.github.earchitecture.*
+com.github.earchitecture.maven.plugins.*
+com.github.earchitecture.reuse.*
+com.github.earchitecture.reuse.datatable.*
+com.github.earchitecture.reuse.web.*
+com.github.easai.*
+com.github.easai.math.*
+com.github.easai.utils.*
+com.github.easemob.*
+com.github.easilyuse.*
+com.github.easonjim.*
+com.github.easy-data.*
+com.github.easy-develop.*
+com.github.easyAutomate.*
+com.github.easyjsonapi.*
+com.github.easypack.*
+com.github.eatstreet.*
+com.github.ebaydatameta.*
+com.github.ebfhub.*
+com.github.eboldyrev.*
+com.github.eborgbjerg.*
+com.github.ec-yakindu.*
+com.github.echisan.*
+com.github.echosun1996.*
+com.github.eciuca.sonar.*
+com.github.ecmdeveloper.*
+com.github.ecolabardini.*
+com.github.ecolangelo.*
+com.github.ecyshor.*
+com.github.edcast-rahul.*
+com.github.eddieraa.registry.*
+com.github.eddumelendez.ldap.*
+com.github.edgar615.*
+com.github.edgarespina.*
+com.github.edgewalk.*
+com.github.edouardswiac.*
+com.github.eduardovalentim.*
+com.github.edwgiz.*
+com.github.eeichinger.service-virtualisation.*
+com.github.eemmiirr.lib.*
+com.github.eemmiirr.redisdata.*
+com.github.eendroroy.*
+com.github.egast.*
+com.github.egateam.*
+com.github.egatlovs.*
+com.github.egbakou.*
+com.github.egoettelmann.*
+com.github.egonw.*
+com.github.egor-n.*
+com.github.ehc.tools.*
+com.github.ehsaniara.*
+com.github.eidien.*
+com.github.eikecochu.*
+com.github.eikek.*
+com.github.eirslett.*
+com.github.eis.libraries.*
+com.github.eitraz.*
+com.github.ejahns.*
+com.github.ejin66.*
+com.github.ekahyukti.*
+com.github.eklavya.*
+com.github.ekondrashev.peyote.*
+com.github.ekryd.echo-maven-plugin.*
+com.github.ekryd.reflection-utils.*
+com.github.ekryd.sortgraphql.*
+com.github.ekryd.sortpom.*
+com.github.eks5115.*
+com.github.eladb.*
+com.github.elbywan.*
+com.github.eldis.*
+com.github.electron007.*
+com.github.electrostar.*
+com.github.elhoce.*
+com.github.eliayng.*
+com.github.elibracha.*
+com.github.eliekarouz.feedbacktree.*
+com.github.elirehema.*
+com.github.eliux.*
+com.github.elizabetht.*
+com.github.elizeuborges.*
+com.github.eljah.*
+com.github.eljhoset.*
+com.github.elkanuco.*
+com.github.elkouhen.*
+com.github.ellzord.*
+com.github.elopteryx.*
+com.github.elover.*
+com.github.eloyzone.*
+com.github.eltohamy.*
+com.github.eltonsandre.*
+com.github.eltonsandre.utils.*
+com.github.eltonvs.*
+com.github.elufimov.*
+com.github.eluleci.*
+com.github.elvinmahmudov.*
+com.github.elvisnovoa.*
+com.github.elzhass.*
+com.github.emabrey.*
+com.github.emanresusername.js.*
+com.github.emanresusername.js.facade.*
+com.github.embeditcz.dbadvisor.*
+com.github.embuc.*
+com.github.emc-mongoose.*
+com.github.emcastro.*
+com.github.emenaceb.appjar.*
+com.github.emildafinov.*
+com.github.emilienkia.*
+com.github.emilienkia.ajmx.*
+com.github.emilienkia.ajmx.examples.*
+com.github.emm035.*
+com.github.emmanueltouzery.*
+com.github.emstlk.*
+com.github.enadim.*
+com.github.enalmada.*
+com.github.endoscope.*
+com.github.enelson.*
+com.github.enerccio.*
+com.github.enesusta.*
+com.github.engwen.*
+com.github.enicholls.*
+com.github.enjektor.*
+com.github.ennmichael.*
+com.github.enpassant.*
+com.github.enricocid.*
+com.github.eoinf.ethanolshared.*
+com.github.eoinf.jiggen.*
+com.github.eomm.*
+com.github.eoscode.*
+com.github.eosif.*
+com.github.eostermueller.*
+com.github.epabst.scala-android-crud.*
+com.github.epabst.triangle.*
+com.github.epiconcept-paris.*
+com.github.epicprojects.glider.*
+com.github.eprst.*
+com.github.equella.jpf.*
+com.github.equella.legacy.*
+com.github.equella.reporting.*
+com.github.equus52.*
+com.github.eratel.*
+com.github.erchu.*
+com.github.erd.*
+com.github.erdanielli.*
+com.github.erehmi.*
+com.github.erhun.*
+com.github.eric0liang.*
+com.github.eriche39.*
+com.github.ericmoshare.*
+com.github.ericneid.*
+com.github.ericpeng1027.*
+com.github.ericschaefer.*
+com.github.erictao2.*
+com.github.erihoss.*
+com.github.erikcaffrey.*
+com.github.erikhuizinga.*
+com.github.eriksattelmair.*
+com.github.erindavid.*
+com.github.erizet.signala.*
+com.github.erosb.*
+com.github.errebenito.*
+com.github.error418.opennms.*
+com.github.error418.properties.*
+com.github.ershakiransari.*
+com.github.ershakiransari.planets.*
+com.github.ertugrulungor.*
+com.github.erwan-boulard.*
+com.github.esap120.*
+com.github.esastack.*
+com.github.esdaprojects.*
+com.github.esempla.*
+com.github.esiqveland.awssigner.*
+com.github.esiqveland.okhttp3.*
+com.github.esrrhs.*
+com.github.essobedo.*
+com.github.estigma88.*
+com.github.estuaryoss.*
+com.github.estuaryoss.libs.*
+com.github.etashkinov.*
+com.github.etaty.*
+com.github.ethancommitpush.*
+com.github.ethendev.*
+com.github.ethpran.*
+com.github.ethul.*
+com.github.eudessilva.*
+com.github.eugeneheen.*
+com.github.eugeneheen.berry.*
+com.github.eugenemedvediev.*
+com.github.eugenemsv.amqp.rabbit.*
+com.github.eugenenosenko.*
+com.github.eugeniyk.*
+com.github.euler-io.*
+com.github.eulery.*
+com.github.euzee.*
+com.github.evanbennett.*
+com.github.evansiroky.*
+com.github.evantill.*
+com.github.evanzyj.*
+com.github.evbruno.*
+com.github.evelizg.*
+com.github.evenardo.*
+com.github.eventasia.*
+com.github.evgenbar.*
+com.github.ewan-keith.*
+com.github.ewanld.*
+com.github.ewanld.visitorj.*
+com.github.ewoij.openminted.components.*
+com.github.exabrial.*
+com.github.exampledriven.*
+com.github.excelmapper.*
+com.github.excitement-engineer.*
+com.github.exerrk.*
+com.github.exmyth.*
+com.github.expdev07.*
+com.github.exqudens.*
+com.github.eye2web.*
+com.github.f-sunrise-q.*
+com.github.f0ris.sweetalert.*
+com.github.f1xmAn.*
+com.github.f1xmAn.oss.*
+com.github.f4b6a3.*
+com.github.f4irline.*
+com.github.fabasset.*
+com.github.fabianmurariu.*
+com.github.fabienbarbero.*
+com.github.fabiojose.kafka.*
+com.github.fabiomaffioletti.*
+com.github.fabriciofx.*
+com.github.fabriziocucci.*
+com.github.fadils.*
+com.github.faelmg18.*
+com.github.faeludire.*
+com.github.fafaldo.*
+com.github.fafram.*
+com.github.fagnerlima.*
+com.github.fair-search.*
+com.github.fakecreditcard.*
+com.github.fakemongo.*
+com.github.falloutfire.*
+com.github.falydoor.*
+com.github.fanavarro.*
+com.github.fanciulli.*
+com.github.fancyerii.*
+com.github.fangasvsass.*
+com.github.fangjinuo.*
+com.github.fangjinuo.agileway.*
+com.github.fangjinuo.agileway.eipchannel.*
+com.github.fangjinuo.audit.*
+com.github.fangjinuo.audit.entityloader.*
+com.github.fangjinuo.dmmq.*
+com.github.fangjinuo.easyjson.*
+com.github.fangjinuo.easyjson.supports.*
+com.github.fangjinuo.esmvc.*
+com.github.fangjinuo.jakarta-oro.*
+com.github.fangjinuo.langx.*
+com.github.fangjinuo.langx.security.*
+com.github.fangjinuo.redisclient.*
+com.github.fangjinuo.sqlhelper.*
+com.github.fangjinuo.sqlhelper.examples.*
+com.github.fangyanpg.*
+com.github.fangzhengjin.*
+com.github.fanpan26.*
+com.github.fansu.tagsoup.*
+com.github.fanzezhen.*
+com.github.fanzezhen.common.*
+com.github.faranjit.*
+com.github.faroukbengharssallah.*
+com.github.fartherp.*
+com.github.fartherp.spring.boot.*
+com.github.fascalsj.*
+com.github.fashionbrot.*
+com.github.fastcube.factory.tibco.*
+com.github.fastcube.factory.tibco.bw.maven.*
+com.github.fastcube.jaxb.com.tibco.bw.schemas.*
+com.github.faster-framework.*
+com.github.fastxml.*
+com.github.fateland.*
+com.github.faubertin.*
+com.github.faustxvi.*
+com.github.fayewon.*
+com.github.fbaierl.*
+com.github.fbalashov.*
+com.github.fbalashov.moduleEnforcer.*
+com.github.fbaro.*
+com.github.fbascheper.*
+com.github.fbdo.*
+com.github.fbertola.*
+com.github.fburato.*
+com.github.fburato.typesafecomparator.*
+com.github.fcappi.*
+com.github.fcofdez.*
+com.github.fcproj.*
+com.github.fd4s.*
+com.github.fdietze.*
+com.github.fdimuccio.*
+com.github.featheredtoast.*
+com.github.feature-flip.*
+com.github.febeling.*
+com.github.febialfarabi.*
+com.github.febo.*
+com.github.fedeoasi.*
+com.github.fedorchuck.*
+com.github.fedorov-s-n.*
+com.github.fedorov-s-n.aht.*
+com.github.fedorov-s-n.graphs.*
+com.github.fedorov-s-n.suspend-utils.*
+com.github.fedy2.*
+com.github.fedy2.johloh.*
+com.github.fedyafed.*
+com.github.feelschaotic.*
+com.github.felfert.*
+com.github.felipe1994.*
+com.github.felipecaparelli.*
+com.github.felipefzdz.*
+com.github.felipewom.*
+com.github.felixgail.*
+com.github.fengcone.*
+com.github.fengdai.*
+com.github.fengdai.compose.*
+com.github.fengdai.inject.*
+com.github.fengdai.viewholder.*
+com.github.fengyuchenglun.*
+com.github.fercho1349.*
+com.github.fernandodev.androidproperties.*
+com.github.fernandodev.daggerplay.*
+com.github.fernandodev.easyratingdialog.*
+com.github.fernandospr.*
+com.github.ferortega.*
+com.github.feroult.*
+com.github.ferrytan.*
+com.github.ferstl.*
+com.github.ffalcinelli.*
+com.github.ffcfalcos.*
+com.github.ffch.*
+com.github.ffff121.*
+com.github.ffgiraldez.migratron.*
+com.github.ffmmjj.*
+com.github.ffpojo.*
+com.github.ffremont.microservices.springboot.*
+com.github.fge.*
+com.github.fgiannesini.libsass.gradle.plugin.*
+com.github.fgoncalves.*
+com.github.fharms.*
+com.github.fhbianling.*
+com.github.fhdalotaibi.*
+com.github.fhtw-swp-tutorium.*
+com.github.fhuss.*
+com.github.fhuss.kafka.streams.*
+com.github.fierioziy.*
+com.github.fierioziy.particlenativeapi.*
+com.github.figurefix.*
+com.github.filbabic.*
+com.github.filipesimoes.*
+com.github.filipesperandio.vraptor.*
+com.github.filippudak.progresspieview.*
+com.github.filosganga.*
+com.github.finagle.*
+com.github.firebase4s.*
+com.github.firecrafty.technicassembler.*
+com.github.firelcw.*
+com.github.firmboy.*
+com.github.firststraw.*
+com.github.fishbowlindiadeveloper.*
+com.github.fishlikewater.*
+com.github.fit51.*
+com.github.fk7075.*
+com.github.fkoehler.*
+com.github.flakm.*
+com.github.flank.*
+com.github.flavienlaurent.datetimepicker.*
+com.github.flavienlaurent.discrollview.*
+com.github.flaxsearch.*
+com.github.fleker.*
+com.github.flepsik.*
+com.github.florent37.*
+com.github.florianingerl.*
+com.github.florianingerl.util.*
+com.github.florinn.*
+com.github.flowersinthesand.*
+com.github.flsusp.hyplogger.*
+com.github.fluency03.*
+com.github.fluentfuture.*
+com.github.fluentxml4j.*
+com.github.fluidsonic.*
+com.github.fluorumlabs.*
+com.github.fluorumlabs.disconnect.*
+com.github.flussig.*
+com.github.fly-bytes.*
+com.github.flying-cattle.*
+com.github.flyingglass.*
+com.github.flyinghe.*
+com.github.flysium-io.*
+com.github.fmarmar.*
+com.github.fmcarvalho.*
+com.github.fmcejudo.*
+com.github.fmjsjx.*
+com.github.fnmartinez.*
+com.github.fntz.*
+com.github.fntzr.*
+com.github.fobid.*
+com.github.foby.*
+com.github.foftware.*
+com.github.fomkin.*
+com.github.fommil.*
+com.github.fommil.lion.*
+com.github.fommil.netlib.*
+com.github.fondesa.*
+com.github.fonimus.*
+com.github.fonoisrev.*
+com.github.foobar27.*
+com.github.foodev.*
+com.github.foofighter2146.*
+com.github.forcetower.*
+com.github.forwardloop.*
+com.github.fosin.*
+com.github.fossamagna.*
+com.github.foxty.*
+com.github.fpay.*
+com.github.fpopic.*
+com.github.fppt.*
+com.github.fqaiser94.*
+com.github.fracpete.*
+com.github.francesco149.*
+com.github.francescobonni.*
+com.github.francescoditrani.*
+com.github.francescopellegrini.*
+com.github.francis-pang.*
+com.github.franckyi.*
+com.github.francofabio.*
+com.github.frank-zhu.*
+com.github.frank240889.*
+com.github.frank5380.*
+com.github.franket268.logisticstimeline.*
+com.github.frankiesardo.*
+com.github.frankivo.*
+com.github.fraunhoferfokus.xtensions.*
+com.github.frederick-s.*
+com.github.fredlo2010.*
+com.github.free-jungle.*
+com.github.freedtice.*
+com.github.freegeese.*
+com.github.freelifer.*
+com.github.freeseawind.*
+com.github.freme-project.*
+com.github.freshconnect.*
+com.github.freva.*
+com.github.fridujo.*
+com.github.friendlyjava.*
+com.github.frimtec.*
+com.github.frist008.*
+com.github.frodoking.*
+com.github.frog-warm.*
+com.github.fromage.quasi.*
+com.github.frontear.*
+com.github.frostyaxe.*
+com.github.frtu.archetype.*
+com.github.frtu.governance.*
+com.github.frtu.libs.*
+com.github.frtu.logs.*
+com.github.frtu.simple.*
+com.github.frtu.smartscan.*
+com.github.frtu.tools.*
+com.github.fs2-blobstore.*
+com.github.fsanaulla.*
+com.github.fsbarata.*
+com.github.fscheffer.*
+com.github.fsimoncelli.*
+com.github.fslev.*
+com.github.fstien.*
+com.github.fsw0422.*
+com.github.ft-force.*
+com.github.ftrossbach.*
+com.github.fujaba.*
+com.github.fulrich.*
+com.github.funthomas424242.*
+com.github.furkandogan.*
+com.github.fusiled.*
+com.github.fuwanguo.*
+com.github.fuzzdbunit.*
+com.github.fworks.*
+com.github.fxhibon.*
+com.github.fys1314.*
+com.github.fzakaria.*
+com.github.g-chenning.*
+com.github.g0soft.*
+com.github.gabadi.scalajooq.*
+com.github.gaborkolarovics.*
+com.github.gaboso.*
+com.github.gabrielemariotti.cards.*
+com.github.gabrielemariotti.changeloglib.*
+com.github.gabrielle-anderson.*
+com.github.gabrielruiu.*
+com.github.gahrae.*
+com.github.galatearaj.*
+com.github.galigator.openllet.*
+com.github.gam2046.*
+com.github.ganeshjunghare.*
+com.github.ganet.*
+com.github.ganfra.*
+com.github.gannalyo.*
+com.github.ganskef.*
+com.github.gantsign.maven.*
+com.github.gantsign.maven.archetypes.*
+com.github.gantsign.maven.doxia.*
+com.github.gantsign.maven.plugin-tools.*
+com.github.gantsign.parent.*
+com.github.gaodeha.common.*
+com.github.gaojh.*
+com.github.gaols.*
+com.github.gaols.unipay.*
+com.github.gaoqisen.*
+com.github.garc33.gradle.plugins.*
+com.github.garyaiki.*
+com.github.gastaldi.*
+com.github.gastricspark.*
+com.github.gavinmead.*
+com.github.gavintranter.*
+com.github.gavlyukovskiy.*
+com.github.gbenroscience.*
+com.github.gcacace.*
+com.github.gcauchis.*
+com.github.gchudnov.*
+com.github.gchudnov.bspec.*
+com.github.gchudnov.squel.*
+com.github.gcms.*
+com.github.gcorporationcare.*
+com.github.gdelafosse.*
+com.github.gdfm.*
+com.github.gdjennings.*
+com.github.gdohmeier.*
+com.github.gdouyang.*
+com.github.gearzero.*
+com.github.geekcodeplus.*
+com.github.geekonjava.*
+com.github.geemu.*
+com.github.gege-fr.*
+com.github.geirolz.*
+com.github.geko444.*
+com.github.gekoh.yagen.*
+com.github.gekomad.*
+com.github.gengzi.*
+com.github.geningxiang.*
+com.github.genium-framework.*
+com.github.geniushkg.*
+com.github.genthaler.*
+com.github.gentity.*
+com.github.gentoor.*
+com.github.geoframecomponents.*
+com.github.geoladris.*
+com.github.geoladris.apps.*
+com.github.geoladris.plugins.*
+com.github.georgeosddev.*
+com.github.gerardklee.*
+com.github.gerardsoleca.*
+com.github.gered.*
+com.github.gergelyszaz.bgl.*
+com.github.germanosin.*
+com.github.gerp83.*
+com.github.gerritjvv.*
+com.github.gert-wijns.*
+com.github.gestalt-config.*
+com.github.getfundwave.*
+com.github.gfernandez598.*
+com.github.gfx.*
+com.github.gfx.android.powerassert.*
+com.github.gfx.gradle.*
+com.github.gfx.ribbonizer.*
+com.github.gfx.util.*
+com.github.gfx.util.encrpt.*
+com.github.gfx.util.encrypt.*
+com.github.gfzeng.*
+com.github.gg811.*
+com.github.ggalmazor.*
+com.github.ggeorgovassilis.*
+com.github.ggerla.*
+com.github.ggotardo.*
+com.github.ggreen.*
+com.github.gh0u1l5.*
+com.github.gh351135612.*
+com.github.ghik.*
+com.github.ghongekshitijtradepirate.*
+com.github.ghostdogpr.*
+com.github.gianlucabevilacqua93.*
+com.github.giannispapadakis.*
+com.github.giantray.*
+com.github.gianttreelp.*
+com.github.gianttreelp.proguardservicesmapper.*
+com.github.gibck.*
+com.github.giftedprimate.*
+com.github.gigamole.millspinners.*
+com.github.gigigo-android-devs.*
+com.github.gigigogreenlabs.*
+com.github.gigiosouza.*
+com.github.gigurra.*
+com.github.giiita.*
+com.github.gilberto-torrezan.*
+com.github.gilbertovento.*
+com.github.gilbertw1.*
+com.github.gilleain.signatures.*
+com.github.gilmardeveloper.*
+com.github.gimlet2.*
+com.github.gimmi.*
+com.github.gino0631.*
+com.github.ginvavilon.*
+com.github.ginvavilon.ajson.*
+com.github.ginvavilon.traghentto.*
+com.github.giorgosart.*
+com.github.giovanimoura.*
+com.github.git-yangshuang.*
+com.github.git1988.*
+com.github.git24j.*
+com.github.github.*
+com.github.githubpeon.*
+com.github.gitqiao.*
+com.github.gitssie.*
+com.github.gittors.*
+com.github.gitveio.*
+com.github.giulianini.jestures.*
+com.github.giulianini.track4j.*
+com.github.giuliopulina.*
+com.github.giulioscattolin.*
+com.github.giuseppegiacoppo.*
+com.github.giveme0101.*
+com.github.gjsduarte.*
+com.github.gkarthiks.*
+com.github.gkonst.*
+com.github.gkutiel.*
+com.github.glautervl.*
+com.github.gleethos.*
+com.github.glistman.*
+com.github.gliviu.*
+com.github.globocom.*
+com.github.glory2018.*
+com.github.glusk.*
+com.github.gm-spacagna.*
+com.github.gmazzo.*
+com.github.gmazzo.codeowners.*
+com.github.gmcoringa.*
+com.github.gnni.*
+com.github.gnurfos.*
+com.github.go-ive.*
+com.github.gobars.*
+com.github.goblinbr.*
+com.github.godfather1103.*
+com.github.godis.*
+com.github.gokan-ekinci.*
+com.github.gokulsukumar03.*
+com.github.goldin.*
+com.github.goldin.plugins.gradle.*
+com.github.golovin47.drawingview.*
+com.github.gondolav.*
+com.github.gonella.*
+com.github.gongfuboy.*
+com.github.gonglb.tools.*
+com.github.goober.*
+com.github.goodforgod.*
+com.github.goodpaas.*
+com.github.goodwillparking.*
+com.github.gopiraj24.*
+com.github.gorans90.*
+com.github.goranstack.esox.*
+com.github.gorttar.*
+com.github.gossie.*
+com.github.gotham25.*
+com.github.goto1134.*
+com.github.gotson.*
+com.github.gotson.bestbefore.*
+com.github.gotson.nightmonkeys.*
+com.github.goutham106.*
+com.github.goutham106.gmarchmvvm.*
+com.github.govindsa1011.*
+com.github.gperez88.*
+com.github.gphat.*
+com.github.gplnature.*
+com.github.gpluscb.*
+com.github.gpor0.*
+com.github.gqtools.*
+com.github.gquintana.beepbeep.*
+com.github.gquintana.metrics.*
+com.github.gradeawarrior.*
+com.github.grails-galahad.*
+com.github.grantcooksey.*
+com.github.grantjforrester.*
+com.github.grantlittle.*
+com.github.grantneale.*
+com.github.grantwest.eventually.*
+com.github.grantwest.sparkj.*
+com.github.grapesnberries.*
+com.github.grapheco.*
+com.github.grat-plugin.*
+com.github.greasemonk.*
+com.github.greatermkemeetup.*
+com.github.greaterplus.*
+com.github.greatjapa.*
+com.github.green-solver.*
+com.github.greenfrvr.*
+com.github.greengerong.*
+com.github.greenyears.*
+com.github.gregwhitaker.*
+com.github.grepplabs.*
+com.github.gressy.*
+com.github.greycode.*
+com.github.greysoft.build.*
+com.github.greysoft.greybuild.*
+com.github.greysoft.loggers.*
+com.github.greysoft.naf.*
+com.github.grgrzybek.*
+com.github.griddb.*
+com.github.grignaak.*
+com.github.grignaak.collections.*
+com.github.grigorevp.*
+com.github.grimmjo.*
+com.github.grimsa.hibernate.*
+com.github.gringostar.*
+com.github.groestlcoin.*
+com.github.grooviter.*
+com.github.groovy-wslite.*
+com.github.grossopa.*
+com.github.groupon.monsoon.*
+com.github.growth2.*
+com.github.grozandrei.*
+com.github.grtechtv.*
+com.github.gryzor.*
+com.github.grzesiek-galezowski.*
+com.github.gs618.*
+com.github.gscaparrotti.*
+com.github.gsdenys.*
+com.github.gsk-aiops.*
+com.github.gslowikowski.*
+com.github.gslowikowski.com.groupon.dse.*
+com.github.gtache.*
+com.github.gtriip.translation.opera.*
+com.github.gturedi.*
+com.github.gtxtreme21.*
+com.github.guang19.*
+com.github.guangyang1314666.*
+com.github.guavaberry.*
+com.github.guigumua.*
+com.github.guilhe.*
+com.github.guilhe.kmp.*
+com.github.guilhe.sharedprefs-ktx.*
+com.github.guilhermesgb.*
+com.github.guilhermestorck.*
+com.github.guillaumebort.*
+com.github.guillaumedd.*
+com.github.guillaumederval.*
+com.github.gumtreediff.*
+com.github.gun88.*
+com.github.gundy.*
+com.github.gungnirlaevatain.*
+com.github.guochaojava.*
+com.github.guolf.*
+com.github.guoxuedong.*
+com.github.guoyaohui.*
+com.github.guoyixing.*
+com.github.guqiyao.*
+com.github.gurgendanielyan.*
+com.github.guru107.*
+com.github.gusenov.*
+com.github.gustafah.*
+com.github.gustajz.*
+com.github.gustavodsf.*
+com.github.gustavovitor.*
+com.github.guu-mc.*
+com.github.guuilp.*
+com.github.gv2011.*
+com.github.gv2011.helloworld.*
+com.github.gv2011.jctrl.*
+com.github.gv2011.logback.*
+com.github.gv2011.m2t.*
+com.github.gvolpe.*
+com.github.gvr.*
+com.github.gw2toolbelt.gw2ml.*
+com.github.gwenn.*
+com.github.gwr3n.*
+com.github.gwtboot.*
+com.github.gwtbootstrap.*
+com.github.gwtd3.*
+com.github.gwtmaterialdesign.*
+com.github.gwtreact.*
+com.github.gx304419380.*
+com.github.gxhunter.*
+com.github.gyntools.*
+com.github.gyulalaszlo.*
+com.github.gzm55.maven.*
+com.github.h-kishi.*
+com.github.h-thurow.*
+com.github.h0ru5.gwt.*
+com.github.h0tk3y.betterParse.*
+com.github.h908714124.*
+com.github.habernal.*
+com.github.habibi07.*
+com.github.hachimann.*
+com.github.hackerwin7.*
+com.github.hadasbro.*
+com.github.hadielmougy.*
+com.github.hadii-tech.*
+com.github.hadilq.*
+com.github.hadilq.liveevent.*
+com.github.hadilq.trackable.*
+com.github.hadoop002.*
+com.github.hadoop002.smartretry.*
+com.github.haerxiong.*
+com.github.haflife3.*
+com.github.hageldave.*
+com.github.hageldave.ezfftw.*
+com.github.hageldave.imagingkit.*
+com.github.hageldave.jplotter.*
+com.github.hageldave.optisled.*
+com.github.hageldave.uamds.*
+com.github.haggholm.*
+com.github.hai046.*
+com.github.haifengl.*
+com.github.haiger.*
+com.github.haiger.starter.*
+com.github.haitaowang123.*
+com.github.hajile.common-pom-oss.*
+com.github.hakenadu.*
+com.github.hakmesyo.*
+com.github.hal4j.*
+com.github.halab4dev.*
+com.github.hale-lee.*
+com.github.halfmatthalfcat.*
+com.github.halking.*
+com.github.hall-wong.*
+com.github.halower.*
+com.github.halysongoncalves.*
+com.github.halzhang.*
+com.github.hammelion.*
+com.github.hamsterksu.*
+com.github.han-yaeger.*
+com.github.handong0123.*
+com.github.handywings.*
+com.github.hanleyt.*
+com.github.hanlyjiang.*
+com.github.hanshsieh.*
+com.github.hanuor.*
+com.github.haosenwei.*
+com.github.happyfaces.*
+com.github.happyjiahui.*
+com.github.harbby.*
+com.github.harikrishnant1991.*
+com.github.harmonicinc-com.*
+com.github.harry389.*
+com.github.harryemartland.*
+com.github.harshad5498.*
+com.github.harti2006.*
+com.github.harunhasdal.livecycle.*
+com.github.haruntuncay.*
+com.github.hasatori.*
+com.github.hasnat.*
+com.github.hassan-ghahraloud.*
+com.github.hateoas-forms.*
+com.github.havardh.*
+com.github.havarunner.*
+com.github.hayarobi.*
+com.github.hayasshi.*
+com.github.haz4j.*
+com.github.hazard4j.*
+com.github.hazendaz.*
+com.github.hazendaz.7zip.*
+com.github.hazendaz.ant.*
+com.github.hazendaz.catch-exception.*
+com.github.hazendaz.git.*
+com.github.hazendaz.gpg4win.*
+com.github.hazendaz.gradle.*
+com.github.hazendaz.httpunit.*
+com.github.hazendaz.jmeter.*
+com.github.hazendaz.jmockit.*
+com.github.hazendaz.jsoup.*
+com.github.hazendaz.maven.*
+com.github.hazendaz.nodejs.*
+com.github.hazendaz.npp.*
+com.github.hazendaz.putty.*
+com.github.hazendaz.sfdx.*
+com.github.hazendaz.spotbugs.*
+com.github.hazendaz.tomcat.*
+com.github.hazendaz.winscp.*
+com.github.hbas.*
+com.github.hbci4j.*
+com.github.hbmartin.*
+com.github.hburgmeier.jerseyoauth2.*
+com.github.hc-tys.*
+com.github.hc621311.*
+com.github.hcguersoy.*
+com.github.hcmlab.*
+com.github.hcsp.*
+com.github.hcyhzy.*
+com.github.hdghg.*
+com.github.hdouss.*
+com.github.hdy10.*
+com.github.healexxzt.*
+com.github.health-hope.*
+com.github.healthonnet.*
+com.github.hearsilent.circularindicator.*
+com.github.heartbridge.*
+com.github.heatalways.*
+com.github.heavensay.*
+com.github.heehan.*
+com.github.hegdepranav21.*
+com.github.heidaodageshiwo.*
+com.github.heideltime.*
+com.github.heiqs.*
+com.github.hekonsek.*
+com.github.helenusdriver.*
+com.github.helgeho.*
+com.github.helloichen.*
+com.github.hellorocky.*
+com.github.hellowzk.*
+com.github.hellproxy.*
+com.github.helpermethod.*
+com.github.hemanthsridhar.*
+com.github.hemanthsridhar1992.*
+com.github.hemantsonu20.*
+com.github.hendricjabs.*
+com.github.heneke.thymeleaf.*
+com.github.hengboy.*
+com.github.henkelian.*
+com.github.henkexbg.*
+com.github.henneberger.*
+com.github.henoc.*
+com.github.henriquemcastro.*
+com.github.henryco.*
+com.github.henryhuang.*
+com.github.heqiao2010.*
+com.github.herdinger.*
+com.github.hermannpencole.*
+com.github.hermod.*
+com.github.herowzz.*
+com.github.herrschwarz.*
+com.github.hervian.*
+com.github.hetianyi.*
+com.github.heuermh.adamcommands.*
+com.github.heuermh.adamexamples.*
+com.github.heuermh.adamexplorer.*
+com.github.heuermh.adamgfa.*
+com.github.heuermh.adamplugins.*
+com.github.heuermh.duckdb.*
+com.github.heuermh.ensemblmartrunner.*
+com.github.heuermh.ensemblrestclient.*
+com.github.heuermh.maven.plugin.changes.*
+com.github.heuermh.sparkling.*
+com.github.heuermh.velocity.*
+com.github.hex0cter.*
+com.github.hexagonoframework.*
+com.github.hexffff0.*
+com.github.hexiangtao.*
+com.github.hexindai.maven.plugins.*
+com.github.hexindai.s3harding.*
+com.github.hexocraft.*
+com.github.hexx.*
+com.github.hey-johnnypark.*
+com.github.heyi-core.*
+com.github.hfhn.*
+com.github.hgbit.*
+com.github.hguerrerojaime.*
+com.github.hgwood.fanfaron.*
+com.github.hgwood.nobleschemas.*
+com.github.hi-dhl.*
+com.github.hi-fi.*
+com.github.hibernate-redis.*
+com.github.hicoincom.*
+com.github.highcharts4gwt.*
+com.github.highposi.*
+com.github.highras.*
+com.github.hihi-dev.*
+com.github.hijesse.*
+com.github.hikvisionga.*
+com.github.hilcode.*
+com.github.hildoneduardo.*
+com.github.himadri77.*
+com.github.hinsteny.*
+com.github.hioo520.*
+com.github.hipjim.*
+com.github.hippo-band.*
+com.github.hippoom.*
+com.github.hirofumi.*
+com.github.hiroshi-cl.*
+com.github.hiteshsondhi88.libffmpeg.*
+com.github.hivakun.*
+com.github.hiwayama.*
+com.github.hiwepy.*
+com.github.hjast.*
+com.github.hjohn.ddif.*
+com.github.hjohn.ddif.extensions.*
+com.github.hjohn.jfx.eventstream.*
+com.github.hkokocin.atheris.*
+com.github.hlvx.*
+com.github.hnishar.konstruk.*
+com.github.hoangdat.mylibrary1.*
+com.github.hoangthai267.*
+com.github.hoantran-it.library.*
+com.github.hoary.*
+com.github.hoary.ffmpeg.*
+com.github.hoary.javaav.*
+com.github.hoboris.*
+com.github.hoboris.scenes.*
+com.github.holgerbrandl.*
+com.github.holgerbrandl.krangl.*
+com.github.homeant.*
+com.github.homesynck.*
+com.github.honatas.*
+com.github.hongframework.*
+com.github.hongwen1993.*
+com.github.hongxuchen.*
+com.github.honoluluhenk.fluent-bigdecimals.*
+com.github.honoluluhenk.gcmonitor.*
+com.github.honoluluhenk.id-class.*
+com.github.honorem.*
+com.github.honzel.*
+com.github.hopshackle.*
+com.github.horseshoe.*
+com.github.hossein761.*
+com.github.hotchemi.*
+com.github.hotdust.*
+com.github.hoteam.*
+com.github.houbb.*
+com.github.houbbbbb.*
+com.github.houbie.*
+com.github.housepower.*
+com.github.houxinhong.*
+com.github.hoverruan.*
+com.github.howinfun.*
+com.github.howjz.job.*
+com.github.howtobuildapp.*
+com.github.howwrite.*
+com.github.hp-enterprise.*
+com.github.hplp.*
+com.github.hpple.reflection-assert.*
+com.github.hqstevenson.aries.*
+com.github.hqstevenson.junit.*
+com.github.hqstevenson.splunk.*
+com.github.hqstevenson.test.*
+com.github.hroniko.*
+com.github.hronom.*
+com.github.hschneid.*
+com.github.hsiangleekwok.*
+com.github.hsindumas.*
+com.github.hslls.*
+com.github.hsnghrld.*
+com.github.htfv.*
+com.github.htfv.maven.plugins.*
+com.github.htfv.querydsl.*
+com.github.htfv.utils.*
+com.github.httl.*
+com.github.httpmock.*
+com.github.hua777.*
+com.github.huajianjiang.*
+com.github.huangbaol.*
+com.github.huangdaren1997.*
+com.github.huanghaoming.*
+com.github.huangp.*
+com.github.huangsigit.*
+com.github.huangtianhua.*
+com.github.huangwenhuan0.toast.*
+com.github.huangzhouhong.*
+com.github.huanshare.*
+com.github.huanying04.utils.*
+com.github.hubbards.*
+com.github.hughwick.*
+com.github.hugoredon.*
+com.github.huifer.*
+com.github.huliganul.*
+com.github.hullbend.*
+com.github.humaoyongyx.*
+com.github.hungntbka.*
+com.github.huntersherms.*
+com.github.huoyu820125.*
+com.github.hupi-analytics.*
+com.github.hushengte.*
+com.github.hussainderry.*
+com.github.hutdev.*
+com.github.huweilong.*
+com.github.huxinghai1988.*
+com.github.huzhitao2018.*
+com.github.hwrdprkns.*
+com.github.hwrdprkns.tileview.*
+com.github.hwywl.*
+com.github.hxbkx.*
+com.github.hy2cone.*
+com.github.hycos.*
+com.github.hyjay.*
+com.github.hyleung.*
+com.github.hypfvieh.*
+com.github.hypfvieh.cli.*
+com.github.hypfvieh.paulmann.*
+com.github.hyukjinkwon.*
+com.github.hyukjinkwon.hcatalog.*
+com.github.hyukjinkwon.shims.*
+com.github.hyunikn.*
+com.github.hyx2020.*
+com.github.i-javan.*
+com.github.i21mscz23.*
+com.github.i2silly.*
+com.github.i49.*
+com.github.iBoot4j.*
+com.github.iaja.*
+com.github.iamdrq.*
+com.github.iamfools.library.*
+com.github.iamiddy.*
+com.github.iammehedi.*
+com.github.iammini5.*
+com.github.iamnotgay.*
+com.github.iampravikant.*
+com.github.iamshreeram.plugins.jmeter.functions.*
+com.github.iamsteveholmes.*
+com.github.iancao.*
+com.github.ianly.*
+com.github.iarellano.*
+com.github.iaunzu.*
+com.github.ibodrov.pcollections.*
+com.github.ibole.*
+com.github.ibryukh.*
+com.github.ican2056.*
+com.github.icarohs7.*
+com.github.icarohs7.unoxlib.*
+com.github.icarus-sullivan.*
+com.github.icatlixl.*
+com.github.ice-zero-cat.*
+com.github.iceberglet.*
+com.github.icebergteam.*
+com.github.icebuf.*
+com.github.icecooly.*
+com.github.iceize.*
+com.github.icexelloss.*
+com.github.ichanzhar.*
+com.github.ichelon.*
+com.github.ichenkaihua.*
+com.github.ichoran.*
+com.github.icuiacd.*
+com.github.icuiacd.spring.util.*
+com.github.ideahut.*
+com.github.idouzi.*
+com.github.idozahavy.*
+com.github.ie3-institute.*
+com.github.iesen.*
+com.github.ifeilong.*
+com.github.ifesdjeen.*
+com.github.ifrugal.*
+com.github.ignaciotcrespo.*
+com.github.ignatij.*
+com.github.igor-g.*
+com.github.igor-petruk.archetypes.*
+com.github.igor-petruk.protobuf.*
+com.github.igor-suhorukov.*
+com.github.igoricelic.*
+com.github.igorperikov.*
+com.github.igortrncic.dotted-progress-bar.*
+com.github.igoryeremin.*
+com.github.igrmk.*
+com.github.ihavenoenglishname.*
+com.github.iherasymenko.*
+com.github.iintelligas.*
+com.github.ik024.*
+com.github.ikhoon.*
+com.github.ikhoury.*
+com.github.ikuo.*
+com.github.ilayze.*
+com.github.ileaniot.*
+com.github.ilgun.*
+com.github.ilpersi.*
+com.github.ilubenets.*
+com.github.ilyes4j.*
+com.github.imNirav.java.validator.*
+com.github.imaginary11.*
+com.github.imangazalievm.*
+com.github.imapi.*
+com.github.imas-alex.*
+com.github.imbactbulletz.*
+com.github.imblue.*
+com.github.imdurgadas.*
+com.github.imifou.*
+com.github.imkrmgn.*
+com.github.imliar.*
+com.github.immuta.hadoop.*
+com.github.imrafaelmerino.*
+com.github.imzz.*
+com.github.inamik.text.tables.*
+com.github.inanme.*
+com.github.inapplibrary.*
+com.github.incu6us.redis.*
+com.github.incu6us.thrift.*
+com.github.indic-dict.*
+com.github.indrabasak.*
+com.github.induwarabas.*
+com.github.indykish.*
+com.github.ineedahouse.*
+com.github.infogen7.*
+com.github.inforion.*
+com.github.infrmods.xbus.*
+com.github.ingarabr.*
+com.github.ingawaleashish.*
+com.github.ingenico-nps-latam.*
+com.github.inkyfox.*
+com.github.insanusmokrassar.*
+com.github.insogroup.*
+com.github.inspektr.*
+com.github.inspetor.*
+com.github.instagram4j.*
+com.github.instantpudd.*
+com.github.insubstantial.*
+com.github.insurlytech.*
+com.github.intel-hadoop.*
+com.github.inthenow.*
+com.github.inti-net.*
+com.github.intraway.*
+com.github.intrigus.cocoja.*
+com.github.intrigus.gdx-freetype-gwt.*
+com.github.introfog.pie.*
+com.github.invictum.*
+com.github.inzahgi.*
+com.github.io-siv.*
+com.github.iojjj.*
+com.github.ioprotocol.*
+com.github.iotexproject.*
+com.github.iounit.*
+com.github.ipaynow.*
+com.github.ipfaffen.*
+com.github.ipsingh12.*
+com.github.iridiobis.*
+com.github.iriscube.*
+com.github.irof.*
+com.github.iron9light.*
+com.github.ironcero.*
+com.github.ironfish.*
+com.github.ironrobot.*
+com.github.irshulx.*
+com.github.isaichkindanila.*
+com.github.isdream.*
+com.github.isengrim613.*
+com.github.ishestakov.carnotzet.*
+com.github.ishugaliy.*
+com.github.isi-nmr.*
+com.github.iskandarma.*
+com.github.iskrenyp.*
+com.github.isliqian.*
+com.github.ismaeltoe.*
+com.github.ismail-mekni.*
+com.github.isong0623.*
+com.github.isopropylcyanide.*
+com.github.ispong.*
+com.github.israel.*
+com.github.isrsal.*
+com.github.isyscore.*
+com.github.itasyurt.*
+com.github.itcrazy2008.*
+com.github.itechbear.*
+com.github.ithildir.*
+com.github.itsabhiaryan.*
+com.github.itsajskid.*
+com.github.itsmechlark.*
+com.github.itsmechlark.android-sliding-menu.*
+com.github.itsmechlark.util.*
+com.github.itspawanbhardwaj.*
+com.github.itwenty.*
+com.github.itzikbraun.*
+com.github.itzmedinesh.*
+com.github.iurysza.*
+com.github.ivan-nosar.*
+com.github.ivan_osipov.*
+com.github.ivandzf.*
+com.github.ivangolubev.*
+com.github.ivangolubev.pbkdf2sha512.*
+com.github.ivanocortesini.*
+com.github.ivanovvlad9626.*
+com.github.ivbaranov.*
+com.github.ivbaranov.rxbluetooth.*
+com.github.iwantthink.*
+com.github.iweinzierl.*
+com.github.iwgang.*
+com.github.ixa-ehu.*
+com.github.izeigerman.*
+com.github.izmailoff.*
+com.github.izzyreal.*
+com.github.j-chimienti.*
+com.github.j-fischer.*
+com.github.j-mie6.*
+com.github.j-pingus.*
+com.github.j2ro.*
+com.github.j2ts.*
+com.github.j3t.*
+com.github.j4velin.EazeGraph.*
+com.github.j4velin.PictureChooser.*
+com.github.j4velin.colorpicker.*
+com.github.j5ik2o.*
+com.github.ja-fra.zk-configuration.*
+com.github.ja391045.*
+com.github.jaceko.cxf.*
+com.github.jaceksokol.*
+com.github.jack6wolf.*
+com.github.jacke.*
+com.github.jacker-wang.*
+com.github.jackieonway.*
+com.github.jackieonway.sms.*
+com.github.jackieonway.util.*
+com.github.jackpanz.*
+com.github.jacky-cai.*
+com.github.jacky00358.*
+com.github.jacoby6000.*
+com.github.jadeice.*
+com.github.jafarlihi.*
+com.github.jahoefne.*
+com.github.jai-imageio.*
+com.github.jaimess.*
+com.github.jainsahab.*
+com.github.jakev.*
+com.github.jakimli.pandaria.*
+com.github.jakubkolar.*
+com.github.jalasoft.*
+com.github.james64.*
+com.github.jamescarter.ooxml2java2d.*
+com.github.jameshnsears.*
+com.github.jamesnetherton.*
+com.github.jameszbl.*
+com.github.janardhanajl.*
+com.github.janbols.*
+com.github.jango89.*
+com.github.janisz.*
+com.github.janjaali.*
+com.github.jankroken.*
+com.github.janlabrie.*
+com.github.jannvck.*
+com.github.janssk1.*
+com.github.japgolly.*
+com.github.japgolly.android.*
+com.github.japgolly.android.test.*
+com.github.japgolly.clearconfig.*
+com.github.japgolly.fork.*
+com.github.japgolly.fork.boopickle.*
+com.github.japgolly.fork.google-cloud-trace.*
+com.github.japgolly.fork.google-cloud-trace.v1.*
+com.github.japgolly.fork.monocle.*
+com.github.japgolly.fork.nicta.*
+com.github.japgolly.fork.parboiled.*
+com.github.japgolly.fork.scalaz.*
+com.github.japgolly.fork.shapeless.*
+com.github.japgolly.fork.specs2.*
+com.github.japgolly.fork.upickle.*
+com.github.japgolly.microlibs.*
+com.github.japgolly.nyaya.*
+com.github.japgolly.scala-graal.*
+com.github.japgolly.scalacss.*
+com.github.japgolly.scalajs-benchmark.*
+com.github.japgolly.scalajs-react.*
+com.github.japgolly.test-state.*
+com.github.japgolly.tla2json.*
+com.github.japgolly.univeq.*
+com.github.japgolly.webapp-util.*
+com.github.japkit.*
+com.github.jarlakxen.*
+com.github.jarnaud.*
+com.github.jarod.*
+com.github.jarvisframework.*
+com.github.jasarus.*
+com.github.jasminb.*
+com.github.jasoma.*
+com.github.jason1114.*
+com.github.jasonfry89.*
+com.github.jasonhancn.*
+com.github.jasonmfehr.*
+com.github.jasonruckman.*
+com.github.jasontypescodes.*
+com.github.jasonwangdev.*
+com.github.jasync-sql.*
+com.github.jatcwang.*
+com.github.java-heap-dump-sanitizer.*
+com.github.java-json-tools.*
+com.github.java-prolog-connectivity.*
+com.github.javachat.*
+com.github.javacliparser.*
+com.github.javaclub.*
+com.github.javacommons.*
+com.github.javacpp-nogpl.*
+com.github.javactic.*
+com.github.javadev.*
+com.github.javadojo.*
+com.github.javafaker.*
+com.github.javahaohao.*
+com.github.javahello.*
+com.github.javaito.*
+com.github.javakam.*
+com.github.javakeyring.*
+com.github.javalbert.*
+com.github.javaparser.*
+com.github.javaslang.map2pojo.*
+com.github.javasridhar.*
+com.github.javasync.*
+com.github.javatlacati.*
+com.github.javawebers.*
+com.github.javawithmarcus.wicket-cdi-1.1.*
+com.github.javawxl.*
+com.github.javaxcel.*
+com.github.javen205.*
+com.github.javicerveraingram.*
+com.github.jawf.*
+com.github.jaxb-xew-plugin.*
+com.github.jayaoliu.*
+com.github.jaybionic.*
+com.github.jayield.*
+com.github.jayuc.*
+com.github.jazng.*
+com.github.jazzhow.*
+com.github.jbaiter.*
+com.github.jbapple.*
+com.github.jbellis.*
+com.github.jbgust.*
+com.github.jborza.*
+com.github.jbosnjak.*
+com.github.jbowkett.*
+com.github.jbricks.soap2jms.*
+com.github.jbricks.soap2jms.integration-tests.*
+com.github.jbvincey.*
+com.github.jbytecode.*
+com.github.jc-roman.*
+com.github.jcandksolutions.gradle.*
+com.github.jcategory.*
+com.github.jchanghong.*
+com.github.jchanghong.jch.*
+com.github.jclww.*
+com.github.jconverter.*
+com.github.jcrochavera.*
+com.github.jcustenborder.*
+com.github.jcustenborder.kafka.*
+com.github.jcustenborder.kafka.connect.*
+com.github.jcustenborder.maven.plugins.*
+com.github.jcustenborder.netty.*
+com.github.jcustenborder.parsers.*
+com.github.jcute.*
+com.github.jczachor6.*
+com.github.jczuchnowski.*
+com.github.jd-alexander.*
+com.github.jdbc-bare.*
+com.github.jdbc-json.*
+com.github.jdegoes.*
+com.github.jdramaix.*
+com.github.jean-merelis.*
+com.github.jeanadrien.*
+com.github.jeanbaptistewatenberg.junit5kubernetes.*
+com.github.jeckep.*
+com.github.jedis-lock.*
+com.github.jeesun.thymeleaf.extras.*
+com.github.jeff-dong.*
+com.github.jeff-dong.marble.*
+com.github.jeffersonzapata.*
+com.github.jeffreyfalgout.*
+com.github.jeffreyning.*
+com.github.jeffreyolchovy.*
+com.github.jeffreytai.*
+com.github.jeffyzhuang.*
+com.github.jegr78.*
+com.github.jeichler.*
+com.github.jelmerk.*
+com.github.jeluard.*
+com.github.jeluard.ion.*
+com.github.jeluard.ion.plugins.*
+com.github.jeluard.parent-enforcer-rule.*
+com.github.jeluard.parent-enforcer-rule.tests.*
+com.github.jeluard.parent-enforcer-rule.tests.multiple-correct.*
+com.github.jenly1314.*
+com.github.jenly1314.AndroidKTX.*
+com.github.jenly1314.AppUpdater.*
+com.github.jenly1314.MLKit.*
+com.github.jenly1314.WeChatQRCode.*
+com.github.jenly1314.wechat-qrcode.*
+com.github.jennybrown8.wicket-source.*
+com.github.jensborch.webhooks4j.*
+com.github.jenshaase.uimascala.*
+com.github.jenzz.multistatelistview.*
+com.github.jenzz.undobar.*
+com.github.jep42.*
+com.github.jeppeter.*
+com.github.jepsar.*
+com.github.jeremiemartinez.*
+com.github.jeremyda.*
+com.github.jeremysolarz.*
+com.github.jeroenr.*
+com.github.jeromelsj.*
+com.github.jerrymice.*
+com.github.jerrymice.common.*
+com.github.jerrysearch.*
+com.github.jerryxia.*
+com.github.jerryzlei.*
+com.github.jershell.*
+com.github.jesg.*
+com.github.jessemull.*
+com.github.jessyZu.*
+com.github.jessyZu.jsongood.*
+com.github.jetose.*
+com.github.jetqin.*
+com.github.jeuler.*
+com.github.jeuxjeux20.*
+com.github.jeya-balaji.*
+com.github.jezza.*
+com.github.jfcloud.*
+com.github.jferard.*
+com.github.jferrater.*
+com.github.jfgrim.*
+com.github.jfno.*
+com.github.jfragosoperez.*
+com.github.jfrommann.*
+com.github.jg513.*
+com.github.jgonian.*
+com.github.jgordijn.*
+com.github.jgswp.*
+com.github.jgum.*
+com.github.jgzl.*
+com.github.jh-factory.*
+com.github.jhberges.*
+com.github.jherculesqz.*
+com.github.jhg023.*
+com.github.jhoenicke.*
+com.github.jhonnymertz.*
+com.github.jhonsapp.*
+com.github.jhonyscamacho.*
+com.github.jhuir.*
+com.github.ji4597056.*
+com.github.jia-zhen.*
+com.github.jiahaowen.*
+com.github.jiangjihui.*
+com.github.jianglei1994.*
+com.github.jiangxch.*
+com.github.jiangxincode.*
+com.github.jianliu.*
+com.github.jiaqi0722.*
+com.github.jiayaoguang.*
+com.github.jiayuhan-it.*
+com.github.jibijose.*
+com.github.jiconfont.*
+com.github.jieblog.*
+com.github.jiesu12.*
+com.github.jikyo.*
+com.github.jilen.*
+com.github.jim2ha0.*
+com.github.jimcoven.*
+com.github.jimsp.*
+com.github.jinahya.*
+com.github.jinanzhuan.*
+com.github.jinatonic.confetti.*
+com.github.jinchunzhao.*
+com.github.jindz.*
+com.github.jingshouyan.*
+com.github.jingting-zhang.*
+com.github.jingxiaohu.*
+com.github.jinnovations.*
+com.github.jinsangYoo.*
+com.github.jinse95.*
+com.github.jinsen47.slidingactionview.*
+com.github.jiramot.*
+com.github.jirkafm.*
+com.github.jirotubuyaki.*
+com.github.jitsk.*
+com.github.jitsni.*
+com.github.jitwxs.*
+com.github.jivimberg.*
+com.github.jiwari.*
+com.github.jj3l.*
+com.github.jjYBdx4IL.*
+com.github.jjYBdx4IL.aop.*
+com.github.jjYBdx4IL.chess.*
+com.github.jjYBdx4IL.gwt.*
+com.github.jjYBdx4IL.nn.fannj.*
+com.github.jjYBdx4IL.utils.*
+com.github.jjagged.*
+com.github.jjfidalgo.*
+com.github.jjwtimmer.*
+com.github.jkauzlar.*
+com.github.jkinkead.*
+com.github.jklasd.*
+com.github.jknack.*
+com.github.jkody.*
+com.github.jkschneider.*
+com.github.jkugiya.*
+com.github.jkutner.*
+com.github.jlabsys.*
+com.github.jlangch.*
+com.github.jlarrieux.*
+com.github.jlefebure.*
+com.github.jleskovar.*
+com.github.jlgrock.*
+com.github.jlgrock.javascript-framework.*
+com.github.jlgrock.javascript.*
+com.github.jlgrock.snp.*
+com.github.jlibrary.*
+com.github.jlinq.*
+com.github.jlinqer.*
+com.github.jlmauduy.*
+com.github.jm-lab.*
+com.github.jmSfernandes.*
+com.github.jmarin.*
+com.github.jmarkstar.*
+com.github.jmatsu.*
+com.github.jmchilton.blend4j.*
+com.github.jmchilton.galaxybootstrap.*
+com.github.jmgilmour.*
+com.github.jmicrostack.*
+com.github.jmjlbmn.*
+com.github.jmkgreen.morphia.*
+com.github.jmnarloch.*
+com.github.jmodel.*
+com.github.jmolsmobile.*
+com.github.jmyday.*
+com.github.jnidzwetzki.*
+com.github.jnoee.*
+com.github.jnr.*
+com.github.jntakpe.*
+com.github.jnthnclt.*
+com.github.joaocruz04.*
+com.github.joaocruz04.jutils.*
+com.github.joaocsousa.*
+com.github.joaquimsn.*
+com.github.jobop.*
+com.github.jobservice.*
+com.github.jochenw.*
+com.github.jochenw.afw.*
+com.github.jochenw.qse.*
+com.github.jodenhe.*
+com.github.jodersky.*
+com.github.joecizac.social-api.*
+com.github.joecourtneyw.*
+com.github.joel1di1.*
+com.github.joelittlejohn.embedmongo.*
+com.github.joeljt.*
+com.github.johan-backstrom.*
+com.github.johanbrorson.*
+com.github.johanfredin.*
+com.github.johann673.*
+com.github.johanneslichtenberger.sirix.*
+com.github.johannesptaszyk.*
+com.github.johnaimes1a.f1x.*
+com.github.johncfranco.*
+com.github.johnkil.android-appmsg.*
+com.github.johnkil.android-progressfragment.*
+com.github.johnkil.android-robototextview.*
+com.github.johnkil.print.*
+com.github.johnlangford.*
+com.github.johnlee175.*
+com.github.johnnyjayjay.*
+com.github.johnnymillergh.boot.*
+com.github.johnpersano.*
+com.github.johnpoth.*
+com.github.johnreedlol.*
+com.github.johrstrom.*
+com.github.joineral32.*
+com.github.jojoldu.*
+com.github.jonahwh.*
+com.github.jonasborn.*
+com.github.jonasgeiregat.*
+com.github.jonasrutishauser.*
+com.github.jonasrutishauser.maven.plugin.*
+com.github.jonasrutishauser.maven.wagon.*
+com.github.jonasrutishauser.org.junit.platform.*
+com.github.jonathanhds.*
+com.github.jonathanmerritt.RxAssetManager.*
+com.github.jonathanmerritt.androidscabbard.*
+com.github.jonathanmerritt.rxassetmanager.*
+com.github.jonathannye.rpatch.*
+com.github.jonathanswenson.*
+com.github.jonathanxd.*
+com.github.jonatino.*
+com.github.jond3k.*
+com.github.jongwook.*
+com.github.joniles.*
+com.github.jonnylaw.*
+com.github.jonpereiradev.*
+com.github.jonpeterson.*
+com.github.jonzhang3.*
+com.github.joonasvali.naturalmouse.*
+com.github.jorge2m.*
+com.github.jorgecastilloprz.*
+com.github.jorgepbrown.*
+com.github.jorilytter.utils.*
+com.github.jorrellz.*
+com.github.joschi.*
+com.github.joschi.jackson.*
+com.github.joschi.jersey.jetty10.*
+com.github.joschi.jlibvips.*
+com.github.joschi.nosqlunit.*
+com.github.joschi.openapi-diff.*
+com.github.josecardenas2021.*
+com.github.joselion.*
+com.github.joselume.*
+com.github.joshelser.*
+com.github.joshiyogesh.*
+com.github.joshjdevl.libsodiumjni.*
+com.github.joshlemer.*
+com.github.joshualley.*
+com.github.josipklaric.*
+com.github.jossiey.*
+com.github.joutaojian.*
+com.github.joutvhu.*
+com.github.jovanibrasil.*
+com.github.jovanikos.*
+com.github.jozzee.android.*
+com.github.jpaoletti.*
+com.github.jparkie.*
+com.github.jparsec.*
+com.github.jpbetz.*
+com.github.jpihl.*
+com.github.jpmorganchase.lint-assert.*
+com.github.jpmorganchase.sandboni.*
+com.github.jpmossin.*
+com.github.jpmsilva.groundlevel-utilities.*
+com.github.jpmsilva.jsystemd.*
+com.github.jpmsilva.ppmp.*
+com.github.jpmsilva.rewrite-spring-boot-starter.*
+com.github.jponge.*
+com.github.jpteam.adhive.*
+com.github.jquality.*
+com.github.jrachiele.*
+com.github.jradolfo.*
+com.github.jrcodeza.*
+com.github.jreddit.*
+com.github.jrh3k5.*
+com.github.jrialland.*
+com.github.jryans.jless.*
+com.github.js-cookie.*
+com.github.jsGintoki.*
+com.github.jsaund.*
+com.github.jsbintask22.*
+com.github.jscancella.*
+com.github.jsdevel.*
+com.github.jsendnsca.*
+com.github.jshaptic.*
+com.github.jsimone.*
+com.github.jsixface.*
+com.github.json-template.*
+com.github.jsonj.*
+com.github.jsonld-java.*
+com.github.jsonzou.*
+com.github.jspxnet.*
+com.github.jsqlparser.*
+com.github.jsr-330.*
+com.github.jsr203hadoop.*
+com.github.jsrdxzw.*
+com.github.jstrainer.*
+com.github.jstumpp.*
+com.github.jsuereth.scala-arm.*
+com.github.jsurfer.*
+com.github.jszczepankiewicz.*
+com.github.jt-org.*
+com.github.jtakakura.*
+com.github.jtendermint.*
+com.github.jtidy.*
+com.github.jtxer.*
+com.github.jucovschi.*
+com.github.judemanutd.*
+com.github.judoole.*
+com.github.juise.*
+com.github.jukkakarvanen.*
+com.github.juliangamble.*
+com.github.julianps.modelmapper.*
+com.github.juliansantosinfo.*
+com.github.julianthome.*
+com.github.julien-truffaut.*
+com.github.julienbanse.*
+com.github.julienst.*
+com.github.juliomarcopineda.*
+com.github.julior.*
+com.github.julywind.*
+com.github.jun1st.*
+com.github.junahan.*
+com.github.junitrunner.*
+com.github.junjie-bianjie.*
+com.github.junqueira.*
+com.github.junrar.*
+com.github.junwen12221.*
+com.github.jupfu.*
+com.github.jurajburian.*
+com.github.just-4-fun.*
+com.github.just-4-fun.core-utils.*
+com.github.justcoke.*
+com.github.justhalf.nlp.*
+com.github.justinclagg.*
+com.github.justincranford.*
+com.github.justinlee88.*
+com.github.justzak.*
+com.github.juzi214032.*
+com.github.jvican.*
+com.github.jvmtool.*
+com.github.jwchung.*
+com.github.jwcnewton.*
+com.github.jweavers.*
+com.github.jweixin.*
+com.github.jwt-scala.*
+com.github.jxc454.*
+com.github.jyane.*
+com.github.jyoghurt.*
+com.github.jzhi001.*
+com.github.jzila.*
+com.github.k-boyle.*
+com.github.k0kubun.*
+com.github.k0shk0sh.*
+com.github.k0shk0sh.easy.version.*
+com.github.k3b.*
+com.github.ka4ok85.*
+com.github.kaaveland.*
+com.github.kabal163.*
+com.github.kacirekj.*
+com.github.kadi79.gaertner.*
+com.github.kaelthasbmg.*
+com.github.kaeluka.*
+com.github.kagkarlsson.*
+com.github.kahlkn.*
+com.github.kahlkn.artoria.*
+com.github.kahlkn.yui.*
+com.github.kaichunlin.transition.*
+com.github.kaikis.m2m.*
+com.github.kaisle.*
+com.github.kaitoy.sneo.*
+com.github.kaiwinter.*
+com.github.kaixindeken.*
+com.github.kaixinwoo.*
+com.github.kaixinzyw.*
+com.github.kaizen4j.*
+com.github.kaizhaokover.*
+com.github.kaja78.*
+com.github.kaklakariada.*
+com.github.kaku13745107.*
+com.github.kakulisen.*
+com.github.kalessine.*
+com.github.kaligence.*
+com.github.kalokanand.*
+com.github.kalusyu.*
+com.github.kameshchauhan.openfaas.*
+com.github.kamijin-fanta.*
+com.github.kamiru78.*
+com.github.kamjin1996.*
+com.github.kancyframework.*
+com.github.kandy-io.*
+com.github.kanekotic.*
+com.github.kanesee.*
+com.github.kangliang2007.*
+com.github.kanlon.*
+com.github.karacken.*
+com.github.karamelsoft.flow.*
+com.github.karamelsoft.interfaces.*
+com.github.karamelsoft.testing.*
+com.github.karasiq.*
+com.github.karczews.*
+com.github.kardapoltsev.*
+com.github.karelcemus.*
+com.github.karlhigley.*
+com.github.karlicoss.auto.value.*
+com.github.karlnicholas.*
+com.github.karsaig.*
+com.github.karthickmanian.*
+com.github.karthicks.*
+com.github.karthyks.*
+com.github.kasecato.*
+com.github.kasenna.*
+com.github.kashishm.*
+com.github.kasiprasad.contextspec.*
+com.github.kaskadee.*
+com.github.kasonchan.*
+com.github.katari.*
+com.github.katena-chain.*
+com.github.katjahahn.*
+com.github.katlasik.*
+com.github.kaundev.upfx.*
+com.github.kaushikthedeveloper.*
+com.github.kawshik.*
+com.github.kaxi4it.*
+com.github.kaygenzo.*
+com.github.kaygisiz.*
+com.github.kayjamlang.*
+com.github.kaylves.*
+com.github.kazinfoteh.*
+com.github.kbngmoses.*
+com.github.kburger.*
+com.github.kciomek.*
+com.github.kcjang.*
+com.github.kclemens.*
+com.github.kdbtree.*
+com.github.kdvolder.*
+com.github.kdyzm.*
+com.github.kedarkulk7.*
+com.github.kedzie.draggabledrawers.*
+com.github.kedzie.spring-event-annotations.*
+com.github.kedzie.supportanimator.*
+com.github.keehyun2.*
+com.github.keenon.*
+com.github.keeperus.*
+com.github.keim-hs-esslingen.*
+com.github.keim-hs-esslingen.efs.*
+com.github.keim-hs-esslingen.spring.*
+com.github.keim-hs-esslingen.validazor.*
+com.github.keith-turner.*
+com.github.keithyokoma.*
+com.github.kejn.*
+com.github.kelebra.*
+com.github.kenCode-de.*
+com.github.kenbot.*
+com.github.kendaozinho.*
+com.github.kennedyoliveira.*
+com.github.kennethnickles.*
+com.github.kenny-tang.*
+com.github.kennycyb.*
+com.github.kentico.*
+com.github.kentyeh.*
+com.github.kenwdelong.*
+com.github.kepocnhh.*
+com.github.keqishou.*
+com.github.keran213539.*
+com.github.keraton.*
+com.github.kerner1000.*
+com.github.kernol-info.*
+com.github.kerzok.*
+com.github.ketan.*
+com.github.keub.*
+com.github.kevbradwick.*
+com.github.kevin-wang001.*
+com.github.kevinconaway.*
+com.github.kevinmmarlow.*
+com.github.kevinsamyn.sportmonks-soccer-api.*
+com.github.kevinsawicki.*
+com.github.kevinstern.*
+com.github.kevinstl.*
+com.github.kevinwl02.plasmaui.*
+com.github.keyboardDrummer.*
+com.github.keyhan.*
+com.github.kezong.*
+com.github.kfang.*
+com.github.kfcfans.*
+com.github.khaledroushdy.*
+com.github.khazrak.*
+com.github.khoalevan.*
+com.github.khoanguyen0791.*
+com.github.khud.*
+com.github.kiambogo.*
+com.github.kidinov.*
+com.github.kiditz.*
+com.github.kidsoncoffee.*
+com.github.kikeajani.*
+com.github.kikoso.*
+com.github.kikuomax.*
+com.github.kildievr.ws.securesocial.*
+com.github.kimffy24.*
+com.github.kims-developergroup.*
+com.github.king019.*
+com.github.kingamajick.admp.*
+com.github.kingchn.*
+com.github.kingsmentor.*
+com.github.kink80.*
+com.github.kinoamyfx.*
+com.github.kiprobinson.*
+com.github.kiran002.*
+com.github.kirich1409.*
+com.github.kirilldev.*
+com.github.kiris.*
+com.github.kirlionik.*
+com.github.kirviq.*
+com.github.kischang.*
+com.github.kishikawa-masateru.*
+com.github.kislayverma.*
+com.github.kislayverma.rulette.*
+com.github.kitefusion.*
+com.github.kitonus.cache.*
+com.github.kittinunf.cored.*
+com.github.kittinunf.forge.*
+com.github.kittinunf.fuel.*
+com.github.kittinunf.fuse.*
+com.github.kittinunf.result.*
+com.github.kixalt.*
+com.github.kjens93.*
+com.github.kjens93.actions.toolkit.*
+com.github.kkarad.*
+com.github.kkieffer.*
+com.github.kklisura.cdt.*
+com.github.kklisura.java.processing.*
+com.github.kkontus.stringhelper.*
+com.github.kkuegler.*
+com.github.kl3answer.*
+com.github.klangfarbe.*
+com.github.klasu.*
+com.github.klboke.*
+com.github.kleinerhacker.*
+com.github.klemek.*
+com.github.klieber.*
+com.github.kmate.*
+com.github.kmbulebu.dsc.*
+com.github.kmbulebu.nicknack.*
+com.github.kmehrunes.*
+com.github.kmekala.*
+com.github.kmenager.*
+com.github.kmeztapi.*
+com.github.kmizu.*
+com.github.kmood.*
+com.github.kmruiz.*
+com.github.knaufk.*
+com.github.knewhow.*
+com.github.knightliao.*
+com.github.knightliao.apollo.*
+com.github.knightliao.canalx.*
+com.github.knightliao.extend.*
+com.github.knightliao.hermesjsonrpc.*
+com.github.knightliao.middle.*
+com.github.knightliao.middle.bom.*
+com.github.knightliao.plugin.*
+com.github.knightliao.test.*
+com.github.knittl.*
+com.github.knoldus.*
+com.github.knot-noow.*
+com.github.kobusgrobler.*
+com.github.kochedykov.*
+com.github.kod4n.*
+com.github.koettlitz.*
+com.github.kogelabs.*
+com.github.kohanyirobert.*
+com.github.kohthecodemaster.*
+com.github.kokorin.*
+com.github.kokorin.jaffree.*
+com.github.kokorin.jdbunit.*
+com.github.kokorin.lombok.*
+com.github.kolema-tech.*
+com.github.koloo91.*
+com.github.kolotaev.*
+com.github.komcrad.snmp.*
+com.github.kompot.*
+com.github.kondaurovdev.*
+com.github.kondrakov.*
+com.github.kongchen.*
+com.github.kongchong.*
+com.github.kongpf8848.*
+com.github.konum.*
+com.github.koori69.*
+com.github.kopihao.*
+com.github.kopilov.rcallerservice.*
+com.github.kopilov.simplehttpclient.*
+com.github.koraktor.*
+com.github.korriganed.*
+com.github.korthout.*
+com.github.kospiotr.*
+com.github.kossy18.*
+com.github.kostasdrakonakis.*
+com.github.kotlin-kold.*
+com.github.kountSdk.*
+com.github.kovszilard.*
+com.github.kozlovzxc.*
+com.github.kpavlov.fixio.*
+com.github.kpavlov.jreactive8583.*
+com.github.kpavlov.maya.*
+com.github.kpavlov.mocks.statsd.*
+com.github.kperson.*
+com.github.krasa.*
+com.github.krazykira.*
+com.github.krdev.*
+com.github.krdev.checkstyle.*
+com.github.krdev.icapclient.*
+com.github.krdev.imapnio.*
+com.github.krdev.jettyresumablemultipart.*
+com.github.krdev.popclient.*
+com.github.krdev.sledclient.*
+com.github.kremliovskyi.*
+com.github.krenfro.*
+com.github.krever.*
+com.github.kripaliz.*
+com.github.krismorte.*
+com.github.kristianhelgesen.aramis.*
+com.github.kristiankime.*
+com.github.kristofa.*
+com.github.krokyze.*
+com.github.kronen.*
+com.github.krosenvold.*
+com.github.krraghavan.*
+com.github.krukow.*
+com.github.krupt.*
+com.github.krystalics.*
+com.github.krzemin.*
+com.github.krzysztofslusarski.*
+com.github.kschuetz.*
+com.github.kshashov.*
+com.github.ksoichiro.*
+com.github.ksprider.*
+com.github.ksszidane.*
+com.github.kstyrc.*
+com.github.ksuid.*
+com.github.ksyun-sdk.*
+com.github.ktakagaki.breeze.*
+com.github.ktarou.*
+com.github.kuaidaili.*
+com.github.kuaidi100-api.*
+com.github.kubatatami.*
+com.github.kubenext.*
+com.github.kubode.*
+com.github.kucera-jan-cz.esBench.*
+com.github.kugel-soft.*
+com.github.kuhn-he.*
+com.github.kuliginstepan.*
+com.github.kulik.*
+com.github.kuljaninemir.*
+com.github.kulya.*
+com.github.kumako.*
+com.github.kumarpankaj18.*
+com.github.kumarvikas1.*
+com.github.kunalk16.*
+com.github.kunkun26.*
+com.github.kurbatov.*
+com.github.kuros.*
+com.github.kurtloong.*
+com.github.kushsaini10.*
+com.github.kusti8.*
+com.github.kutzilla.*
+com.github.kuzya88.*
+com.github.kuzznya.*
+com.github.kvafy.*
+com.github.kvishalnie.*
+com.github.kw3r.*
+com.github.kwaiopen.*
+com.github.kwaisocial.*
+com.github.kwart.jd.*
+com.github.kwart.jsign.*
+com.github.kwart.kerberos.*
+com.github.kwart.ldap.*
+com.github.kwg0424.*
+com.github.kwhat.*
+com.github.kxbmap.*
+com.github.kyle-annen.*
+com.github.kyleroush.*
+com.github.kynthus.*
+com.github.kyo7701.*
+com.github.kypeli.*
+com.github.kyriosdata.*
+com.github.kyriosdata.adapter.*
+com.github.kyriosdata.cid10.*
+com.github.kyriosdata.fb.*
+com.github.kyriosdata.pack.*
+com.github.kyriosdata.parser.*
+com.github.kyriosdata.regras.*
+com.github.kyriosdata.saep.*
+com.github.kyriosdata.seed.*
+com.github.kyrotiko.*
+com.github.kysnm.*
+com.github.kyuubiran.*
+com.github.kywpcm.*
+com.github.kyzylsy.*
+com.github.kzwang.*
+com.github.l0n9h02n.*
+com.github.l3liang.*
+com.github.l42111996.*
+com.github.l423r.*
+com.github.l524l.*
+com.github.lab403.mapcontroller.*
+com.github.labai.*
+com.github.labai.utils.*
+com.github.labbolframework.*
+com.github.labbolframework.704tms.*
+com.github.labradorgithubcanine.*
+com.github.labri-progress.*
+com.github.laci009.*
+com.github.ladder2020.*
+com.github.ladderwinner.*
+com.github.ladutsko.*
+com.github.lafa.cache.*
+com.github.lafa.common.*
+com.github.lafa.ja3_4java.*
+com.github.lafa.jmetrics.*
+com.github.lafa.jsonpath.*
+com.github.lafa.logfast.*
+com.github.lafa.pdfbox.*
+com.github.lafa.popclient.*
+com.github.lafa.sledclient.*
+com.github.lafa.sparzr.*
+com.github.lafa.tagchowder.*
+com.github.lafa.tikaNoExternal.*
+com.github.lafa.twelvemonkeyspurejava.*
+com.github.lafa.twelvemonkeyspurejava.bom.*
+com.github.lafa.twelvemonkeyspurejava.common.*
+com.github.lafa.twelvemonkeyspurejava.contrib.*
+com.github.lafa.twelvemonkeyspurejava.imageio.*
+com.github.lafa.twelvemonkeyspurejava.servlet.*
+com.github.lahahana.*
+com.github.lailaik.*
+com.github.lajospolya.*
+com.github.lakelab.*
+com.github.lakrsv.*
+com.github.lalilou.*
+com.github.lalithsuresh.*
+com.github.lalyos.*
+com.github.lamba92.*
+com.github.lambdaexpression.*
+com.github.lambdasawa.*
+com.github.lambdatest.*
+com.github.lampaa.*
+com.github.lamydev.*
+com.github.lancearlaus.*
+com.github.lanchon.dexpatcher.*
+com.github.langhoangal.*
+com.github.langion.*
+com.github.langlan.*
+com.github.lanit-exp.*
+com.github.lanit-izh.*
+com.github.lansheng228.*
+com.github.lant.*
+com.github.laohuaishu.*
+com.github.laohyx.*
+com.github.lapesd.rdfit.*
+com.github.lapissea.*
+com.github.larrylgq.*
+com.github.lastexceed.*
+com.github.lastrix.*
+com.github.latency4j.*
+com.github.lauhwong.*
+com.github.laurencecao.*
+com.github.lawloretienne.*
+com.github.lazaronixon.*
+com.github.lazyBoyl.*
+com.github.lazyboyl.*
+com.github.lazynoon.*
+com.github.lbitonti.*
+com.github.lbordowitz.openforecast.*
+com.github.lbovolini.*
+com.github.lbovolini.crowd.*
+com.github.lbownik.*
+com.github.lbqds.*
+com.github.lbroudoux.elasticsearch.*
+com.github.lburgazzoli.*
+com.github.lchli.*
+com.github.ldaniels528.*
+com.github.ldapchai.*
+com.github.ldeitos.*
+com.github.ldeluigi.*
+com.github.ldriscoll.*
+com.github.ldzzdl.*
+com.github.leachbj.*
+com.github.leandroborgesferreira.*
+com.github.leanframeworks.*
+com.github.leanjaxrs.*
+com.github.lecho.*
+com.github.lecogiteur.*
+com.github.ledio5485.*
+com.github.ledsoft.*
+com.github.ledwinson.*
+com.github.leejay.customgridlayout.*
+com.github.leeonky.*
+com.github.leeyazhou.*
+com.github.leeyazhou.chilkat.*
+com.github.lehphyro.branch-maven-plugin.*
+com.github.lehphyro.fastbuilder.*
+com.github.lehphyro.money.*
+com.github.leigh-perry.*
+com.github.leixuan6.*
+com.github.lejeanbono.*
+com.github.lekaha.*
+com.github.lekhana3003.*
+com.github.lekmiti.*
+com.github.leleuj.play.*
+com.github.leleuj.springframework.security.*
+com.github.lemfi.kest.*
+com.github.lemonboston.*
+com.github.leo-1994.*
+com.github.leobel.*
+com.github.leofalco.*
+com.github.leogitpub.*
+com.github.leonardo-couto.*
+com.github.leonardoxh.*
+com.github.leonidesfernando.*
+com.github.leopard2a5.*
+com.github.leoromanovsky.*
+com.github.leozhang123.*
+com.github.lero4ka16.*
+com.github.lesbroot.*
+com.github.lespaul361.*
+com.github.leuras.*
+com.github.levants.*
+com.github.levkhomich.*
+com.github.levkoposc.*
+com.github.levry.*
+com.github.levyfan.*
+com.github.lewis-od.*
+com.github.lewissk.*
+com.github.lewka.*
+com.github.lexshcherbinin.*
+com.github.lfantinel.*
+com.github.lftao.*
+com.github.lgdd.*
+com.github.lgermani.*
+com.github.lgigek.*
+com.github.lgooddatepicker.*
+com.github.lgsxiaosen.*
+com.github.lhanson.*
+com.github.lhnonline.*
+com.github.lhotari.*
+com.github.li-yaobing.*
+com.github.liamhayes1.*
+com.github.liancheng.*
+com.github.liangbaika.*
+com.github.liangyuanpeng.*
+com.github.lianjiatech.*
+com.github.liaochong.*
+com.github.liaoheng.*
+com.github.liaomengge.*
+com.github.liaopen123.*
+com.github.libgraviton.*
+com.github.libinterval.*
+com.github.librepdf.*
+com.github.librudder.*
+com.github.libsgh.*
+com.github.licanhua.test.*
+com.github.lichuanzhi7909.*
+com.github.life-lab.*
+com.github.life-labs.leisure.*
+com.github.lifus.*
+com.github.light-flame.*
+com.github.lightbatis.*
+com.github.lightdocs.*
+com.github.lightsaway.*
+com.github.lihang1991.*
+com.github.lihang212010.*
+com.github.lihengming.*
+com.github.lijian-1218.*
+com.github.lijian69.*
+com.github.lijuncai.*
+com.github.likavn.*
+com.github.likeabook.*
+com.github.lilyhu2014.*
+com.github.limansky.*
+com.github.limeng32.*
+com.github.limiaogithub.*
+com.github.liming495.*
+com.github.lindenb.*
+com.github.lindseyzhang.*
+com.github.lingcoder.*
+com.github.linjonh.*
+com.github.link-kou.*
+com.github.linkeer8802.*
+com.github.linkenli.*
+com.github.linlinisme.*
+com.github.linmcqq.*
+com.github.linpn.*
+com.github.linshenkx.*
+com.github.linsolas.*
+com.github.linushp.*
+com.github.linyuzai.*
+com.github.lionelfleury.*
+com.github.lipengxs.jcsv.*
+com.github.lipinskipawel.*
+com.github.liqyu.*
+com.github.lisdocument.*
+com.github.lishengguo.*
+com.github.lishuang11.*
+com.github.lisicnu.*
+com.github.listennatural.*
+com.github.lite2073.*
+com.github.litekite.*
+com.github.litpho.*
+com.github.littlejin.*
+com.github.littlenewbie.*
+com.github.liuaixi200.*
+com.github.liuanxin.*
+com.github.liubin9999.*
+com.github.liubingxu18.*
+com.github.liuche51.*
+com.github.liuchengts.*
+com.github.liuchink.chinkutils.*
+com.github.liuchink.hcutils.*
+com.github.liudaomanbu.*
+com.github.liudechi7.*
+com.github.liuguangqiang.*
+com.github.liuguangqiang.MaterialDialog.*
+com.github.liuguangqiang.MultiLayout.*
+com.github.liuguangqiang.SuperRecyclerView.*
+com.github.liuguangqiang.aframework.*
+com.github.liuguangqiang.asyncokhttp.*
+com.github.liuguangqiang.bowevent.*
+com.github.liuguangqiang.materialdialog.*
+com.github.liuguangqiang.mvp.*
+com.github.liuguangqiang.permissionhelper.*
+com.github.liuguangqiang.prettyprogressbar.*
+com.github.liuguangqiang.support.*
+com.github.liuguangqiang.swipeback.*
+com.github.liuguangqiang.turnlayout.*
+com.github.liuhuagui.*
+com.github.liujiebang.*
+com.github.liukaitydn.*
+com.github.liulus.*
+com.github.liuping123.commadapter.*
+com.github.liuping123.json_examiner.*
+com.github.liusheng.*
+com.github.liushuaiq.*
+com.github.liuweijw.library.*
+com.github.liuwww.*
+com.github.liuxiaoli007.*
+com.github.liuxuebinu.*
+com.github.liuxun666.*
+com.github.liuyangSunny.good.tool.*
+com.github.liuyehcf.*
+com.github.liuyueyi.*
+com.github.liuyueyi.media.*
+com.github.liuyuyu.*
+com.github.liuzhenghui.*
+com.github.liuzhengyang.*
+com.github.liuzhongkai.*
+com.github.liuzhuoming23.*
+com.github.livesense.*
+com.github.lixhbs.*
+com.github.lixiang2114.*
+com.github.liyang0211.*
+com.github.liyanpro.*
+com.github.liyiorg.*
+com.github.liyuan3210.*
+com.github.lizardev.*
+com.github.lizeze.*
+com.github.lizhiwei88.*
+com.github.lizhongyuan3.*
+com.github.lizhuogui.android.*
+com.github.lizixiang.*
+com.github.ljbo82.*
+com.github.ljhan2.*
+com.github.ljinlin.*
+com.github.ljishen.*
+com.github.ljtfreitas.*
+com.github.ljtfreitas.julian-http-client.*
+com.github.ljun20160606.*
+com.github.ljx95.*
+com.github.lkalwa.*
+com.github.lkasdolka.*
+com.github.lkkushan101.ChromeDevTools.*
+com.github.lkkushan101.JavaErrorReporting.*
+com.github.lkkushan101.PDFLogger.*
+com.github.lkkushan101.PDFVerify.*
+com.github.lkkushan101.RestAssuredPDFReport.*
+com.github.lkkushan101.accessilenium.*
+com.github.lkkushan101.appiumlocator.*
+com.github.lkkushan101.appiumscreengrab.*
+com.github.lkkushan101.jalenium.*
+com.github.lkkushan101.testngPDF.*
+com.github.lkmc2.*
+com.github.lkoskela.*
+com.github.lkoskela.jsptest.*
+com.github.lkq.*
+com.github.lkqm.*
+com.github.lkumarjain.*
+com.github.lltyk.*
+com.github.lly835.*
+com.github.llyb120.*
+com.github.lmen.*
+com.github.lmm1990.*
+com.github.lmm1990.fast.mvc.*
+com.github.lmnet.*
+com.github.lmslone.*
+com.github.ln-12.*
+com.github.lnaranjo3.*
+com.github.loadingbg.*
+com.github.lodsve.*
+com.github.log0ymxm.*
+com.github.log4jdbc-forjdbi.*
+com.github.logafine.*
+com.github.loganathan001.*
+com.github.loggly.log4jSyslogWriter64k.*
+com.github.loicoudot.java4cpp.*
+com.github.loki-afro.*
+com.github.loki4j.*
+com.github.lokic.*
+com.github.lolgab.*
+com.github.lolobosse.contactsautocompletetextview.*
+com.github.lonely-lockley.*
+com.github.longdt.*
+com.github.longhaoteng.*
+com.github.longhuihu.*
+com.github.longstone.*
+com.github.lonnyj.*
+com.github.lontime.*
+com.github.lookfirst.*
+com.github.lord-of-code.*
+com.github.lordcrekit.*
+com.github.lordrex34.config.*
+com.github.lordrex34.reflection.*
+com.github.loren-wang.*
+com.github.losersclub.*
+com.github.losizm.*
+com.github.lostsky3000.*
+com.github.lotsabackscatter.*
+com.github.lotty520.mango.*
+com.github.loudywen.*
+com.github.louis-forite.*
+com.github.louism33.*
+com.github.loverto.*
+com.github.lowzj.*
+com.github.loyada.dollarx.*
+com.github.lp3799.*
+com.github.lpandzic.*
+com.github.lpandzic.chameleon.*
+com.github.lpezet.*
+com.github.lpezet.antiope.*
+com.github.lpezet.java.*
+com.github.lprc.*
+com.github.lqccan.*
+com.github.lquiroli.*
+com.github.lrkwz.*
+com.github.ls9527.*
+com.github.lsgro.*
+com.github.lsiu.maven.plugins.*
+com.github.lsqlebai.*
+com.github.lstephen.*
+com.github.lsund.*
+com.github.ltassoneVisua.*
+com.github.ltsopensource.*
+com.github.luanhaipeng.*
+com.github.luanqiu.*
+com.github.luben.*
+com.github.lucadruda.*
+com.github.lucapino.*
+com.github.lucarosellini.*
+com.github.lucarosellini.alexa.*
+com.github.lucarosellini.rJava.*
+com.github.lucasfsousa.*
+com.github.lucasls.kotlinx.wiremock.*
+com.github.lucasrest.*
+com.github.lucassaldanha.*
+com.github.luccappellaro.*
+com.github.lucene-gosen.*
+com.github.luckamuu.*
+com.github.luckyberg.*
+com.github.ludoviccarretti.*
+com.github.lufengwen.*
+com.github.luffytalory.*
+com.github.luhuec.*
+com.github.luismanuelamengual.*
+com.github.luispereira.*
+com.github.lujiannt.*
+com.github.lujinfeifly.*
+com.github.lukajcb.*
+com.github.lukaspili.*
+com.github.lukaspili.autodagger2.*
+com.github.lukaspili.automortar.*
+com.github.lukaspili.mortar-architect.*
+com.github.lukaspili.processor-workflow.*
+com.github.lukaspili.reactive-billing.*
+com.github.lukaszbudnik.cloudtag.*
+com.github.lukaszbudnik.gugis.*
+com.github.lukaszbudnik.guice-properties-el.*
+com.github.lukaszbudnik.jelvis.*
+com.github.lukaszbudnik.metrics-cloudwatch.*
+com.github.lukedeighton.*
+com.github.lukethompsxn.*
+com.github.lukeu.*
+com.github.lukfor.*
+com.github.luks91.*
+com.github.lumpchen.*
+com.github.luning-l.*
+com.github.luohaha.*
+com.github.luomingxuorg.*
+com.github.luoshu-open.*
+com.github.luqmansahaf.*
+com.github.lusoalex.*
+com.github.luterc.*
+com.github.luues.*
+com.github.luues.boot.*
+com.github.luues.cloud.*
+com.github.luues.tool.*
+com.github.luxlang.*
+com.github.lvabarajithan.*
+com.github.lvcn.*
+com.github.lvyanyang.*
+com.github.lwaddicor.*
+com.github.lwfwind.automation.*
+com.github.lwfwind.common.*
+com.github.lwfwind.web.*
+com.github.lwhite1.*
+com.github.lxchinesszz.*
+com.github.lxr1827991.*
+com.github.lyang.*
+com.github.lyeung.*
+com.github.lyhnx.*
+com.github.lyjaeho.*
+com.github.lynchmaniac.*
+com.github.lynnyuan-arch.*
+com.github.lynxcat.*
+com.github.lynzabo.*
+com.github.lynzabo.codegen.*
+com.github.lyr-2000.*
+com.github.lyuze.*
+com.github.lzaruba.*
+com.github.lzj960515.*
+com.github.lzm320a99981e.*
+com.github.lzyzsd.*
+com.github.m-ga.*
+com.github.m-razavi.*
+com.github.m0uj.*
+com.github.m451.*
+com.github.m4schini.*
+com.github.m50d.*
+com.github.maasdi.*
+com.github.maccamlc.*
+com.github.macchinetta.blank.*
+com.github.macdao.*
+com.github.macgregor.*
+com.github.machaval.*
+com.github.machinarius.*
+com.github.maciejmalewicz.*
+com.github.madgnome.*
+com.github.madprogger.*
+com.github.madprogger.metamodel.*
+com.github.madrapps.*
+com.github.magese.*
+com.github.magicae.*
+com.github.magpiebridge.*
+com.github.magrifle.*
+com.github.magrossi.*
+com.github.mahendragohel.*
+com.github.mahjong4j.*
+com.github.mahnkong.*
+com.github.maiflai.*
+com.github.maikoncanuto.*
+com.github.maikwolf.*
+com.github.maimart.*
+com.github.maimas.*
+com.github.majiweihappy.*
+com.github.makeitfine-org.*
+com.github.maketubo.*
+com.github.makewheels.*
+com.github.makintsian.*
+com.github.malamut2.*
+com.github.malathi8190.*
+com.github.malbari.*
+com.github.malkomich.*
+com.github.malliina.*
+com.github.maltalex.*
+com.github.mamadou-diallo.*
+com.github.mambabosso.*
+com.github.mamorum.*
+com.github.mandriana.*
+com.github.mangatmodi.*
+com.github.mangelion.*
+com.github.mangstadt.*
+com.github.manikmagar.*
+com.github.manishahluwalia.*
+com.github.manishahluwalia.gwt.*
+com.github.manjotsidhu.*
+com.github.manjunathprabhakar.*
+com.github.manjusaka28.tools.*
+com.github.manliogit.*
+com.github.manodj-sfdc.*
+com.github.manolo.*
+com.github.manosbatsis.corbeans.*
+com.github.manosbatsis.corda.leanstate.*
+com.github.manosbatsis.corda.restate.*
+com.github.manosbatsis.corda.rpc.poolboy.*
+com.github.manosbatsis.corda.statemeant.*
+com.github.manosbatsis.corda.testacles.*
+com.github.manosbatsis.corda5.testutils.*
+com.github.manosbatsis.kmm.converters.*
+com.github.manosbatsis.kmp.converters.*
+com.github.manosbatsis.kotlin-utils.*
+com.github.manosbatsis.kotlinpoet-utils.*
+com.github.manosbatsis.partiture.*
+com.github.manosbatsis.scrudbeans.*
+com.github.manosbatsis.vaultaire.*
+com.github.manouti.*
+com.github.manuelpeinado.fadingactionbar-native.*
+com.github.manuelpeinado.fadingactionbar.*
+com.github.manuelpeinado.glassactionbar.*
+com.github.manuelpeinado.imagelayout.*
+com.github.manuelpeinado.multichoiceadapter.*
+com.github.manuelpeinado.numericpageindicator.*
+com.github.manuelpeinado.refreshactionitem-native.*
+com.github.manuelpeinado.refreshactionitem.*
+com.github.manzhda.*
+com.github.maofangyun.*
+com.github.maojx0630.*
+com.github.maoo.indexer.*
+com.github.mapkiwiz.*
+com.github.mapkiwiz.routing.*
+com.github.marandus.*
+com.github.mararun.*
+com.github.marc-christian-schulze.structs4java.*
+com.github.marc7806.*
+com.github.marcellodesales.*
+com.github.marceloemanoel.*
+com.github.marcelop3251.*
+com.github.marcelosmith77.*
+com.github.marceloverdijk.*
+com.github.marchenkoprojects.*
+com.github.marcherdiego.mvp.*
+com.github.marcherdiego.swipecompare.*
+com.github.marcinzh.*
+com.github.marcioos.*
+com.github.marco-schmidt.*
+com.github.marcobjorge.*
+com.github.marcobjorge.anytime.*
+com.github.marcoblos.*
+com.github.marcodama7.*
+com.github.marcodama7.posty.*
+com.github.marcodama7.tactilelayouts.*
+com.github.marcoferrer.krotoplus.*
+com.github.marcomanzi.*
+com.github.marcoral.versatia.*
+com.github.marcosemiao.*
+com.github.marcosemiao.lang.jarnativeloader.*
+com.github.marcosemiao.log4jdbc.*
+com.github.marcosemiao.log4jdbc.core.*
+com.github.marcosemiao.log4jdbc.logger.*
+com.github.marcosemiao.log4jdbc.modules.*
+com.github.marcosemiao.log4jdbc.modules.logger.*
+com.github.marcosemiao.log4jdbc.modules.logger.file.*
+com.github.marcosemiao.log4jdbc.modules.rdbms.*
+com.github.marcosemiao.log4jdbc.package.*
+com.github.marcosemiao.log4jdbc.rdbms.*
+com.github.marcosemiao.maven.plugin.logger.*
+com.github.marcosemiao.maven.plugins.*
+com.github.marcosemiao.maven.plugins.shade.resource.*
+com.github.marcosemiao.maven.shade.*
+com.github.marcosemiao.openjpa.db2.rownumber.*
+com.github.marcosemiao.tomcat.listener.*
+com.github.marcosemiao.tomcat.maven.plugin.*
+com.github.marcosemiao.util.*
+com.github.marcoshsc.*
+com.github.marcospereira.*
+com.github.marcpoppleton.*
+com.github.marcus-nl.*
+com.github.marcus-nl.btm.*
+com.github.maria4j.*
+com.github.marianobarrios.*
+com.github.maricn.*
+com.github.marijangazica.*
+com.github.marinmit.marineslider.*
+com.github.marino-serna.*
+com.github.mariusfeteanu.*
+com.github.mariusfilip.*
+com.github.mariusgreve.timing-utils.*
+com.github.markash.*
+com.github.marketsquare.*
+com.github.marklister.*
+com.github.markomilos.*
+com.github.markozajc.*
+com.github.marks-yag.*
+com.github.markserrano.*
+com.github.markusbernhardt.*
+com.github.markusf.*
+com.github.markushi.*
+com.github.markusmo3.urm.*
+com.github.markymarkmcdonald.*
+com.github.markzhai.*
+com.github.marlonlom.*
+com.github.marocraft.trackntrace.*
+com.github.mars05.*
+com.github.marsbits.restfbmessenger.*
+com.github.marschall.*
+com.github.martarodriguezm.*
+com.github.martin-g.*
+com.github.martincooper.*
+com.github.martinei.*
+com.github.martinfrancois.*
+com.github.martinfrank.*
+com.github.martinhaeusler.*
+com.github.martinjedwabny.*
+com.github.martinkoster.*
+com.github.martinpaljak.*
+com.github.martinpg2001.*
+com.github.martinprause.cytoscape.*
+com.github.martinq108.*
+com.github.martins1930.gradle.*
+com.github.martinstuga.*
+com.github.martinwithaar.*
+com.github.marty912.jahia.tools.*
+com.github.marvin-ai.*
+com.github.masahitojp.*
+com.github.masiuchi.*
+com.github.maskwerewolf.*
+com.github.masonm.*
+com.github.masonm.wiremock.*
+com.github.masontool.*
+com.github.massamany.*
+com.github.massie.*
+com.github.master.*
+com.github.mastery001.*
+com.github.mastinno.*
+com.github.matejtymes.*
+com.github.matek2305.*
+com.github.materna-se.*
+com.github.materna-se.fegen.*
+com.github.mateuszjanczak.*
+com.github.matheusesoft.*
+com.github.matheusviegas.*
+com.github.mathianasj.*
+com.github.mathiasritter.*
+com.github.mathieudebrito.*
+com.github.mathieupaillart.*
+com.github.mathiewz.*
+com.github.mathiewz.slick.*
+com.github.matiasromar.*
+com.github.matinh.vdldoc.*
+com.github.matrixseven.*
+com.github.matsluni.*
+com.github.matthew123cl.*
+com.github.matthewbeasley.*
+com.github.matthewbretten.*
+com.github.matthewyork.*
+com.github.matthiasrobbers.*
+com.github.matthiasrobbers.shortbread.*
+com.github.mattyoliveira.*
+com.github.mattzhongchang.*
+com.github.maumay.*
+com.github.mauricio.*
+com.github.mauricioaniche.*
+com.github.mauro-midolo.*
+com.github.mautini.*
+com.github.maven-hadoop.plugin.*
+com.github.maven-integration-test-helper.*
+com.github.maven-nar.*
+com.github.mavenhaus.*
+com.github.mavenplugins.*
+com.github.mavenplugins.maven-doctest-plugin.*
+com.github.mavogel.*
+com.github.mavolin.*
+com.github.mawillers.*
+com.github.mawippel.*
+com.github.max-leuthaeuser.*
+com.github.maxbraun.*
+com.github.maxbraun.maven.*
+com.github.maxbraun.test.*
+com.github.maxfichtelmann.*
+com.github.maximan3000.*
+com.github.maximejallu.*
+com.github.maximevw.*
+com.github.maximilientyc.*
+com.github.maximjev.*
+com.github.maxkazantsev.*
+com.github.maxpsq.*
+com.github.maxsherry.retrofit2.*
+com.github.maxxedev.*
+com.github.maxxkrakoa.lineman-maven-plugin.*
+com.github.mayank31313.*
+com.github.maybeec.*
+com.github.mayconbordin.*
+com.github.mayconmfl.*
+com.github.mayflower.*
+com.github.mayoi7.*
+com.github.mayp1998.taskExecutor.*
+com.github.maytech.*
+com.github.mayurkaul.*
+com.github.mazenmelouk.*
+com.github.mazine.*
+com.github.mbeier1406.*
+com.github.mbelling.*
+com.github.mbenson.*
+com.github.mbenson.cotterpin.*
+com.github.mbenson.therian.*
+com.github.mbiamont.*
+com.github.mbieniek.facebookimagepicker.*
+com.github.mbn217.*
+com.github.mboogerd.*
+com.github.mbuzdalov.*
+com.github.mcac0006.*
+com.github.mcheely.*
+com.github.mchernyakov.*
+com.github.mckernant1.*
+com.github.mcollovati.*
+com.github.mcollovati.vertx.*
+com.github.mcpat.apistubs.*
+com.github.mcpat.gcf.*
+com.github.mcpat.libxjava.*
+com.github.mcpat.slf4j.*
+com.github.mdennis10.*
+com.github.mdislam.customfont.*
+com.github.mdr.*
+com.github.mdre.*
+com.github.mdsdanny.*
+com.github.mdsina.*
+com.github.mdzhb.*
+com.github.meanbeanlib.*
+com.github.meandor.*
+com.github.meazza.*
+com.github.medyo.*
+com.github.meetamastani1.*
+com.github.meetsl.netbus.*
+com.github.meetupjavasaopaulo.*
+com.github.mega13d.*
+com.github.megafonweblab.histone.*
+com.github.megallo.*
+com.github.megathrone.*
+com.github.megatronking.*
+com.github.megatronking.stringfog.*
+com.github.mehmetakiftutuncu.*
+com.github.meirfaraj.*
+com.github.meisolsson.*
+com.github.meituan-dianping.lyrebird.sdk.*
+com.github.meixuesong.*
+com.github.meizupush.*
+com.github.mekuanent.*
+com.github.meldsza.*
+com.github.melin.*
+com.github.melowe.*
+com.github.melrief.*
+com.github.meltedspark.*
+com.github.memorylorry.*
+com.github.menacher.*
+com.github.mendela1992.*
+com.github.menger-duan.*
+com.github.mengjincn.*
+com.github.menglim.*
+com.github.mengshijian.*
+com.github.mengweijin.*
+com.github.mengxianun.*
+com.github.mengzuozhu.*
+com.github.meowingtwurtle.*
+com.github.mercurievv.*
+com.github.mercurydb.*
+com.github.merlinyu.*
+com.github.mert-z.*
+com.github.mertakdut.*
+com.github.mervick.*
+com.github.merylliu.*
+com.github.mesharel.*
+com.github.messenger4j.*
+com.github.metadave.*
+com.github.metair.jersey.*
+com.github.metalloid-project.*
+com.github.meteoorkip.*
+com.github.methylene.*
+com.github.mezereonxp.*
+com.github.mfaisalkhatri.*
+com.github.mfarsikov.*
+com.github.mfathi91.*
+com.github.mfatihercik.*
+com.github.mfoody.*
+com.github.mfornos.*
+com.github.mfpdev.*
+com.github.mfrtrifork.humio-android-logger.*
+com.github.mg0324.*
+com.github.mg365.*
+com.github.mgabor11.*
+com.github.mgeiss.*
+com.github.mguidi.asyncop.*
+com.github.mgunlogson.*
+com.github.mhariri.*
+com.github.mheath.*
+com.github.mhendred.face4j.*
+com.github.mhewedy.*
+com.github.mhiew.*
+com.github.mhoffrog.*
+com.github.mhoffrog.attached.*
+com.github.mhoffrog.io.onedev.*
+com.github.mhoffrog.jna.*
+com.github.mhshams.*
+com.github.mht-xyt.*
+com.github.miachm.sods.*
+com.github.miamish.*
+com.github.miaozongpei.*
+com.github.mibo.*
+com.github.mibrahim.*
+com.github.michael-rapp.*
+com.github.michaelahlers.*
+com.github.michaeldoyle.*
+com.github.michaelgantman.*
+com.github.michaelpisula.*
+com.github.michaelruocco.*
+com.github.michaelruocco.idv.*
+com.github.michaelruocco.mysql.*
+com.github.michaelruocco.service.*
+com.github.michaelruocco.servicetemplate.*
+com.github.michaelye.easydialog.*
+com.github.michaldrabik.*
+com.github.micheal-swiggs.*
+com.github.michedev.*
+com.github.michelzanini.*
+com.github.mickleroy.*
+com.github.microcmpt.*
+com.github.micromix.*
+com.github.microon.*
+com.github.microsofia.*
+com.github.microsoft.*
+com.github.microsoft.telemetry-client-for-android.*
+com.github.microtweak.*
+com.github.microwww.*
+com.github.mictaege.*
+com.github.middle-out.*
+com.github.mideo.*
+com.github.miemiedev.*
+com.github.mifmif.*
+com.github.migangqui.*
+com.github.migellal.*
+com.github.migger.*
+com.github.mighty-tech.*
+com.github.migralito.*
+com.github.migueljteixeira.*
+com.github.mihaibogdaneugen.redisrepository.*
+com.github.mihaicostin.*
+com.github.mihajul.*
+com.github.mihone.*
+com.github.mikaelv.*
+com.github.mikaelzero.*
+com.github.mikaelzero.flugin.*
+com.github.mike10004.*
+com.github.mikeldpl.*
+com.github.mikeldpl.lambda.runtime.*
+com.github.mikeliyes.*
+com.github.mikeliyes.mongobatis.*
+com.github.mikeqian.*
+com.github.mikereem.*
+com.github.mikesafonov.*
+com.github.mikesena.maven.plugins.*
+com.github.mikesena.maven.shared.*
+com.github.mikkoi.maven.enforcer.rule.*
+com.github.mikrop.*
+com.github.mikuu.*
+com.github.miladheydari.*
+com.github.miles-hu.*
+com.github.milis92.krang.*
+com.github.milos01.*
+com.github.mimdal.*
+com.github.mina-asham.*
+com.github.mineex.*
+com.github.mineot.*
+com.github.mingchuno.*
+com.github.minglie.*
+com.github.minhlong293.*
+com.github.minhnguyen31093.*
+com.github.minigdx.*
+com.github.minlingchao1.*
+com.github.minordima.*
+com.github.minxinjituan.*
+com.github.mirreck.*
+com.github.mirrorSystem.*
+com.github.misberner.ap-commons.*
+com.github.misberner.buildergen.*
+com.github.misberner.duzzt.*
+com.github.misberner.graphviz-awt-shapes.*
+com.github.misberner.scalamacros.*
+com.github.misev.*
+com.github.misterchangray.mybatis.generator.plugins.*
+com.github.misterreg.mavenplugins.*
+com.github.mistertea.*
+com.github.mitallast.*
+com.github.mitchwongho.gradle.*
+com.github.mitonize.*
+com.github.miwurster.*
+com.github.mixja.*
+com.github.miyakawasaki.jcifsng.*
+com.github.mizool.*
+com.github.mizool.cloudformation.*
+com.github.mizool.jcache.*
+com.github.mizool.jediscache.*
+com.github.mizool.tableaccess.*
+com.github.mizool.tableaccess.store.*
+com.github.mizool.technology.*
+com.github.mizool.technology.table-access.*
+com.github.mizool.technology.table-access.store.*
+com.github.mizool.technology.typemapping.*
+com.github.mizool.technology.typemapping.store.*
+com.github.mizool.tool.*
+com.github.mizool.typemapping.*
+com.github.mizool.typemapping.store.*
+com.github.mizosoft.methanol.*
+com.github.mjakubowski84.*
+com.github.mjd507.*
+com.github.mjdbc.*
+com.github.mjdev.*
+com.github.mjeanroy.*
+com.github.mjreid.*
+com.github.mkgoingup.*
+com.github.mkhytarmkhoian.*
+com.github.mkluas.*
+com.github.mkolisnyk.*
+com.github.mkopylec.*
+com.github.mkorman9.*
+com.github.mkorman9.districron.*
+com.github.mkrevuelta.*
+com.github.mkroli.*
+com.github.mkspcd.*
+com.github.mkyrychenko.*
+com.github.mlaccetti.*
+com.github.mlangc.*
+com.github.mliarakos.lagomjs.*
+com.github.mlk.*
+com.github.mmarquee.*
+com.github.mmauro94.*
+com.github.mmazi.*
+com.github.mmichaelis.*
+com.github.mmielimonka.*
+com.github.mmizutani.*
+com.github.mmuller88.*
+com.github.mnadeem.*
+com.github.mnogu.*
+com.github.mnteam.*
+com.github.moaxcp.*
+com.github.moaxcp.escher.*
+com.github.moaxcp.gifbuilder.*
+com.github.moaxcp.graphs.*
+com.github.moaxcp.x11.*
+com.github.mob41.blapi.*
+com.github.mobeho.*
+com.github.moc-yuto.*
+com.github.moceanapi.*
+com.github.modouxiansheng.*
+com.github.moduth.*
+com.github.mogikanen9.maven.plugins.*
+com.github.mohd-bh.*
+com.github.mohitgoyal91.*
+com.github.mohitsoni.*
+com.github.mohrazzr.*
+com.github.mojeskamlapure.*
+com.github.mokka88.*
+com.github.molcikas.*
+com.github.molecule-labs.*
+com.github.moleksyuk.*
+com.github.monarch-initiative.*
+com.github.monchynr.spike.*
+com.github.monee1988.*
+com.github.mongobee.*
+com.github.mongoutils.*
+com.github.monjo.*
+com.github.monkeysintown.*
+com.github.monkeywie.*
+com.github.monnetproject.*
+com.github.monosoul.*
+com.github.monxalo.*
+com.github.moomoon.*
+com.github.moon-util.*
+com.github.moondroid.colormixer.*
+com.github.moondroid.coverflow.*
+com.github.moos-ivp.*
+com.github.moraisigor.*
+com.github.morgen-peschke.*
+com.github.morinb.*
+com.github.morinb.kotlin.*
+com.github.morinb.maven.*
+com.github.moronicgeek.*
+com.github.moronicgeek.swagger.*
+com.github.morteza-j8.*
+com.github.mortonl.*
+com.github.morulay.*
+com.github.mottox.*
+com.github.mouse0w0.*
+com.github.movabletype.*
+com.github.movilepay.*
+com.github.mowedgrass.*
+com.github.moxy-community.*
+com.github.mozhumz.*
+com.github.mozilla.*
+com.github.mozvip.*
+com.github.mpashka.spring.*
+com.github.mpe85.*
+com.github.mperry.*
+com.github.mperry.frege.*
+com.github.mpetruska.*
+com.github.mpilquist.*
+com.github.mpinardi.*
+com.github.mpkorstanje.*
+com.github.mpolla.*
+com.github.mprops.*
+com.github.mpusher.*
+com.github.mr5.*
+com.github.mr746866.*
+com.github.mrLawrenc.*
+com.github.mrbean355.*
+com.github.mrcdnk.*
+com.github.mrcjkb.*
+com.github.mrcritical.*
+com.github.mrdimosthenis.*
+com.github.mredjem.*
+com.github.mrengineer13.*
+com.github.mrenou.*
+com.github.mreutegg.*
+com.github.mrfrag.*
+com.github.mrgzhen.*
+com.github.mrharibo.micronet.*
+com.github.mristuccia.*
+com.github.mrivanplays.*
+com.github.mrkenitvnn.*
+com.github.mrmechko.*
+com.github.mrmike.*
+com.github.mrniko.*
+com.github.mrpangu.*
+com.github.mrpowers.*
+com.github.mrstampy.*
+com.github.mrvilkaman.*
+com.github.mryan43.*
+com.github.mryang-jia.*
+com.github.mryf323.*
+com.github.mryingjie.*
+com.github.mryurihi.*
+com.github.mrzhqiang.helper.*
+com.github.mrzhqiang.helper.database.*
+com.github.mrzhqiang.helper.sample.*
+com.github.ms5984.api.*
+com.github.ms5984.clans.*
+com.github.ms5984.learnspigotsmp.*
+com.github.ms5984.lib.*
+com.github.msarhan.*
+com.github.mschaeuble.*
+com.github.mscking.*
+com.github.msemys.*
+com.github.mshockwave.*
+com.github.msievers.*
+com.github.msimw.*
+com.github.mskimm.*
+com.github.mslimani.*
+com.github.msnijder30.*
+com.github.msoliter.*
+com.github.msr5464.*
+com.github.mstarodubtsev.dropwizard.*
+com.github.msteinbeck.*
+com.github.mstream-trader.*
+com.github.mswolfe.*
+com.github.mta452.*
+com.github.mtakaki.*
+com.github.mtcloud.*
+com.github.mthizo247.*
+com.github.mttkay.memento.*
+com.github.mub.*
+com.github.mucaho.*
+com.github.mufanh.*
+com.github.muff1nman.chameleon.*
+com.github.muirandy.*
+com.github.mujave.*
+com.github.mujun0312.*
+com.github.multiworldtesting.*
+com.github.mumoshu.*
+com.github.munerf.modelmapper-spring-boot-starter.*
+com.github.munozy.*
+com.github.muratkaragozgil.*
+com.github.mureinik.*
+com.github.museadmin.*
+com.github.music-of-the-ainur.*
+com.github.mustafa01ali.*
+com.github.mustafabayar.*
+com.github.mustfun.*
+com.github.mutcianm.*
+com.github.muthushenll.*
+com.github.muuknl.*
+com.github.muyu8890.*
+com.github.mvallim.*
+com.github.mvh77.*
+com.github.mvp4g.*
+com.github.mvv.routineer.*
+com.github.mvv.sager.*
+com.github.mvv.sash.*
+com.github.mvv.sredded.*
+com.github.mvv.typine.*
+com.github.mvv.zilog.*
+com.github.mvysny.dirutils.*
+com.github.mvysny.dynatest.*
+com.github.mvysny.karibu-migration.*
+com.github.mvysny.karibu-tools.*
+com.github.mvysny.karibudsl.*
+com.github.mvysny.kaributesting.*
+com.github.mvysny.kotlin-unsigned-jvm.*
+com.github.mvysny.shepherd.*
+com.github.mvysny.sucklessprofiler.*
+com.github.mvysny.vaadin-boot.*
+com.github.mvysny.vaadin-groovy-builder.*
+com.github.mvysny.vaadin-jandex.*
+com.github.mvysny.vaadin-simple-security.*
+com.github.mvysny.vokdataloader.*
+com.github.mvysny.vokorm.*
+com.github.mwarc.*
+com.github.mwegrz.*
+com.github.mwiede.*
+com.github.mwiede.dockerjava.*
+com.github.mwmahlberg.sparkjava.*
+com.github.mwmahlberg.speedy.*
+com.github.mx-go.*
+com.github.mxab.thymeleaf.extras.*
+com.github.mxsm.*
+com.github.myBingk.*
+com.github.myabcc17.*
+com.github.mydq.*
+com.github.myedibleenso.*
+com.github.mygodness100.*
+com.github.mygreen.*
+com.github.mygreen.sqlmapper.*
+com.github.myibu.*
+com.github.mylxy.*
+com.github.mynlp.*
+com.github.myoss.*
+com.github.myoss.checkstyle.*
+com.github.myoss.eclipse.*
+com.github.myoss.maven.plugins.*
+com.github.myrealitycoding.*
+com.github.myshzzx.*
+com.github.myst3r10n.*
+com.github.mytcctransaction.*
+com.github.myth-china.*
+com.github.myth-gourd.*
+com.github.myxfeng.*
+com.github.myzhan.*
+com.github.mzachar.maven.plugins.*
+com.github.n15g.*
+com.github.nabsha.mule4.property.provider.*
+com.github.naeidxvTools.*
+com.github.nagasagar.*
+com.github.nagyesta.*
+com.github.nagyesta.abort-mission.*
+com.github.nagyesta.abort-mission.boosters.*
+com.github.nagyesta.abort-mission.reports.*
+com.github.nagyesta.abort-mission.strongback.*
+com.github.nagyesta.abort-mission.testkit.*
+com.github.nagyesta.lowkey-vault.*
+com.github.nahuelolgiati.*
+com.github.nainappa.*
+com.github.nalim2.*
+com.github.nalivajr.*
+com.github.nalukit.*
+com.github.nalukit.archetype.*
+com.github.nanodeath.*
+com.github.nanodeath.typedconfig.*
+com.github.nanshens.*
+com.github.nantianba.*
+com.github.naoghuman.*
+com.github.napp-com.*
+com.github.narcissujsk.*
+com.github.narender-singh.*
+com.github.nateriver520.*
+com.github.natezhengbne.*
+com.github.naviit.libs.*
+com.github.navisarv.*
+com.github.nawforce.*
+com.github.nayasis.*
+com.github.nayuki.*
+com.github.nbaars.*
+com.github.nbbrd.heylogs.*
+com.github.nbbrd.java-console-properties.*
+com.github.nbbrd.java-design-util.*
+com.github.nbbrd.java-desktop-util.*
+com.github.nbbrd.java-io-util.*
+com.github.nbbrd.java-net-proxy.*
+com.github.nbbrd.java-service-util.*
+com.github.nbbrd.java-sql-util.*
+com.github.nbbrd.jdplus-sdmx.*
+com.github.nbbrd.picocsv.*
+com.github.nbbrd.sasquatch.*
+com.github.nbbrd.sdmx-dl.*
+com.github.nbbrd.spreadsheet4j.*
+com.github.nblair.*
+com.github.nbs-llc.*
+com.github.ncredinburgh.*
+com.github.nd00rn.*
+com.github.ndorigatti.mcpb.*
+com.github.ndrew.*
+com.github.ndrlslz.*
+com.github.nearbydelta.*
+com.github.neat-solutions-lab.*
+com.github.neatlife.*
+com.github.nebelritter.dice-roller.*
+com.github.nectarine.*
+com.github.neeleshsambhajiche.*
+com.github.neelrs.*
+com.github.nejcgrenc.plugin.*
+com.github.nekolr.*
+com.github.nelo686.*
+com.github.neokidd.maven.plugins.*
+com.github.neothemachine.*
+com.github.netcapture.*
+com.github.netcrusherorg.*
+com.github.netfarmers.*
+com.github.netkorp.*
+com.github.netricecake.*
+com.github.netyjq.*
+com.github.neuroph.*
+com.github.neusnail.*
+com.github.neutius.*
+com.github.new-proimage.*
+com.github.newagesol.*
+com.github.newbieroutine.*
+com.github.nework-eth.*
+com.github.nexengine.*
+com.github.nextcenturycorporation.*
+com.github.nexus-actions.sample.*
+com.github.neysofu.*
+com.github.nezasa.*
+com.github.nezihyigitbasi.*
+com.github.nfalco79.*
+com.github.nfwork.*
+com.github.ngeor.*
+com.github.nghiatrx.*
+com.github.nginate.*
+com.github.ngoanh2n.*
+com.github.ngorongoro.*
+com.github.nguyencse.*
+com.github.nguyenhunghau.*
+com.github.nguyentientungduong.*
+com.github.ngyewch.capsule.*
+com.github.ngyewch.fjage-extras.*
+com.github.ngyewch.fjage-sim-sentuator.*
+com.github.ngyewch.leafletfx.*
+com.github.ngyewch.ntfsvc.*
+com.github.nhalase.*
+com.github.nhenneaux.jersey.connector.httpclient.*
+com.github.nhenneaux.jersey.jetty.http2.*
+com.github.nhenneaux.resilienthttpclient.*
+com.github.nhirakawa.*
+com.github.nhojpatrick.*
+com.github.nhojpatrick.checkstyle.*
+com.github.nhojpatrick.cucumber.*
+com.github.nhojpatrick.hamcrest.*
+com.github.nhojpatrick.log4j2.appenders.*
+com.github.nhojpatrick.pmd.*
+com.github.nhojpatrick.qa.*
+com.github.nhojpatrick.sortpom.*
+com.github.nhojpatrick.versions.*
+com.github.nhuray.*
+com.github.nic-luo.*
+com.github.nicccccccccce.rippleview.*
+com.github.nicccccccccce.zxing.*
+com.github.nicho92.*
+com.github.nicholasastuart.*
+com.github.nicholasda.*
+com.github.nicholasren.*
+com.github.nick318.*
+com.github.nicklaus4.*
+com.github.nickmcdowall.*
+com.github.nickrm.*
+com.github.nickscha.*
+com.github.nicktgn.mvp.*
+com.github.nickvl.*
+com.github.nicolas-raoul.*
+com.github.nicolasjafelle.*
+com.github.nicosensei.*
+com.github.nicosensei.batch.*
+com.github.nielsenbe.*
+com.github.nifty-gui.*
+com.github.nightcodelabs.*
+com.github.nightdragonyl.*
+com.github.nighttripperid.*
+com.github.nihao2015.*
+com.github.nijian.jkeel.*
+com.github.nik-gleb.*
+com.github.nikita-volkov.*
+com.github.nikita-volkov.java.*
+com.github.nikita-volkov.scala.*
+com.github.niko-tian.*
+com.github.nikodem911.*
+com.github.nikolavp.*
+com.github.nikolaybespalov.*
+com.github.nikolaymenzhulin.*
+com.github.nikyotensai.*
+com.github.nilankamanoj.*
+com.github.nilesh-agsft.*
+com.github.nill14.*
+com.github.nill14.parsers.*
+com.github.nill14.patch1.*
+com.github.nill14.utils.*
+com.github.nimbus-org.*
+com.github.nimeshabuddhika.*
+com.github.ningjie000.*
+com.github.nipun-birla.*
+com.github.nipunaranasinghe.*
+com.github.niqdev.*
+com.github.niqo01.rxplayservices.*
+com.github.nirhart.*
+com.github.nishengpan.*
+com.github.nisrulz.*
+com.github.nithril.*
+com.github.nitishhhh3.dmi.customlib.*
+com.github.nitram509.*
+com.github.niupengyu.*
+com.github.niupengyu.schedule.*
+com.github.njd5475.*
+com.github.njlg.*
+com.github.njlkj.*
+com.github.nkb03.*
+com.github.nkutsche.*
+com.github.nkzawa.*
+com.github.nlbwqmz.*
+com.github.nlloyd.*
+com.github.nmasahiro.*
+com.github.nmondal.*
+com.github.nmorel.gwtjackson.*
+com.github.nmuzhichin.*
+com.github.nnarendravijay.*
+com.github.nnest.*
+com.github.noahr-atc.midisplitter.*
+com.github.nobodxbodon.*
+com.github.nobugboy.*
+com.github.nociar.*
+com.github.noconnor.*
+com.github.nodamushi.*
+com.github.nodely.*
+com.github.noemus.*
+com.github.noir-lattice.*
+com.github.nokamoto.*
+com.github.nomadblacky.*
+com.github.nomou.*
+com.github.nomou.mybatis.*
+com.github.nomou.pangolin.*
+com.github.nomou.spreadsheet.*
+com.github.nondeterministic.*
+com.github.nonorc.*
+com.github.noobknight.*
+com.github.nopparat-mkw.dateutility.*
+com.github.noraui.*
+com.github.nordstrom.tools.*
+com.github.norwae.*
+com.github.nosan.*
+com.github.nosix-me.*
+com.github.novamage.*
+com.github.npathai.*
+com.github.npetzall.testcontainers.junit.*
+com.github.nradov.*
+com.github.nrudenko.*
+com.github.nruzic.*
+com.github.nruzic.commons.assemblies.*
+com.github.nruzic.commons.conventions.*
+com.github.nruzic.commons.master.*
+com.github.nruzic.extensions.eclipse.model.*
+com.github.nruzic.mvnunit.*
+com.github.nruzic.org.apache.maven.doxia.*
+com.github.nruzic.org.apache.maven.shared.*
+com.github.nruzic.playground.submodule.release.*
+com.github.ns2j.*
+com.github.nscala-money.*
+com.github.nscala-time.*
+com.github.nscuro.*
+com.github.nsd-tools.maven.plugins.*
+com.github.nstdio.*
+com.github.nstojiljkovic.*
+com.github.nucleussoftware.*
+com.github.nukc.loadmorelayout.*
+com.github.nullterminated.*
+com.github.nut077.*
+com.github.nwforrer.*
+com.github.nwillc.*
+com.github.ny83427.*
+com.github.nyakto.*
+com.github.nydx.*
+com.github.nyholmniklas.*
+com.github.nyla-solutions.*
+com.github.nylle.*
+com.github.nyvi.*
+com.github.o0starshine0o.*
+com.github.oanhltko.*
+com.github.obase.*
+com.github.obhen233.*
+com.github.obiteaaron.*
+com.github.oboehm.*
+com.github.obolsh.*
+com.github.obouchta.*
+com.github.obourgain.*
+com.github.oc-soft.*
+com.github.oceanc.*
+com.github.ocraft.*
+com.github.odavid.*
+com.github.odavid.maven.plugins.*
+com.github.odinysus.*
+com.github.odiszapc.*
+com.github.oehme.*
+com.github.oehme.jnario.*
+com.github.oehme.xtend.*
+com.github.oen9.*
+com.github.offercat.*
+com.github.ofmooseandmen.*
+com.github.ofofs.*
+com.github.ohcomeyes.*
+com.github.oheger.*
+com.github.oinker4577.*
+com.github.ojaynico.*
+com.github.ojinxy.android-component.*
+com.github.ok2c.hc4.android.*
+com.github.ok2c.hc5.*
+com.github.ok2c.hc5.android.*
+com.github.okapies.*
+com.github.okarmusk.*
+com.github.okenshields.*
+com.github.okeyj.*
+com.github.okihouse.*
+com.github.olaaronsson.*
+com.github.olada.*
+com.github.olavloite.*
+com.github.olegilyenko.*
+com.github.olegosipenko.*
+com.github.olegzzz.*
+com.github.oletraveler.*
+com.github.oli-ver.*
+com.github.oligo.*
+com.github.olim7t.*
+com.github.olivergondza.*
+com.github.olivergondza.dumpling.*
+com.github.olivergondza.os4j.*
+com.github.olivergondza.os4j.connectors.*
+com.github.oliverselinger.*
+com.github.ollgei.*
+com.github.ollgei.base.*
+com.github.ollgei.plugin.*
+com.github.ollgei.spring.*
+com.github.omadahealth.*
+com.github.omadahealth.circularbarpager.*
+com.github.omadahealth.slidepager.*
+com.github.omadahealth.typefaceview.*
+com.github.omarmiatello.android-slf4j-logger.*
+com.github.omarmiatello.android-utils-ktx.*
+com.github.omarmiatello.androidslfjlogger.*
+com.github.omarmiatello.brother-label-printer-kt.*
+com.github.omarmiatello.gradle-modules-config.*
+com.github.omarmiatello.kotlin-script-toolbox.*
+com.github.omarmiatello.source-of-truth.*
+com.github.omarmiatello.telegram.*
+com.github.omarmiatello.yeelight.*
+com.github.omashano.*
+com.github.ombre42.*
+com.github.omkreddy.*
+com.github.omnecon.*
+com.github.omniproc.*
+com.github.omottec.*
+com.github.onbass-naga.*
+com.github.onblog.*
+com.github.oncizl.*
+com.github.onepiecex.*
+com.github.onepiecex.session.core.*
+com.github.onepiecex.session.share.core.*
+com.github.onepiecex.session.share.spring.boot.starter.*
+com.github.onepiecex.session.spring.boot.starter.*
+com.github.onesignaliran.*
+com.github.oneyx.*
+com.github.onikx.*
+com.github.onimur.*
+com.github.onion4.*
+com.github.onliner10.*
+com.github.onlypiglet.*
+com.github.onozaty.*
+com.github.onskola.*
+com.github.onslip.*
+com.github.onsoul.*
+com.github.ontio.*
+com.github.ontologyportal.*
+com.github.ooftf.*
+com.github.oohira.*
+com.github.ooknight.ui.*
+com.github.ooknight.utils.*
+com.github.oopstool.*
+com.github.oowekyala.*
+com.github.oowekyala.ooxml.*
+com.github.oowekyala.treeutils.*
+com.github.ooxi.*
+com.github.opedrosiqueira.*
+com.github.open-fidias.*
+com.github.open-source-sharing.*
+com.github.openasn1.*
+com.github.opendevl.*
+com.github.openequella.*
+com.github.openjson.*
+com.github.opennano.*
+com.github.openstack4j.core.*
+com.github.openstack4j.core.connectors.*
+com.github.operando.*
+com.github.oraclexing.*
+com.github.oranda.*
+com.github.orangegangsters.*
+com.github.orbialabs.*
+com.github.ordnaelmedeiros.*
+com.github.org-arl.*
+com.github.org-hejianhui.*
+com.github.orgnizationteam.*
+com.github.orion-io.*
+com.github.orionlibs.*
+com.github.orionlibs.core.*
+com.github.orm-fux.*
+com.github.orolle.*
+com.github.oryanmat.*
+com.github.os72.*
+com.github.oscana.*
+com.github.oscar0812.*
+com.github.oscerd.*
+com.github.oschuen.*
+com.github.oshi.*
+com.github.oskin1.*
+com.github.osp-huhula.*
+com.github.ostrovskal.*
+com.github.osvaldopina.*
+com.github.oswetto.*
+com.github.osworks.*
+com.github.otrimegistro.*
+com.github.ottogroupsolutionprovider.*
+com.github.oueasley.*
+com.github.oughttoprevail.*
+com.github.outerman.*
+com.github.outerman.be.*
+com.github.outofrange.*
+com.github.ovargas.*
+com.github.overmighty.*
+com.github.owen-jia.*
+com.github.owlcs.*
+com.github.oxo42.*
+com.github.oyvindbjerke.*
+com.github.ozancicek.*
+com.github.ozayduman.*
+com.github.ozcanturkmen.*
+com.github.ozlerhakan.*
+com.github.ozsie.*
+com.github.ozuo.*
+com.github.p2m2.*
+com.github.p6m7g8.*
+com.github.pabloo99.xmlsoccer.*
+com.github.pablopdomingos.*
+com.github.pabzdzdzwiagief.*
+com.github.pabzdzdzwiagief.initialization.*
+com.github.package-url.*
+com.github.packleader.rapid.*
+com.github.padrig64.*
+com.github.paganini2008.*
+com.github.paganini2008.atlantis.*
+com.github.paganini2008.springworld.*
+com.github.pagehelper.*
+com.github.pageobject.*
+com.github.paginationspring.*
+com.github.pagodiario.*
+com.github.palindromicity.*
+com.github.palyfight.*
+com.github.panchitoboy.*
+com.github.pandachanv587.*
+com.github.pandafw.*
+com.github.pandaxz.events.*
+com.github.panga.*
+com.github.panhongan.*
+com.github.panhongan.bigdata.*
+com.github.paniko0.*
+com.github.panjiesw.*
+com.github.pankajadhav.*
+com.github.pankajkrastogi.*
+com.github.panlicun.*
+com.github.pannonia-expertise.*
+com.github.panxiaochao.*
+com.github.panxiaole.*
+com.github.paolodenti.*
+com.github.paolodenti.jsapp.*
+com.github.paolorotolo.*
+com.github.paopaoyue.*
+com.github.papayam.*
+com.github.paramitamirza.*
+com.github.parboiled1.*
+com.github.parc.*
+com.github.pardhumadipalli.*
+com.github.parisk85.*
+com.github.parisoft.*
+com.github.parmag.*
+com.github.parze.*
+com.github.pascalgn.*
+com.github.pashc.*
+com.github.pasqualedalterio.*
+com.github.passionjava4.*
+com.github.passionke.*
+com.github.pat-laugh.*
+com.github.patching.*
+com.github.pateluday07.*
+com.github.pathikrit.*
+com.github.patilrohit.*
+com.github.patjlm.*
+com.github.patricio78.*
+com.github.patrick-mc.*
+com.github.patwakeem.*
+com.github.paulakimenko.*
+com.github.paulcwarren.*
+com.github.pauldambra.*
+com.github.pauleyj.*
+com.github.paulmoloney.*
+com.github.paulocesarcuneo.*
+com.github.paulosalonso.*
+com.github.paulporu.*
+com.github.paulwilson7865.*
+com.github.pavandv9.*
+com.github.pavel-vasilev.*
+com.github.paveljakov.*
+com.github.pavinan.*
+com.github.pavlospt.*
+com.github.pavlospt.certificatetransparency.*
+com.github.paweladamski.*
+com.github.pawelj-pl.*
+com.github.pawelkrol.*
+com.github.paypal.*
+com.github.pbaiyy.*
+com.github.pbaun.*
+com.github.pbetkier.*
+com.github.pbilstein.infrastructure-mocks.*
+com.github.pcejrowski.*
+com.github.pcimcioch.*
+com.github.pcj.*
+com.github.pcmehlitz.*
+com.github.pcorless.icepdf.*
+com.github.pcpl2.*
+com.github.pdorobisz.*
+com.github.peacetrue.*
+com.github.peacetrue.gradle.*
+com.github.peacetrue.modelgenerator.*
+com.github.peacetrue.result.*
+com.github.peacetrue.spring.*
+com.github.peacetrue.template.*
+com.github.peak-ai.*
+com.github.peckb1.*
+com.github.pedrocomitto.*
+com.github.pedrodimoura.*
+com.github.pedrovgs.*
+com.github.peerstack.*
+com.github.peeveen.*
+com.github.peiatgithub.*
+com.github.peichhorn.*
+com.github.peking2.*
+com.github.pellaton.config-validation-processor.*
+com.github.pellaton.estol.*
+com.github.pellierd.*
+com.github.pemistahl.*
+com.github.penemue.*
+com.github.penfeizhou.*
+com.github.penfeizhou.android.animation.*
+com.github.penggle.*
+com.github.pengqun.*
+com.github.pengrad.*
+com.github.pengzhanqian.*
+com.github.pentoligy.*
+com.github.pepelu0.*
+com.github.peppe130.*
+com.github.perbeatus.*
+com.github.perceptron8.*
+com.github.percychuang.*
+com.github.perfectacle.*
+com.github.perfree.*
+com.github.perfrobo.*
+com.github.perkinsli.*
+com.github.permissions-dispatcher.*
+com.github.pernyfelt.sieparser.*
+com.github.persapiens.*
+com.github.pervoj.*
+com.github.peter-gergely-horvath.*
+com.github.peterasasi.cm.*
+com.github.peterbecker.*
+com.github.peterbencze.*
+com.github.peterchen82.*
+com.github.peteroupc.*
+com.github.peterwippermann.junit4.*
+com.github.peterwippermann.maven.*
+com.github.peterzeller.*
+com.github.petitparser.*
+com.github.petka5.*
+com.github.petr-s.*
+com.github.petros-dimitris.*
+com.github.petrovich4j.*
+com.github.petruki.*
+com.github.peymanfarajnezhad.*
+com.github.pfichtner.*
+com.github.pfmiles.*
+com.github.pgcomb.*
+com.github.pgelinas.*
+com.github.pgrandjean.*
+com.github.pgreze.*
+com.github.pgtoopx.*
+com.github.pguedes.*
+com.github.phajduk.*
+com.github.phamquangsang.*
+com.github.phaneesh.*
+com.github.phannaly.*
+com.github.phantomthief.*
+com.github.phasd.*
+com.github.phasebash.*
+com.github.pheerathach.*
+com.github.phenomics.*
+com.github.pheymann.*
+com.github.philanthropix.*
+com.github.philcali.*
+com.github.philippefichet.*
+com.github.philippheuer.credentialmanager.*
+com.github.philippheuer.events4j.*
+com.github.philippheuer.gcf4j.*
+com.github.philippheuer.snowflake4j.*
+com.github.phillip-kruger.*
+com.github.phillip-kruger.javaee-servers-parent.*
+com.github.phillip-kruger.microprofile-demo.*
+com.github.phillip-kruger.microprofile-extensions.*
+com.github.phillip-kruger.microprofile-extentions.*
+com.github.phisgr.*
+com.github.phiz71.*
+com.github.phoenix-young.*
+com.github.phongvt3110.*
+com.github.phonypianist.*
+com.github.phoswald.*
+com.github.phuonghuynh.*
+com.github.physicslovejava.*
+com.github.piacenti.*
+com.github.piacenti.antlr-kotlin.*
+com.github.piaohao.*
+com.github.piasy.*
+com.github.picadoh.*
+com.github.piccuss.*
+com.github.pichsy.*
+com.github.picon-software.*
+com.github.pidygb.*
+com.github.pidygb.android.*
+com.github.pidygb.gestureutilities.*
+com.github.pidygb.slidinglayout.*
+com.github.pidygb.typography.*
+com.github.piemjean.*
+com.github.pierrenodet.*
+com.github.piggyguojy.*
+com.github.pikachu-tech.*
+com.github.piled.*
+com.github.pillsilly.*
+com.github.piltt.*
+com.github.pimvoeten.*
+com.github.pinball83.*
+com.github.pingaz.*
+com.github.pingbu.*
+com.github.pinguet62.*
+com.github.pinguinson.*
+com.github.pinkalshah.*
+com.github.pinterest.*
+com.github.piomin.*
+com.github.piorkowskiprzemyslaw.*
+com.github.piotr-kalanski.*
+com.github.piotr-kalanski.kafka.*
+com.github.piotrkot.*
+com.github.piotrkot.http.*
+com.github.piotrkot.takes.*
+com.github.pipauwel.*
+com.github.pipiloveslife.*
+com.github.pipiz.*
+com.github.pireba.*
+com.github.pires.*
+com.github.pivotalservices.*
+com.github.pixeon.plugins.*
+com.github.pixocial.*
+com.github.piyushpriyadarshi.*
+com.github.pjagielski.spring-boot-swagger.*
+com.github.pjfanning.*
+com.github.pjfanning.elastic4s.*
+com.github.pjfanning.hadoop.thirdparty.*
+com.github.pjfanning.sangria.*
+com.github.pjgg.*
+com.github.pjozsef.*
+com.github.pkair.*
+com.github.pkiep-reniec.*
+com.github.pkoli.*
+com.github.pkuliuqiang.*
+com.github.pkuzz.util.*
+com.github.platan.*
+com.github.platform-team.*
+com.github.play2war.*
+com.github.play2war.ext.*
+com.github.playerforcehd.*
+com.github.plecong.*
+com.github.pleomax00.*
+com.github.plexpt.*
+com.github.pliance.*
+com.github.plippe.*
+com.github.plokhotnyuk.*
+com.github.plokhotnyuk.expression-evaluator.*
+com.github.plokhotnyuk.fsi.*
+com.github.plokhotnyuk.jsoniter-scala.*
+com.github.plokhotnyuk.play-json-extensions.*
+com.github.plokhotnyuk.rtree2d.*
+com.github.plombard.*
+com.github.plural4j.*
+com.github.plusonesoftware.*
+com.github.pm-dev.*
+com.github.pmairif.*
+com.github.pmanent.*
+com.github.pmerienne.*
+com.github.pms1.e3.*
+com.github.pms1.tppt.*
+com.github.pn-x.*
+com.github.pnavais.*
+com.github.pnayak.*
+com.github.pnowy.nc.*
+com.github.pnpninja.*
+com.github.poad.*
+com.github.pocketberserker.*
+com.github.podal.async.*
+com.github.podal.codejavadoc.*
+com.github.podio-community.*
+com.github.podio.*
+com.github.pojomvcc.*
+com.github.pokeboston.*
+com.github.pokkie.*
+com.github.polok.*
+com.github.polok.flipview.*
+com.github.polok.localify.*
+com.github.polok.pincodepicker.*
+com.github.polok.routedrawer.*
+com.github.polok.taggerstring.*
+com.github.polyang.*
+com.github.polydome.*
+com.github.popbrain.*
+com.github.popkidorc.*
+com.github.porokoro.paperboy.*
+com.github.porops.*
+com.github.porpit.*
+com.github.portagoras.*
+com.github.porval.*
+com.github.pos0637.*
+com.github.poslegm.*
+com.github.postgresql-async.*
+com.github.potix2.*
+com.github.power-libraries.*
+com.github.power721.*
+com.github.pozo.*
+com.github.ppadial.*
+com.github.ppadial.mavenbase.*
+com.github.ppiotrow.*
+com.github.ppodgorsek.*
+com.github.ppodgorsek.apache.*
+com.github.ppodgorsek.cache.*
+com.github.ppodgorsek.email.*
+com.github.ppzhuk.*
+com.github.prabhu3084.*
+com.github.prabhuprabhakaran.*
+com.github.pradeeppappu.*
+com.github.pradyothadavi.*
+com.github.prakma.*
+com.github.pranayhere.*
+com.github.prasanta-biswas.*
+com.github.prasanthj.*
+com.github.prashamtrivedi.*
+com.github.pratikalladi.*
+com.github.pravejos.*
+com.github.pravin-raha.*
+com.github.praxissoftware.*
+com.github.praxissoftware.maven.plugins.*
+com.github.praxissoftware.poms.*
+com.github.praxissoftware.rest.*
+com.github.praxissoftware.testing.*
+com.github.prchen.*
+com.github.premnirmal.*
+com.github.pricindalas.*
+com.github.prifiz.*
+com.github.princeparadoxes.*
+com.github.princesslana.*
+com.github.privacystreams.*
+com.github.privaliatech.*
+com.github.priyeshkpandey.*
+com.github.priytam.*
+com.github.program_in_chinese.*
+com.github.progrocus.*
+com.github.projectkendal.*
+com.github.prokod.*
+com.github.prologdb.*
+com.github.prominence.*
+com.github.promisepay.*
+com.github.promregator.*
+com.github.proteus1989.*
+com.github.protobufel.*
+com.github.provigen.*
+com.github.prt2121.*
+com.github.przlach.*
+com.github.psambit9791.*
+com.github.psamsotha.*
+com.github.pscheidl.*
+com.github.pscosta.*
+com.github.pseudometa.*
+com.github.pshirshov.*
+com.github.pshirshov.izumi.*
+com.github.pshirshov.izumi.legacy.*
+com.github.pshirshov.izumi.r2.*
+com.github.psi-probe.*
+com.github.psnrigner.*
+com.github.psorobka.*
+com.github.psquickitjayant.log4jSyslogWriter64k.*
+com.github.psxpaul.*
+com.github.psyuhen.*
+com.github.ptdien.*
+com.github.ptgoetz.*
+com.github.ptitnoony.*
+com.github.ptitnoony.components.*
+com.github.ptomaszek.*
+com.github.ptomli.bedrock.*
+com.github.ptomli.spring-integration-version.*
+com.github.ptomli.spring-security-version.*
+com.github.ptomli.spring-version.*
+com.github.ptrajdos.*
+com.github.ptv-logistics.*
+com.github.publicdevop2019.*
+com.github.publickey.*
+com.github.puddingspudding.*
+com.github.pudovika.*
+com.github.puhaiyang.*
+com.github.pukkaone.*
+com.github.puppet2436.*
+com.github.pureconfig.*
+com.github.purejavacomm.*
+com.github.puresprout.*
+com.github.putpixel.*
+com.github.pvdberg1998.*
+com.github.pwcompany.*
+com.github.pwdd.*
+com.github.pwdd.HTTPServer.*
+com.github.pwittchen.*
+com.github.pwittchen.kirai.*
+com.github.pwizenty.*
+com.github.pwliwanow.fdb-pubsub.*
+com.github.pwliwanow.foundationdb4s.*
+com.github.pxav.kelp.*
+com.github.pyknic.*
+com.github.pyloque.*
+com.github.pylsoft.*
+com.github.pyracantha.*
+com.github.pysrc.*
+com.github.pytarng.*
+com.github.q742972035.mysql.binlog.*
+com.github.q742972035.tools.*
+com.github.qa-automation-utils.*
+com.github.qa-maniac.*
+com.github.qacore.*
+com.github.qantrous.*
+com.github.qbek.*
+com.github.qbetti.*
+com.github.qcloudsms.*
+com.github.qgintest.*
+com.github.qhh6eq.*
+com.github.qiangbiaoyang.*
+com.github.qiangjie.*
+com.github.qianhezheng.*
+com.github.qianxinkakaxi.*
+com.github.qiaolin.*
+com.github.qicodes.*
+com.github.qihootest.*
+com.github.qin.*
+com.github.qingkouwei.*
+com.github.qingquanlv.*
+com.github.qinhouping.*
+com.github.qinpiyi.*
+com.github.qishenghe.*
+com.github.qiubowang.*
+com.github.qiujiayu.*
+com.github.qiujuer.*
+com.github.qiuxiaoj.*
+com.github.qiyimbd.*
+com.github.qiyueW.*
+com.github.qlcchain.*
+com.github.qlefevre.*
+com.github.qlone.*
+com.github.qq275860560.*
+com.github.qq549631030.*
+com.github.qqfbleach.*
+com.github.qqqq331792873.yamlutil.*
+com.github.qqrondy.*
+com.github.qqxadyy.*
+com.github.qrenfeng.*
+com.github.qskyline.*
+com.github.quaintclever.*
+com.github.quangaming2929.*
+com.github.quanoc.*
+com.github.quantum-framework.*
+com.github.quantumcs.*
+com.github.quarkus-criteria.*
+com.github.quarkus-extension.*
+com.github.quartzweb.*
+com.github.quartzwebui.*
+com.github.quentus123.*
+com.github.quickhull3d.*
+com.github.quickstart-nt-996.*
+com.github.quiin.*
+com.github.quintans.*
+com.github.quivr.*
+com.github.ququzone.*
+com.github.qurben.*
+com.github.qxo.*
+com.github.qydq.*
+com.github.qzagarese.*
+com.github.r2dkennobi.*
+com.github.r4mz0r.*
+com.github.rabend.*
+com.github.rabitarochan.*
+com.github.rabwallace.yabibuildinfo.*
+com.github.rac021.*
+com.github.racaljk.*
+com.github.racc.*
+com.github.radadam.*
+com.github.radist-nt.*
+com.github.raduciumag.shapeshift.*
+com.github.rafaelstelles.*
+com.github.rafalkucab.*
+com.github.rafelbev.*
+com.github.raffaeleragni.*
+com.github.rage28.*
+com.github.raghav-chandra.*
+com.github.raghubs81.*
+com.github.rahack95.*
+com.github.rahatarmanahmed.*
+com.github.rahulrvp.*
+com.github.rahulsinghai.*
+com.github.rahulsom.*
+com.github.raimannma.*
+com.github.rain091667.*
+com.github.rainsunset.*
+com.github.raipc.*
+com.github.rajeshkumarkhadka.*
+com.github.rajkumarvenkatasamy.*
+com.github.rajpriy1629.*
+com.github.rajyvan.*
+com.github.ramalapure.*
+com.github.ramanrajarathinam.*
+com.github.ramasct1.*
+com.github.ramesh-dev.*
+com.github.raml2spring.*
+com.github.ramonnteixeira.*
+com.github.rampo.updatechecker.*
+com.github.random-dwi.*
+com.github.randomcodeorg.devlog.*
+com.github.randomcodeorg.ppplugin.*
+com.github.randomcodeorg.simplepdf.*
+com.github.randyp.*
+com.github.ranphi.*
+com.github.raoyu001.*
+com.github.raphc.*
+com.github.raphcal.*
+com.github.rapidark.*
+com.github.rapidboot.*
+com.github.raptor-test.*
+com.github.rarnu.*
+com.github.rasadi.*
+com.github.rastoarpit.*
+com.github.ratanoff.*
+com.github.rationaleemotions.*
+com.github.ratoshniuk.*
+com.github.ratrecommends.*
+com.github.rauber-projects.*
+com.github.ravenfeld.*
+com.github.rawls238.*
+com.github.rawnly.*
+com.github.rayboot.aliimagesdk.*
+com.github.rayboot.simplefresco.*
+com.github.rayboot.svr.*
+com.github.rayboot.widget.*
+com.github.raychatter.*
+com.github.raycw.*
+com.github.raymanrt.*
+com.github.rayou.*
+com.github.rayzone107.*
+com.github.razir.progressbutton.*
+com.github.rblessings.*
+com.github.rbuck.*
+com.github.rchargel.build.*
+com.github.rchargel.maven.*
+com.github.rcmartins.*
+com.github.rcoh.*
+com.github.rdg5.*
+com.github.reactivesprint.*
+com.github.readyou.*
+com.github.realid-global.*
+com.github.realzimboguy.*
+com.github.realzimboguy.ewelink.api.*
+com.github.rebayun.*
+com.github.rebue.*
+com.github.rebue.archetype.*
+com.github.rebue.common-pom.*
+com.github.rebue.jwt.*
+com.github.rebue.mbgx.*
+com.github.rebue.robotech.*
+com.github.rebue.sbs.*
+com.github.rebue.scx.*
+com.github.rebue.wheel.*
+com.github.redattack34.*
+com.github.reddone.*
+com.github.redfish4ktc.parent.*
+com.github.redfish4ktc.soapui.*
+com.github.redhatqe.byzantine.*
+com.github.redhatqe.polarize.*
+com.github.redhatqe.polarizer.*
+com.github.redione1.*
+com.github.rednoll.*
+com.github.redouane59.twitter.*
+com.github.redsolo.vcmtool.*
+com.github.reducktion.*
+com.github.redwheelbarrow.*
+com.github.reflect-framework.*
+com.github.reflect-framework.example.*
+com.github.reforms.*
+com.github.reggar.*
+com.github.regis-leray.*
+com.github.reibitto.*
+com.github.reikje.*
+com.github.reinaldoarrosi.*
+com.github.reinert.*
+com.github.relai.vertx.springdata.*
+com.github.relateddigital.*
+com.github.relaxng.*
+com.github.relistar.*
+com.github.relucent.*
+com.github.reminance.*
+com.github.remis-thoughts.*
+com.github.ren545457803.*
+com.github.renanbandeira.*
+com.github.renesca.*
+com.github.renesca.renesca.*
+com.github.reniec-idaas.*
+com.github.reportportal.*
+com.github.republicofgavin.*
+com.github.research-virtualfortknox.*
+com.github.resource4j.*
+com.github.rest-driver.*
+com.github.restream.*
+com.github.restup.*
+com.github.restup.test.*
+com.github.revenuemonster.*
+com.github.rexenpub.*
+com.github.rexsheng.*
+com.github.rey5137.*
+com.github.rformagio.*
+com.github.rgladwell.*
+com.github.rholder.*
+com.github.rholder.fauxflake.*
+com.github.rholder.nlp.*
+com.github.rhyskeepence.*
+com.github.rhythmdiao.*
+com.github.rialang.*
+com.github.ricardoffmartins.*
+com.github.ricardojob.*
+com.github.riccardove.easyjasub.*
+com.github.riccardove.easyjasub.kurikosu.*
+com.github.ricfedel.*
+com.github.richard-ballard.*
+com.github.richardjwild.*
+com.github.richardroda.util.*
+com.github.richardwill98.elasticsearch.*
+com.github.richardwilly98.elasticsearch.*
+com.github.richardwrq.*
+com.github.richygreat.*
+com.github.rickodesea.gdxscreen.*
+com.github.ricksbrown.*
+com.github.rickyclarkson.*
+com.github.ricpacca.*
+com.github.ricsirigu.*
+com.github.righettod.*
+com.github.rigoford.*
+com.github.riicksouzaa.*
+com.github.rikkartx.*
+com.github.rillis.*
+com.github.rinde.*
+com.github.rinoto.mongo.*
+com.github.rinoto.spring.*
+com.github.riprasad.*
+com.github.risedragon.*
+com.github.rishabh9.*
+com.github.rishihahs.wordsearchsolver.*
+com.github.rising3.*
+com.github.riteshkukreja.*
+com.github.riversking.*
+com.github.rjbx.rateraid.*
+com.github.rjdavis3.*
+com.github.rjeschke.*
+com.github.rjolly.*
+com.github.rkatipally.*
+com.github.rkmk.*
+com.github.rkonovalov.*
+com.github.rkpunjal.sqlsafe.*
+com.github.rkumsher.*
+com.github.rlazoti.*
+com.github.rlespinasse.*
+com.github.rlishtaba.*
+com.github.rlon008.*
+com.github.rmannibucau.*
+com.github.rmannibucau.jel.*
+com.github.rmannibucau.reactive.*
+com.github.rmannibucau.sirona.*
+com.github.rmannibucau.talend.*
+com.github.rmielnik.*
+com.github.rmm0001.*
+com.github.rnett.compiler-plugin-utils.*
+com.github.rnett.kotlin-future-testing.*
+com.github.rnett.krosstalk.*
+com.github.rnett.ktjs-github-action.*
+com.github.rnnds.*
+com.github.roar109.*
+com.github.robert2411.*
+com.github.robert2411.platform.*
+com.github.robert2411.platform.client.*
+com.github.robert2411.platform.client.bus.*
+com.github.robert2411.platform.components.*
+com.github.robert2411.platform.logging.*
+com.github.robert2411.platform.utils.*
+com.github.robertdeocampojr.*
+com.github.robertnetz.*
+com.github.robertomanfreda.*
+com.github.robertotru.*
+com.github.robfletcher.*
+com.github.robindevilliers.*
+com.github.robinrrr10.*
+com.github.robocup-atan.*
+com.github.robozonky.*
+com.github.robozonky.distribution.*
+com.github.robozonky.installer.*
+com.github.robsonbittencourt.*
+com.github.robtimus.*
+com.github.rocketraman.*
+com.github.rocketraman.bootable.*
+com.github.rocketraman.cfg4k.*
+com.github.rocketzly.*
+com.github.rockh.*
+com.github.rockjam.*
+com.github.rockjl.*
+com.github.rocksteady.*
+com.github.rockswang.*
+com.github.rockylomo.*
+com.github.rodbate.*
+com.github.rodionmoiseev.c10n.*
+com.github.rodionmoiseev.gradle.plugins.*
+com.github.rodm.*
+com.github.rodneykinney.*
+com.github.rodrigobriet.*
+com.github.rodrigosaito.*
+com.github.rodrigotm.*
+com.github.rogerhehe.*
+com.github.rogowskik.*
+com.github.roharon.*
+com.github.rohitawate.*
+com.github.rokishopen.*
+com.github.roklenarcic.*
+com.github.rolandhe.*
+com.github.romain-warnan.*
+com.github.romaindu35.*
+com.github.romangromov.*
+com.github.romankh3.*
+com.github.romanowski.*
+com.github.romanqed.*
+com.github.romansl.*
+com.github.romastyi.*
+com.github.romewing.*
+com.github.romix.*
+com.github.romix.akka.*
+com.github.romualdrousseau.*
+com.github.ronakkhunt.*
+com.github.roneetshaw.*
+com.github.roneetshaw.examples.*
+com.github.rongzhu8888.*
+com.github.roookeee.*
+com.github.roroche.*
+com.github.roskart.dropwizard-jaxws.*
+com.github.rosklyar.*
+com.github.rosmith.service.*
+com.github.rosolko.*
+com.github.rostislav-maslov.rcore.*
+com.github.rostmyr.*
+com.github.rostrovsky.*
+com.github.roti.*
+com.github.rotty3000.*
+com.github.roughy.http.util.*
+com.github.rougsig.*
+com.github.roujiamo-cold.*
+com.github.roundrop.*
+com.github.roycetech.commons.*
+com.github.roycetech.rule-engine.*
+com.github.royken.*
+com.github.royqh1979.*
+com.github.rozidan.*
+com.github.rpaulkennedy.*
+com.github.rperez93.*
+com.github.rpgleparser.*
+com.github.rpradal.lettrine.*
+com.github.rpsl4j.*
+com.github.rreckel.*
+com.github.rremer.*
+com.github.rrodriguessilico.*
+com.github.rrrekin.*
+com.github.rrsunhome.*
+com.github.rschmitt.*
+com.github.rsetkus.*
+com.github.rshift.*
+com.github.rshtishi.*
+com.github.rsimoni.*
+com.github.rsschermer.*
+com.github.rssh.*
+com.github.rstiller.nettycluster.*
+com.github.rstradling.*
+com.github.rtf666.*
+com.github.rtoshiro.*
+com.github.rtoshiro.fullscreenvideoview.*
+com.github.rtoshiro.mflibrary.*
+com.github.rtoshiro.popoverview.*
+com.github.rtoshiro.securesharedpreferences.*
+com.github.rtugeek.*
+com.github.rtunsole.*
+com.github.rtyley.*
+com.github.ruanwenjun.*
+com.github.ruanzy.*
+com.github.rubanm.*
+com.github.rubenqba.*
+com.github.rubens1287.*
+com.github.rubenskj.*
+com.github.rubensousa.*
+com.github.rubetrio.*
+com.github.rubiconprojectmobile.*
+com.github.rubinchen.lint.auto.plug.*
+com.github.rudda.*
+com.github.rudnaruk.*
+com.github.ruediste.*
+com.github.ruediste.elasticsearchAppender.*
+com.github.ruediste.remoteJUnit.*
+com.github.ruediste.salta.*
+com.github.ruifengho.*
+com.github.ruifigueira.*
+com.github.ruijun.*
+com.github.ruiyun.dvr4j.*
+com.github.rumbledb.*
+com.github.rumwei.*
+com.github.runbuggyinc.*
+com.github.runeflobakk.*
+com.github.rupendert.*
+com.github.rustamg.*
+com.github.rustock0.*
+com.github.rutledgepaulv.*
+com.github.rvaidya.*
+com.github.rvanheest.*
+com.github.rvesse.*
+com.github.rweisleder.*
+com.github.rwirdemann.*
+com.github.rwitzel.*
+com.github.rwitzel.streamflyer.*
+com.github.rwl.*
+com.github.rwocj.*
+com.github.rworsnop.*
+com.github.rwsargent.*
+com.github.rxson.*
+com.github.rxyor.*
+com.github.ryanbrainard.*
+com.github.ryanch741.*
+com.github.ryanholdren.*
+com.github.ryanholdren.typesafesql.*
+com.github.ryanjohn1.*
+com.github.ryankenney.jasync_driver.*
+com.github.ryanlevell.*
+com.github.ryanp102694.*
+com.github.ryarnyah.*
+com.github.rycaon.*
+com.github.ryenus.*
+com.github.ryneal.*
+com.github.ryoppy.*
+com.github.ryukato.*
+com.github.rzabini.*
+com.github.rzykov.*
+com.github.rzymek.*
+com.github.s1ck.*
+com.github.s1kulkarni.*
+com.github.s3curitybug.*
+com.github.s4u.*
+com.github.s4u.plugins.*
+com.github.s7connector.*
+com.github.s8871404.*
+com.github.s92025592025.*
+com.github.saadfarooq.*
+com.github.saar25.*
+com.github.sabirove.*
+com.github.sabomichal.*
+com.github.sadath42.*
+com.github.sadikovi.*
+com.github.sadstool.*
+com.github.safeprometheus.*
+com.github.safrain.*
+com.github.saftsau.*
+com.github.sagerman4.*
+com.github.sah4ez.*
+com.github.sahand77.*
+com.github.sahara3.*
+com.github.sahasbhop.*
+com.github.sahildave.*
+com.github.sahindagdelen.*
+com.github.said1296.*
+com.github.saiff35.*
+com.github.saikiran40cs.*
+com.github.saikocat.*
+com.github.saikrishna321.*
+com.github.saiprasadkrishnamurthy.*
+com.github.saiprasadkrishnamurthy.objectfinder.*
+com.github.saivamsi123.TermInsurancePremiumCalculator.*
+com.github.sakebook.*
+com.github.sakebook.dialoghelper.*
+com.github.sakesushibig.*
+com.github.sakserv.*
+com.github.saksham.*
+com.github.salamansar.envbuild.*
+com.github.salat.*
+com.github.salemebo.*
+com.github.salesforce-marketingcloud.*
+com.github.saleson.*
+com.github.saleson.fm-dynamic-compiler.*
+com.github.salilvnair.*
+com.github.salmonocean.*
+com.github.salomonbrys.androidfap.*
+com.github.salomonbrys.kodein.*
+com.github.salomonbrys.kotson.*
+com.github.salva.*
+com.github.salvatore-lanzini.*
+com.github.sam474850601.*
+com.github.samair.*
+com.github.samarth2222.*
+com.github.sambe.*
+com.github.sameerparekh.*
+com.github.samelamin.*
+com.github.samirbraga.*
+com.github.samitc.utils.*
+com.github.samizerouta.retrofit.*
+com.github.sammyrulez.*
+com.github.sammyvimes.*
+com.github.samsao.*
+com.github.samskiter.jsonschema2pojo.*
+com.github.samtools.*
+com.github.samuel22gj.*
+com.github.samueltbrown.*
+com.github.samystudio.flair.*
+com.github.samyuan1990.*
+com.github.sanat51289.*
+com.github.sandre.contrail.*
+com.github.sanity4j.*
+com.github.sanjusoftware.*
+com.github.sankulgarg.*
+com.github.sanshi0518.*
+com.github.sanskrit-coders.*
+com.github.sanskrit.*
+com.github.santiagosernah.*
+com.github.sap9433.*
+com.github.saphyra.*
+com.github.sapienttest.*
+com.github.sarahbuisson.*
+com.github.saraivaugioni.*
+com.github.sarunkurup3.*
+com.github.sarveswaran-m.*
+com.github.sarxos.*
+com.github.sasakitomohiro.*
+com.github.sasi040.*
+com.github.sassunt.*
+com.github.satahippy.*
+com.github.satant.*
+com.github.satoshun.CorWebView.*
+com.github.satoshun.RxKeepOrder.*
+com.github.satoshun.RxKotlinCache.*
+com.github.satoshun.RxLifecycleOwner.*
+com.github.satoshun.RxWebView.*
+com.github.satoshun.compose.palette.*
+com.github.satoshun.coroutine.autodispose.*
+com.github.satoshun.coroutinebinding.*
+com.github.satoshun.firebase.*
+com.github.satoshun.groupie.dsl.*
+com.github.satoshun.lifecycleaware.*
+com.github.satoshun.material.*
+com.github.satoshun.reactivex.exoplayer2.*
+com.github.satoshun.redex.gradle.*
+com.github.satoshun.rxreceiver.*
+com.github.satouso0401.*
+com.github.sats17.*
+com.github.satta.*
+com.github.satyan.*
+com.github.saulis.*
+com.github.savio-zc.*
+com.github.savveex.*
+com.github.sazzad16.*
+com.github.sbabcoc.*
+com.github.sbahmani.*
+com.github.sbaudoin.*
+com.github.sblundy.gradle.dependencymanagement.*
+com.github.sbocq.*
+com.github.sbridges.*
+com.github.sbt.*
+com.github.sbtourist.*
+com.github.sc6l6d3v.*
+com.github.scala-academy.*
+com.github.scala-blitz.*
+com.github.scala-incubator.*
+com.github.scala-incubator.io.*
+com.github.scala212-forks.*
+com.github.scala2ts.*
+com.github.scalafanatic.*
+com.github.scalagen.*
+com.github.scalaomg.*
+com.github.scalapi.*
+com.github.scalaprops.*
+com.github.scalaspring.*
+com.github.scaldi.*
+com.github.scalexcel.*
+com.github.scan.*
+com.github.scaruby.*
+com.github.scct.*
+com.github.scfj.*
+com.github.schlak.*
+com.github.schmittjoaopedro.*
+com.github.schnitker.log4j12.*
+com.github.schnitker.logmanager.*
+com.github.schuettec.*
+com.github.scizeron.jidr.*
+com.github.sclassen.*
+com.github.scodec.*
+com.github.scopt.*
+com.github.scoquelin.*
+com.github.scott-gao.*
+com.github.scr.*
+com.github.scredis.*
+com.github.scribejava.*
+com.github.scullxbones.*
+com.github.scyks.*
+com.github.sd4324530.*
+com.github.sd6352051.niftydialogeffects.*
+com.github.sdaduanbilei.*
+com.github.sdaduanbilei.util.*
+com.github.sdb.*
+com.github.sdcxy.*
+com.github.sdegroot.*
+com.github.sdmcraft.*
+com.github.sdmcraft.slingdynamo.*
+com.github.sdnwiselab.*
+com.github.sdorra.*
+com.github.sdp-tech-nj.*
+com.github.sdrss.*
+com.github.sdtool.*
+com.github.sdziubka.*
+com.github.sea-boat.*
+com.github.sea-huang.*
+com.github.seaframework.*
+com.github.seahen.*
+com.github.seancfoley.*
+com.github.seanparsons.jsonar.*
+com.github.seanroy.*
+com.github.seanyinx.*
+com.github.seanyinx.wing.*
+com.github.seanzor.*
+com.github.seanzor.webgl.detect.*
+com.github.searls.*
+com.github.seasarorg.mayaa.*
+com.github.sebastianengel.actionbarpulltorefresh.*
+com.github.sebhoss.*
+com.github.sebhoss.bom.*
+com.github.sebhoss.common.*
+com.github.sebhoss.contract.*
+com.github.sebhoss.doxia.*
+com.github.sebhoss.utils.*
+com.github.sebhoss.yosql.*
+com.github.sebischair.*
+com.github.sebrichards.*
+com.github.sebruck.*
+com.github.sebymiano.fabwithprogress.*
+com.github.sebymiano.materialfabwithprogress.*
+com.github.secbr.*
+com.github.secdec.astam-correlator.*
+com.github.secondbase.*
+com.github.sedus.*
+com.github.seek-oss.*
+com.github.seeker.commonhash.*
+com.github.seeker.commonj.*
+com.github.seeseemelk.*
+com.github.segator.*
+com.github.segmentio.*
+com.github.seishin.rxbus.*
+com.github.seishin.rxmvp.*
+com.github.seitenbau.*
+com.github.sejoung.*
+com.github.selamialtin.*
+com.github.selenium-consulting.*
+com.github.seleniumhouse.*
+com.github.selfancy.*
+com.github.selfridicule.*
+com.github.selwynshen.*
+com.github.semanticer.*
+com.github.semoncat.GoogleNavigationDrawerMenu.*
+com.github.semoncat.featureCoverFlow.*
+com.github.semoncat.floatlabelededittext.*
+com.github.semoncat.fragmenttransanim.*
+com.github.semoncat.geachgame.core.*
+com.github.semoncat.merlin.*
+com.github.semoncat.seekarc.*
+com.github.semoncat.udroid.*
+com.github.semoncat.wizzardpager.*
+com.github.semoncat.xcombine.*
+com.github.senssic.*
+com.github.sent2280.*
+com.github.seoj.*
+com.github.sepp2k.*
+com.github.sepulrator.*
+com.github.sequenceplanner.*
+com.github.seratch.*
+com.github.seratch.com.veact.*
+com.github.seratch.reaktor.*
+com.github.seratch.taskun.*
+com.github.serceman.*
+com.github.serchinastico.*
+com.github.serddmitry.*
+com.github.serebrus.*
+com.github.seregamorph.*
+com.github.serg-delft.*
+com.github.serg-delft.hyperion.*
+com.github.sergeds.*
+com.github.sergejzr.lib.*
+com.github.sergenes.*
+com.github.sergeybudnik.*
+com.github.sergeygrigorev.*
+com.github.sergiofgonzalez.*
+com.github.sergiomartins8.*
+com.github.serguei-p.*
+com.github.serkanalgl.*
+com.github.serlockholmes.*
+com.github.servanter.*
+com.github.servicenow.stl4j.*
+com.github.sesygroup.choreography.*
+com.github.setielouis.*
+com.github.sett4.*
+com.github.sevastyandark.*
+com.github.sevenbitstech.*
+com.github.sevntu-checkstyle.*
+com.github.sevtech-dev.*
+com.github.seykron.*
+com.github.seyyedmojtaba72.*
+com.github.sfg-beer-works.*
+com.github.sfleiter.cdi-interceptors.*
+com.github.sftwnd.crayfish.*
+com.github.sftwnd.crayfish.alarms.*
+com.github.sftwnd.crayfish.common.*
+com.github.sgfh.*
+com.github.sgoertzen.*
+com.github.sgoeschl.gatling.*
+com.github.sgreben.*
+com.github.sgroschupf.*
+com.github.sgyyz.*
+com.github.sh0nk.*
+com.github.sh4869.*
+com.github.shadowsocks.*
+com.github.shadskii.*
+com.github.shafiquejamal.*
+com.github.shahar2k5.*
+com.github.shalk.*
+com.github.shalousun.*
+com.github.shamithachandrasena.*
+com.github.shanananana.*
+com.github.shanks2048.*
+com.github.shaohj.*
+com.github.sharispe.*
+com.github.shawn2013.plugin.*
+com.github.shawven.*
+com.github.shawyeok.*
+com.github.shayanlinux.*
+com.github.shaykhsalman.*
+com.github.shchurov.*
+com.github.shediao.crashsdk.*
+com.github.sheigutn.*
+com.github.shell-software.*
+com.github.shem8.*
+com.github.shenjianli.netclient.*
+com.github.shenyuanqing.okhttp3.*
+com.github.shenyuanqing.zxing.*
+com.github.shenzhang.*
+com.github.shepherdviolet.*
+com.github.shepherdviolet.glaciion2.*
+com.github.shepherdviolet.glacimon.*
+com.github.shepherdviolet.slate20.*
+com.github.shepherdviolet.thistle20.*
+com.github.sherlockjun.*
+com.github.sherpya.*
+com.github.sheyll.*
+com.github.shi-tou-ren.*
+com.github.shibayu36.*
+com.github.shibor.*
+com.github.shicloud.*
+com.github.shidilii.*
+com.github.shiguruikai.*
+com.github.shihyuho.*
+com.github.shijingsh.*
+com.github.shinanca.*
+com.github.shinixsensei-dev.*
+com.github.shipengyan.*
+com.github.shiqiyue.*
+com.github.shivam9ronaldo7.*
+com.github.shivanikanojia.*
+com.github.shiver-me-timbers.*
+com.github.shiver-me-timbers.aws.cloudformation.*
+com.github.shivthepro.*
+com.github.shnewto.*
+com.github.shnoble.*
+com.github.shonlin.*
+com.github.shootercheng.*
+com.github.shoothzj.*
+com.github.shootmoon.*
+com.github.shouaya.*
+com.github.shredder121.*
+com.github.shse.*
+com.github.shuaidd.*
+com.github.shuaisheng.*
+com.github.shuhart.*
+com.github.shuiguang.*
+com.github.shumonsharif.*
+com.github.shumy.*
+com.github.shuvigoss.zconf.*
+com.github.shyiko.*
+com.github.shyiko.dotenv.*
+com.github.shyiko.hadoop-maven-plugin.*
+com.github.shyiko.jsst.*
+com.github.shyiko.klob.*
+com.github.shyiko.ktlint.*
+com.github.shyiko.levelkt.*
+com.github.shyiko.mappify.*
+com.github.shyiko.rook.*
+com.github.shyiko.servers-maven-extension.*
+com.github.shyiko.skedule.*
+com.github.shyiko.usage-maven-plugin.*
+com.github.shynixn.*
+com.github.shynixn.anchornms.*
+com.github.shynixn.ball.*
+com.github.shynixn.blockball.*
+com.github.shynixn.chat.*
+com.github.shynixn.headdatabase.*
+com.github.shynixn.item.*
+com.github.shynixn.mccoroutine.*
+com.github.shynixn.mcpowerprotocol.*
+com.github.shynixn.mini.googledrive.*
+com.github.shynixn.mini.googleoauth.*
+com.github.shynixn.minihttp.*
+com.github.shynixn.minikeyvaluestore.*
+com.github.shynixn.org.bstats.*
+com.github.shynixn.packet.*
+com.github.shynixn.patreonauth.*
+com.github.shynixn.petblocks.*
+com.github.shynixn.samplehelloworld.*
+com.github.shynixn.structureblocklib.*
+com.github.shynixn.vector.*
+com.github.shynixn.workbench.*
+com.github.siahsang.*
+com.github.siasia.*
+com.github.sic-sic.*
+com.github.sideeffffect.*
+com.github.sidhant92.*
+com.github.sidnan.*
+com.github.sidneibjunior.*
+com.github.sidssids.*
+com.github.sigalhu.*
+com.github.sigmasolution.*
+com.github.signaflo.*
+com.github.signalr4j.*
+com.github.signed.gradle.plugin.*
+com.github.signed.inmemory.ftp.*
+com.github.signed.inmemory.jms.*
+com.github.signed.inmemory.jndi.*
+com.github.signed.inmemory.sftp.*
+com.github.signed.inmemory.shared.*
+com.github.signed.junit.*
+com.github.signed.jvm-protocol-handler.*
+com.github.signed.matcher.file.*
+com.github.signed.pockuito.*
+com.github.signed.swagger.*
+com.github.sijojosan21.*
+com.github.sikorka.*
+com.github.silaev.*
+com.github.silencesu.*
+com.github.silicosciences.*
+com.github.sillebille.*
+com.github.silvagpmiguel.*
+com.github.silverlight7.*
+com.github.silvestrpredko.*
+com.github.silvestrpredko.dotprogressbar.*
+com.github.simerplaha.*
+com.github.simkuenzi.*
+com.github.simmoblabla.*
+com.github.simonalong.*
+com.github.simondan.*
+com.github.simondan.ojcms.*
+com.github.simondan.ojcms.server.*
+com.github.simonfischer04.*
+com.github.simongregersen.*
+com.github.simonharmonicminor.*
+com.github.simonpercic.*
+com.github.simonschiller.*
+com.github.simoska4.editimage.*
+com.github.simoska4.removespaces.*
+com.github.simoska4.straightentext.*
+com.github.simplehych.*
+com.github.simplesteph.ksm.*
+com.github.simplify3x.*
+com.github.simplyscala.*
+com.github.simy4.coregex.*
+com.github.simy4.stub.*
+com.github.simy4.xpath.*
+com.github.sinall.*
+com.github.sinboun.*
+com.github.sinemetu1.*
+com.github.sink772.*
+com.github.sinorockie.*
+com.github.sinwe.*
+com.github.sinwe.gradle.caching.hazelcast.*
+com.github.sinyat.*
+com.github.siom79.japicmp.*
+com.github.sirayan.genericdb-mongo.*
+com.github.sirikid.*
+com.github.sirixdb.brackit.*
+com.github.siroshun09.adventureextender.*
+com.github.siroshun09.configapi.*
+com.github.siroshun09.event4j.*
+com.github.siroshun09.mccommand.*
+com.github.siroshun09.mcmessage.*
+com.github.siroshun09.messages.*
+com.github.siroshun09.translationloader.*
+com.github.sisyphsu.*
+com.github.sitangshupal.*
+com.github.sitangshupal.ServiceAutomator.*
+com.github.sitrakary.*
+com.github.sitture.*
+com.github.sivalabs.*
+com.github.siwenyan.*
+com.github.six42.*
+com.github.sixinyiyu.*
+com.github.sixro.*
+com.github.siyamed.*
+com.github.siyoon210.*
+com.github.sj853.*
+com.github.sjcasey21.*
+com.github.sjitech.*
+com.github.sjoerdvankreel.*
+com.github.skalowsky.*
+com.github.skapral.*
+com.github.skapral.config.*
+com.github.skapral.jersey.se.*
+com.github.skapral.poetryclub.*
+com.github.skapral.puzzler.*
+com.github.skapral.reqresp.*
+com.github.skarpushin.*
+com.github.skazzyy.gradle.plugins.*
+com.github.skeychen.*
+com.github.skgmn.*
+com.github.skhatri.*
+com.github.skhatri.dependencyset.*
+com.github.skhatri.reposet.*
+com.github.skjolber.*
+com.github.skjolber.3d-bin-container-packing.*
+com.github.skjolber.android.nfc-lifecycle-wrapper.*
+com.github.skjolber.android.nfc.*
+com.github.skjolber.aotc.*
+com.github.skjolber.gradle-cache-cleaner.*
+com.github.skjolber.gtfs-databinding.*
+com.github.skjolber.jackson.*
+com.github.skjolber.json-log-filter.*
+com.github.skjolber.log-domain.*
+com.github.skjolber.logback-logstash-syntax-highlighting-decorators.*
+com.github.skjolber.maven-pom-recorder.*
+com.github.skjolber.mockito-rest-spring.*
+com.github.skjolber.ndef-tools-for-android.*
+com.github.skjolber.sesseltjonna-csv.*
+com.github.skjolber.tolltariffen.*
+com.github.skjolber.unzip-csv.*
+com.github.skjolber.xml-log-filter.*
+com.github.skozlov.*
+com.github.skwakman.nodejs-maven-binaries.*
+com.github.skwakman.nodejs-maven-plugin.*
+com.github.sky-gu.*
+com.github.skyding228.*
+com.github.skydoves.*
+com.github.skyghis.*
+com.github.slack-scala-client.*
+com.github.slackey.*
+com.github.slacrey.*
+com.github.slang03.*
+com.github.slaout.fork.info.cukesthreads.*
+com.github.slashrootv200.*
+com.github.slavaz.*
+com.github.slech.dbmanager.*
+com.github.slem1.*
+com.github.sleroy.*
+com.github.slezadav.*
+com.github.slezier.*
+com.github.slimish.*
+com.github.sljjyy.*
+com.github.slugify.*
+com.github.sm4rtisan.*
+com.github.smallcham.*
+com.github.smallcreep.*
+com.github.smallcreep.cucumber.*
+com.github.smallmenu.*
+com.github.smallmiro.*
+com.github.smartboooy.*
+com.github.smartbuf.*
+com.github.smitajit.*
+com.github.smokestack.*
+com.github.smythasen.*
+com.github.sn42.gwt.*
+com.github.snake19870227.*
+com.github.snakerflow-starter.*
+com.github.snakerflow.*
+com.github.snchengqi.*
+com.github.snieking.*
+com.github.snksoft.*
+com.github.snowdream.*
+com.github.snowdream.android.*
+com.github.snowdream.android.app.*
+com.github.snowdream.android.database.*
+com.github.snowdream.android.resource.*
+com.github.snowdream.android.template.*
+com.github.snowdream.android.util.*
+com.github.snowdream.android.util.concurrent.*
+com.github.snowdream.android.widget.*
+com.github.snowdream.gvi.*
+com.github.snowdream.toybricks.*
+com.github.snowdream.util.*
+com.github.snowdream.web.*
+com.github.snowgooseyk.*
+com.github.snowindy.*
+com.github.snuffix.*
+com.github.snuffix.android.material.rippleeffect.*
+com.github.so-kes.*
+com.github.soartech.*
+com.github.socketIo4Netty.*
+com.github.soft-po.*
+com.github.softbasic.*
+com.github.softinica.maven.*
+com.github.softwaresandbox.*
+com.github.softwarevax.*
+com.github.sogyf.*
+com.github.sola92.*
+com.github.solarknight.*
+com.github.solomonronald.*
+com.github.somchit.*
+com.github.somefree.*
+com.github.someja.*
+com.github.somereason.*
+com.github.sommeri.*
+com.github.somnambulaDreams.*
+com.github.sonac.*
+com.github.sonake.*
+com.github.sonenko.*
+com.github.songdongsheng.*
+com.github.songjinze.*
+com.github.songxchn.*
+com.github.songyz0310.*
+com.github.songzhijian.*
+com.github.sonhal.*
+com.github.sonnguyenvan9794.*
+com.github.sonus21.*
+com.github.sophisticatedxie.*
+com.github.sophoun.*
+com.github.sophtutch.*
+com.github.soranakk.oofqrreader.*
+com.github.sormuras.bach.*
+com.github.sorokinigor.*
+com.github.soshibby.*
+com.github.soulyaroslav.*
+com.github.soumya-vats.*
+com.github.sourabhgupta811.*
+com.github.sourcegroove.*
+com.github.souzen.*
+com.github.sovaa.*
+com.github.sovaalexandr.*
+com.github.sowasvonbot.*
+com.github.soysaucelm.*
+com.github.spacanowski.*
+com.github.spacetimeme.*
+com.github.spapageo.*
+com.github.spapageo.reactor.*
+com.github.spark-ds.*
+com.github.sparkds.*
+com.github.sparkmuse.*
+com.github.sparkzxl.*
+com.github.sparow199.*
+com.github.sparrow007.*
+com.github.sparsaa.*
+com.github.sparsick.maven.docker.extension.*
+com.github.spartatech.*
+com.github.spbisya.*
+com.github.speaksugar.*
+com.github.speedwing.*
+com.github.spelcrawler.*
+com.github.spice-h2020.*
+com.github.spinalhdl.*
+com.github.spirom.*
+com.github.spirylics.*
+com.github.spirylics.web2app.*
+com.github.spirylics.xgwt.*
+com.github.spjoe.*
+com.github.splend-io.*
+com.github.splunk.lightproto.*
+com.github.spockz.*
+com.github.spoddutur.*
+com.github.spoofzu.*
+com.github.spoonlabs.*
+com.github.spoonlabs.coming.*
+com.github.spoptchev.*
+com.github.sporcina.mule.modules.*
+com.github.spotbugs.*
+com.github.spranshu1.*
+com.github.spranshu1.common.util.*
+com.github.spread0x.*
+com.github.spring-bees.*
+com.github.spring-boot-ext.*
+com.github.spring-data-dynamodb.*
+com.github.spring-social.*
+com.github.springbootPlus.*
+com.github.springcloud.*
+com.github.springlink.*
+com.github.springtestdbunit.*
+com.github.sprinklr.*
+com.github.sps.junidecode.*
+com.github.sps.metrics.*
+com.github.sps.mustache.*
+com.github.sps.notifo4j.*
+com.github.sps.pushover.net.*
+com.github.spt-oss.*
+com.github.spucman.*
+com.github.spullara.cli-parser.*
+com.github.spullara.java.*
+com.github.spullara.mustache.java.*
+com.github.spullara.redis.*
+com.github.sputnik906.*
+com.github.spyhunter99.*
+com.github.spyrospac.*
+com.github.sqlunit4j.*
+com.github.sqrlserverjava.*
+com.github.squallopen.*
+com.github.squigglesql.*
+com.github.squirrelgrip.*
+com.github.srang.*
+com.github.srapisarda.*
+com.github.srbarber1997.*
+com.github.srec.*
+com.github.srf5132.*
+com.github.srgsf.*
+com.github.sridhar-001.*
+com.github.sriki77.*
+com.github.srimaddy.*
+com.github.srini156.*
+com.github.sritejakv.*
+com.github.srujankujmar.*
+com.github.sschipor.*
+com.github.sschlib.*
+com.github.ssedano.*
+com.github.ssmplus.*
+com.github.sstone.*
+com.github.sszuev.*
+com.github.st-h.*
+com.github.st235.*
+com.github.stachu540.*
+com.github.stacs-srg.*
+com.github.stacycurl.*
+com.github.stadler.*
+com.github.stampery.*
+com.github.stanford-futuredata.momentsketch.*
+com.github.stanislav-sartasov.*
+com.github.starhq.*
+com.github.starnowski.bmunit.extension.*
+com.github.starnowski.posjsonhelper.*
+com.github.starnowski.posmulten.*
+com.github.starnowski.posmulten.configuration.*
+com.github.starnowski.posmulten.hibernate.*
+com.github.starsLightShine.*
+com.github.staslev.*
+com.github.stateless4j.*
+com.github.stay4cold.*
+com.github.stefanbirkner.*
+com.github.stefaniniinspiring.*
+com.github.stefanliebenberg.*
+com.github.stefanocke.japkit.*
+com.github.stefanofornari.*
+com.github.stefanvstein.*
+com.github.stefnotch.*
+com.github.stefvanschie.inventoryframework.*
+com.github.stengerh.*
+com.github.stephanarts.*
+com.github.stephanenicolas.*
+com.github.stephanenicolas.afterburner.*
+com.github.stephanenicolas.dart.v2.*
+com.github.stephanenicolas.injectextra.*
+com.github.stephanenicolas.injectresource.*
+com.github.stephanenicolas.injectview.*
+com.github.stephanenicolas.javassist.*
+com.github.stephanenicolas.loglifecycle.*
+com.github.stephanenicolas.mimic.*
+com.github.stephanenicolas.morpheus.*
+com.github.stephanenicolas.ormgap.*
+com.github.stephanenicolas.toothpick.*
+com.github.stephdz.chuse.*
+com.github.stephenc.*
+com.github.stephenc.connectors.*
+com.github.stephenc.continuous.*
+com.github.stephenc.definalizer.*
+com.github.stephenc.diffpatch.*
+com.github.stephenc.docker.*
+com.github.stephenc.eaio-grabbag.*
+com.github.stephenc.eaio-uuid.*
+com.github.stephenc.findbugs.*
+com.github.stephenc.hector.*
+com.github.stephenc.high-scale-lib.*
+com.github.stephenc.java-iso-tools.*
+com.github.stephenc.jcip.*
+com.github.stephenc.jetties.*
+com.github.stephenc.mongodb.*
+com.github.stephenc.monte.*
+com.github.stephenc.nonmavenjar.*
+com.github.stephenc.scale7.*
+com.github.stephenc.simple-java-mail.*
+com.github.stephenc.wagon.*
+com.github.stephenenright.*
+com.github.stephengold.*
+com.github.stephenvinouze.*
+com.github.sterkh66.*
+com.github.steveash.addr.*
+com.github.steveash.bushwhacker.*
+com.github.steveash.commons.*
+com.github.steveash.guavate.*
+com.github.steveash.hnp.*
+com.github.steveash.itxttbl.*
+com.github.steveash.jg2p.*
+com.github.steveash.jopenfst.*
+com.github.steveash.kylm.*
+com.github.steveash.mallet.*
+com.github.stevecrox.*
+com.github.stevedc1989.webmover.*
+com.github.steveice10.*
+com.github.steven-lang.*
+com.github.stevenchen3.*
+com.github.stijndehaes.*
+com.github.stma.*
+com.github.stokito.*
+com.github.stone1234.*
+com.github.stone365.*
+com.github.stoneforever.*
+com.github.stonelion.*
+com.github.stonyshi.*
+com.github.storeconnect.*
+com.github.storm-bit.*
+com.github.storm3java.*
+com.github.stoyicker.auto-factory-kotlin.*
+com.github.stoyicker.onautoscrolledtoview.*
+com.github.stoyicker.otpview.*
+com.github.stoyicker.test-accessors.*
+com.github.stpatrck.*
+com.github.strangepleasures.*
+com.github.strator-dev.greenpepper.*
+com.github.streamlang.*
+com.github.streamone.*
+com.github.strengthened.*
+com.github.stromner.*
+com.github.structlogging.*
+com.github.stuartapp.*
+com.github.stupdit1t.*
+com.github.stuxuhai.*
+com.github.styxco.*
+com.github.sub-mob.*
+com.github.subchen.*
+com.github.submob.*
+com.github.suckgamony.*
+com.github.sudeep23.*
+com.github.sufianbabri.*
+com.github.suganda8.*
+com.github.sukhjindersukh.*
+com.github.sulir.*
+com.github.suloginscene.*
+com.github.sumanit.*
+com.github.sumankumar01.*
+com.github.sumuzhou.*
+com.github.sun00743.okhttpRequest.*
+com.github.sunbufu.*
+com.github.sunchao0312.*
+com.github.sundeepk.*
+com.github.sundev79.MineBootFramework.*
+com.github.sundev79.MineBootShell.*
+com.github.sundev79.sunupdate.*
+com.github.suneettipirneni.*
+com.github.sunilcarpenter.*
+com.github.sunjinyue1993.*
+com.github.sunlin901203.*
+com.github.sunmya.*
+com.github.sunnus3.*
+com.github.sunproject-org.*
+com.github.sunsear.*
+com.github.sunshinezmh.*
+com.github.sunyanghah.*
+com.github.sunywdev.*
+com.github.super-sean.*
+com.github.superad.pdf.kit.*
+com.github.supergaga.*
+com.github.supermanhub.*
+com.github.supermoonie.*
+com.github.superproxy.*
+com.github.supersanders.*
+com.github.superscorpion.*
+com.github.superutils.*
+com.github.surabhigupta412.*
+com.github.surpassm.*
+com.github.surpsg.*
+com.github.sursmobil.*
+com.github.sushantmimani.*
+com.github.susom.*
+com.github.suxingli.*
+com.github.suziquan.*
+com.github.sv244.*
+com.github.svendiedrichsen.*
+com.github.svenmeier.wicket-box.*
+com.github.svenmeier.wicket-dnd.*
+com.github.svezfaz.*
+com.github.svinci.*
+com.github.svinniks.*
+com.github.sviperll.*
+com.github.svstoll.*
+com.github.svyatoslavlynda.*
+com.github.swagger-akka-http.*
+com.github.swagger-api.*
+com.github.swagger-spray.*
+com.github.swami-mahesh.*
+com.github.swapi4j.*
+com.github.swierkosz.*
+com.github.swiftech.*
+com.github.swisscom-blockchain.*
+com.github.swissquote.*
+com.github.switcherapi.*
+com.github.swjuyhz.*
+com.github.swms-project.*
+com.github.sworisbreathing.*
+com.github.sworisbreathing.ehcachefilemonitor.*
+com.github.sworisbreathing.sfmf4j.*
+com.github.sworm.*
+com.github.swri-robotics.*
+com.github.sxlatgithub.javaglue.*
+com.github.sya-ri.*
+com.github.sylphlike.*
+com.github.sylvainlaurent.jdbcperflogger.*
+com.github.sylvainlaurent.maven.*
+com.github.symulakr.*
+com.github.synesso.*
+com.github.sypexgeo.*
+com.github.sysalto.*
+com.github.systemdir.gml.*
+com.github.szczurmys.*
+com.github.szenasimartin.*
+com.github.szgabsz91.*
+com.github.szhittech.*
+com.github.szugyi.*
+com.github.t0rr3sp3dr0.*
+com.github.t1.*
+com.github.t3hnar.*
+com.github.t3t5u.*
+com.github.t9t.jooq.*
+com.github.t9t.minecraft-rcon-client.*
+com.github.tablebird.*
+com.github.taccisum.*
+com.github.tackfast.*
+com.github.tadeuespindolapalermo.easyjdbc.*
+com.github.tadeuespindolapalermo.itprojectsupport.*
+com.github.tadukoo.annotations.*
+com.github.tadukoo.database.*
+com.github.tadukoo.github.*
+com.github.tadukoo.java.*
+com.github.tadukoo.junit.*
+com.github.tadukoo.maven.*
+com.github.tadukoo.parsing.*
+com.github.tadukoo.parsing.code.*
+com.github.tadukoo.util.*
+com.github.tadukoo.view.*
+com.github.tadukoo.web.*
+com.github.tailwolf.*
+com.github.taintech.*
+com.github.taixiongliu.*
+com.github.takawitter.*
+com.github.takayahilton.*
+com.github.takemikami.*
+com.github.takezoe.*
+com.github.taksan.*
+com.github.takumi-n.*
+com.github.takusemba.*
+com.github.talberto.*
+com.github.talenguyen.*
+com.github.talkwithkeyboard.*
+com.github.tamnguyenbbt.*
+com.github.tamurashingo.dbutil3.*
+com.github.tandronicus.*
+com.github.tang-jianghua.*
+com.github.tangchen-blip.*
+com.github.tangr1.*
+com.github.tangweixin.*
+com.github.taniqng.*
+com.github.tanishiking.*
+com.github.tankist88.*
+com.github.tanob.*
+com.github.tanshion.*
+com.github.tantalor93.*
+com.github.tanxiaofan.*
+com.github.taodong.*
+com.github.taomus.coderuntime4j.*
+com.github.taomus.fig.*
+com.github.taoristor.*
+com.github.taptap.*
+com.github.tarao.*
+com.github.tarasbilinsky.*
+com.github.target2sell.*
+com.github.target365.*
+com.github.tarsys.android.*
+com.github.tarsys.android.kotlin.*
+com.github.tashoyan.*
+com.github.tasubo.*
+com.github.tatsuyuki25.*
+com.github.taucher2003.*
+com.github.taucher2003.appenders.*
+com.github.tavisdxh.*
+com.github.taxone.plugins.*
+com.github.taymindis.*
+com.github.tbekolay.jnumeric.*
+com.github.tbje.*
+com.github.tbodt.*
+com.github.tbosoft.*
+com.github.tbouron.*
+com.github.tbouron.shakedetector.*
+com.github.tchoulihan.*
+com.github.tcl-ec.*
+com.github.tcnh.*
+com.github.tcurrie.*
+com.github.tddmonkey.*
+com.github.tdesjardins.*
+com.github.tdomzal.*
+com.github.teaey.*
+com.github.teafarm.javatea.*
+com.github.teakfly.*
+com.github.tec2go.test-pyramid.api.*
+com.github.techflavors.*
+com.github.techfreak.*
+com.github.techguy-bhushan.*
+com.github.techisfun.*
+com.github.technoir42.*
+com.github.technology16.*
+com.github.technomancy.*
+com.github.tedzhdz.*
+com.github.tehleo.*
+com.github.teja24nex.*
+com.github.telecomsdn.*
+com.github.telecomsdn.openapi.*
+com.github.telecomsdn.openapi.sdk.*
+com.github.tellison.*
+com.github.temen24.*
+com.github.temyers.*
+com.github.tencent.*
+com.github.tencentyun.*
+com.github.tengnatDeveloper.*
+com.github.tennaito.*
+com.github.tenslar.*
+com.github.terentich.*
+com.github.teriks.*
+com.github.terma.*
+com.github.terma.gigaspace-web-console.*
+com.github.terrakok.*
+com.github.terran4j.*
+com.github.terratest-maven-plugin.*
+com.github.terrytsai.*
+com.github.testdriven.*
+com.github.testdriven.guice.*
+com.github.testing-blaze.*
+com.github.testng-team.*
+com.github.testoptimal.*
+com.github.testpress.*
+com.github.tevid.*
+com.github.texxel.*
+com.github.tezc.*
+com.github.tfaga.lynx.*
+com.github.tfoxcroft.*
+com.github.tfoxy.*
+com.github.tgio.*
+com.github.tgioihan.*
+com.github.thake.avro4k.*
+com.github.thake.logminer.*
+com.github.thangiee.*
+com.github.thanglequoc.*
+com.github.thanhtien522.*
+com.github.thanhtinhpas1.*
+com.github.thanhvoquang.*
+com.github.tharwaninitin.*
+com.github.the-alchemist.*
+com.github.the-cybersapien.*
+com.github.the-h-team.*
+com.github.the-h-team.menu_man.*
+com.github.the-h-team.my-essentials.*
+com.github.the-watchmen.*
+com.github.theDazzler.*
+com.github.theastrolab.*
+com.github.theborakompanioni.*
+com.github.thecoldwine.*
+com.github.thecookielab.*
+com.github.thehilikus.events.*
+com.github.thehilikus.jrobocom.*
+com.github.thehilikus.jrobocom.samples.*
+com.github.thehilikus.jrobocom.samples.legends.*
+com.github.thehilikus.jrobocom.samples.simple.*
+com.github.theholywaffle.*
+com.github.thejuki.*
+com.github.thekhaeng.*
+com.github.themrmilchmann.kopt.*
+com.github.themrmilchmann.kraton.*
+com.github.themrmilchmann.mjl.*
+com.github.theon.*
+com.github.thepacific.*
+com.github.therajanmaurya.*
+com.github.therapi.*
+com.github.therealandroid.*
+com.github.thesmartenergy.*
+com.github.thesortedchaos.*
+com.github.thestarmaker.*
+com.github.thesurix.*
+com.github.thewaychung.*
+com.github.theyy.*
+com.github.thiagogarbazza.*
+com.github.thiagokimo.*
+com.github.thiagoleitecarvalho.*
+com.github.thiagolocatelli.*
+com.github.thiagonego.*
+com.github.thiagonsilva.*
+com.github.thiagosqr.*
+com.github.thierrysquirrel.*
+com.github.thinker0.*
+com.github.thinker0.heron.*
+com.github.thinker0.metrics.*
+com.github.thinkerou.*
+com.github.thinwonton.mybatismetamodel.*
+com.github.thirdteeth.*
+com.github.thisxulz.*
+com.github.thjomnx.*
+com.github.thomasnield.*
+com.github.thomasridd.*
+com.github.thongtran715.*
+com.github.thonill.*
+com.github.thorbenkuck.*
+com.github.thorbenlindhauer.*
+com.github.thowv.javafxcomps.*
+com.github.threefish.*
+com.github.threefish.nutz.*
+com.github.throwable.beanref.*
+com.github.thspinto.*
+com.github.thssmonkey.*
+com.github.thstock.*
+com.github.thuf.*
+com.github.thuf.application.*
+com.github.thunderroaddotorg.*
+com.github.thunderz99.*
+com.github.tiagompalte.*
+com.github.tianjing.*
+com.github.tianzi94wob.*
+com.github.tibolte.*
+com.github.ticktack.*
+com.github.tiecia.jledcontrol.*
+com.github.tientun.*
+com.github.tigerjayjay.*
+com.github.tigertian.*
+com.github.tiktok-analytics.*
+com.github.tillerino.*
+com.github.tillerino.twirc.*
+com.github.tim-tools.*
+com.github.timabilov.*
+com.github.timawkovandrey.*
+com.github.timeloveboy.*
+com.github.timeu.gwt-libs.dygraphs-gwt.*
+com.github.timeu.gwt-libs.geneviewer.*
+com.github.timeu.gwt-libs.gwasviewer.*
+com.github.timeu.gwt-libs.ldviewer.*
+com.github.timeu.gwt-libs.processingjs-gwt.*
+com.github.timgent.*
+com.github.timic.*
+com.github.timmy80.*
+com.github.timo-reymann.*
+com.github.timofeevda.*
+com.github.timofeevda.jstressy.*
+com.github.timols.*
+com.github.timoteoponce.*
+com.github.timothykim.*
+com.github.timpeeters.*
+com.github.timtimmahh.*
+com.github.timurstrekalov.*
+com.github.timvlaer.*
+com.github.timwspence.*
+com.github.tinawenqiao.*
+com.github.tinesoft.*
+com.github.tinet-wangzb.*
+com.github.tingbob.*
+com.github.tingyugetc520.*
+com.github.tinosteinort.*
+com.github.titisan.*
+com.github.tix-measurements.*
+com.github.tix320.*
+com.github.tja414312570.*
+com.github.tjake.*
+com.github.tjarvstrand.*
+com.github.tjni.beholder.*
+com.github.tjni.captainhook.*
+com.github.tkawachi.*
+com.github.tknudsen.*
+com.github.tkqubo.*
+com.github.tkrs.*
+com.github.tkuenneth.*
+com.github.tkurz.*
+com.github.tkurz.sesame.*
+com.github.tkurz.webjars.*
+com.github.tlrx.*
+com.github.tmarsteel.*
+com.github.tmatek.*
+com.github.tminglei.*
+com.github.tmnd1991.*
+com.github.tmoncorp.*
+com.github.tmyroadctfig.*
+com.github.tnakamot.*
+com.github.tnessn.*
+com.github.tnsasse.*
+com.github.tntim96.*
+com.github.tntkhang.*
+com.github.to-ithaca.*
+com.github.to2mbn.*
+com.github.toanvc.*
+com.github.toastshaman.*
+com.github.tobato.*
+com.github.tobiasbuchholz.*
+com.github.tobiasrm.*
+com.github.tobiasstadler.opentracing.*
+com.github.tobykurien.*
+com.github.tocrhz.*
+com.github.todou.*
+com.github.tohodog.*
+com.github.tomakehurst.*
+com.github.tomas-langer.*
+com.github.tomas-langer.cli.*
+com.github.tomasi26.*
+com.github.tomasmikula.*
+com.github.tomcat-slf4j-logback.*
+com.github.tomeees.*
+com.github.tomitakussaari.*
+com.github.tomjankes.*
+com.github.toml-java.*
+com.github.tommyettinger.*
+com.github.tommyk-gears.*
+com.github.tomnelson.*
+com.github.tomsbee8.*
+com.github.tomschi.*
+com.github.tomseanmy.*
+com.github.tomtom-international.james.*
+com.github.tomtung.*
+com.github.tomtzook.*
+com.github.tomxiong.*
+com.github.tomyeh.*
+com.github.tonethink.*
+com.github.tonilopezmr.*
+com.github.tonivade.*
+com.github.tony19.*
+com.github.tonybaines.*
+com.github.tonyluo.*
+com.github.tonysparks.jslt2.*
+com.github.tonysparks.leola.*
+com.github.toobrien.*
+com.github.tookool.*
+com.github.toolarium.*
+com.github.topikachu.*
+com.github.tornaia.*
+com.github.toromtomtom.*
+com.github.torresmi.*
+com.github.torresmi.remotedata.*
+com.github.toto-castaldi.*
+com.github.toto-castaldi.services.*
+com.github.toto-castaldi.services.restServer.*
+com.github.tototoshi.*
+com.github.totyumengr.*
+com.github.townsfolk.*
+com.github.toyangdon.*
+com.github.tpakula.*
+com.github.tpiecora.*
+com.github.tpucci.*
+com.github.traex.calendarlistview.*
+com.github.traex.expandablelayout.*
+com.github.traex.rippleeffect.*
+com.github.transactpro.*
+com.github.transbankdevelopers.*
+com.github.transcurity.*
+com.github.transformutil.*
+com.github.translocathor.*
+com.github.transoid.*
+com.github.trask.*
+com.github.trask.io.netty.*
+com.github.tratagroup.*
+com.github.traviatasoftware.*
+com.github.travijuu.*
+com.github.traviscrawford.*
+com.github.trd8859.*
+com.github.trecloux.*
+com.github.treeleafj.*
+com.github.treepat.*
+com.github.trentonadams.*
+com.github.trepo.*
+com.github.trevershick.*
+com.github.trex-paxos.*
+com.github.tri-bao.*
+com.github.tribudirb.*
+com.github.triceo.robozonky.*
+com.github.triceo.robozonky.extensions.*
+com.github.triceo.robozonky.installer.*
+com.github.triceo.splitlog.*
+com.github.triceo.zonkybot.*
+com.github.trickl.*
+com.github.trifectalabs.*
+com.github.trilarion.*
+com.github.triplet.gradle.*
+com.github.triplet.simpleprovider.*
+com.github.trixt0r.*
+com.github.troopson.*
+com.github.trows.*
+com.github.troxid.*
+com.github.truechain.*
+com.github.trustbox.*
+com.github.tsantalis.*
+com.github.tsavo.*
+com.github.tsc4j.*
+com.github.tschoohuy.*
+com.github.tschoonj.*
+com.github.tschuchortdev.*
+com.github.tsijercic1.*
+com.github.tsingjyujing.*
+com.github.tsingxiao.*
+com.github.tslamic.*
+com.github.tslamic.adn.*
+com.github.tslamic.fancybackground.*
+com.github.tslamic.premiumer.*
+com.github.tslamic.weakexecutor.*
+com.github.tsohr.*
+com.github.tsouza.promises.*
+com.github.tstout.*
+com.github.tsutomunakamura.ipfilteringtree4j.*
+com.github.tsvdh.*
+com.github.tt-uio.*
+com.github.ttarcher.*
+com.github.tteky.*
+com.github.ttt43ttt.*
+com.github.tuguri8.*
+com.github.tuhe32.*
+com.github.tuk-cps.*
+com.github.tulskiy.*
+com.github.turakar.*
+com.github.turansky.cesium.*
+com.github.turansky.kfc.*
+com.github.turansky.seskar.*
+com.github.turasa.*
+com.github.turdsniffer.*
+com.github.tushardhole.*
+com.github.tuupertunut.*
+com.github.tuxychandru.*
+com.github.tvanderb.*
+com.github.tvinke.*
+com.github.twalcari.*
+com.github.twinkle942910.*
+com.github.twitch4j.*
+com.github.twogoods.*
+com.github.txxs.*
+com.github.tyagihas.*
+com.github.tyler5673.*
+com.github.typeutils.*
+com.github.tyrion9.*
+com.github.tzemp.*
+com.github.tzfun.*
+com.github.tzimisce012.*
+com.github.ua-parser.*
+com.github.ubehebe.*
+com.github.uchephilz.*
+com.github.uchibori3.*
+com.github.ucomdigital.*
+com.github.ucweb.crashsdk.*
+com.github.udioshi85.*
+com.github.udpnarola.*
+com.github.ufofind.*
+com.github.ug-dbg.*
+com.github.uharaqo.*
+com.github.uharaqo.kotlin-hocon-mapper.*
+com.github.uhfun.*
+com.github.uiiang.*
+com.github.uinio.*
+com.github.uinios.*
+com.github.ukase.*
+com.github.ukman.*
+com.github.ukman.kolobok.*
+com.github.ulisesbocchio.*
+com.github.ulwx.*
+com.github.umeshawasthi.*
+com.github.umeshsp.*
+com.github.unafraid.*
+com.github.unafraid.plugins.*
+com.github.unafraid.telegram-apis.*
+com.github.unbound-tech.*
+com.github.unchai.*
+com.github.unclehh.copyMvc.*
+com.github.uncommon-configuration.*
+com.github.underscorenico.*
+com.github.unguiculus.maven.*
+com.github.unidpers.*
+com.github.uniform-java.*
+com.github.uniliva.*
+com.github.unipop-graph.*
+com.github.unive-ssv.*
+com.github.universal-automata.*
+com.github.unix-junkie.*
+com.github.unknownnpc.jsontostring.*
+com.github.unknownnpc.plugins.*
+com.github.unknownnpc.psw.*
+com.github.unlog.*
+com.github.uosdmlab.*
+com.github.uotto.*
+com.github.upachler.mwbmodel.*
+com.github.upers.*
+com.github.upthewaterspout.fates.*
+com.github.uryyyyyyy.*
+com.github.usc.*
+com.github.uscexp.*
+com.github.useful-solutions.*
+com.github.usefulness.*
+com.github.usefulness.testing.screenshot.*
+com.github.usercare.*
+com.github.userswlwork.*
+com.github.ushiosan23.*
+com.github.ustc-infinitelab.*
+com.github.utgarda.*
+com.github.utkarpandey.springProject.*
+com.github.uuidcode.*
+com.github.uw-pharm.*
+com.github.uzrnem.*
+com.github.v-ladynev.*
+com.github.v-play-games.*
+com.github.vaadin-for-grails.*
+com.github.vaadin4qbanos.*
+com.github.vaddipar.*
+com.github.vadeg.*
+com.github.vadims.*
+com.github.vagmcs.*
+com.github.vaibhav-sinha.*
+com.github.vaishnavmhetre.terminsurancecalculator.*
+com.github.valdr.*
+com.github.valfirst.*
+com.github.valfirst.browserup-proxy.*
+com.github.valskalla.*
+com.github.vanatka.*
+com.github.vanbv.*
+com.github.vandeseer.*
+com.github.vangj.*
+com.github.vanlla.*
+com.github.vanroy.*
+com.github.vanspo.*
+com.github.vantonov1.*
+com.github.varchart.*
+com.github.variflight.*
+com.github.vario.*
+com.github.varivoda.*
+com.github.varra4u.*
+com.github.varshaupadhyay.*
+com.github.vase4kin.*
+com.github.vatbub.*
+com.github.vavrcc.*
+com.github.vbartacek.*
+com.github.vbmacher.*
+com.github.vboxnick.*
+com.github.vdubus.*
+com.github.vebqa.*
+com.github.vector4wang.*
+com.github.veddan.*
+com.github.vedenin.*
+com.github.vedenin.atoms.*
+com.github.vegas-viz.*
+com.github.veithen.*
+com.github.veithen.alta.*
+com.github.veithen.checkt.*
+com.github.veithen.cosmos.*
+com.github.veithen.cosmos.bootstrap.*
+com.github.veithen.daemon.*
+com.github.veithen.filecheck.*
+com.github.veithen.invoker.*
+com.github.veithen.maven.*
+com.github.veithen.maven.shared.*
+com.github.veithen.phos.*
+com.github.veithen.rbeans.*
+com.github.veithen.ulog.*
+com.github.veithen.visualwas.*
+com.github.veithen.visualwas.thirdparty.*
+com.github.velvia.*
+com.github.vencent-lu.*
+com.github.vendigo.*
+com.github.venkatesan255.*
+com.github.venkatramanm.*
+com.github.venkatramanm.swf-all.*
+com.github.venth.failsafe.*
+com.github.venth.tools.*
+com.github.venus-ai.*
+com.github.veqryn.*
+com.github.verachadw.*
+com.github.verbalexpressions.*
+com.github.vergenzt.*
+com.github.vergil-ong.*
+com.github.verifalia.*
+com.github.vertical-blank.*
+com.github.vertigobr.ipaas.*
+com.github.verylazyboy.*
+com.github.verytouch.vkit.*
+com.github.vfro.*
+com.github.vgalloy.*
+com.github.vh.*
+com.github.vhall.android.base.*
+com.github.vhall.android.library.*
+com.github.vhall.sdk.*
+com.github.vhall.sdk.dingdangsdk.*
+com.github.vhall.sdk.financeSecuritiesSdk.*
+com.github.vhall.sdk.foundersc_sdk.*
+com.github.vhall.sdk.guosen_sdk.*
+com.github.vhall.sdk.standard_sdk.*
+com.github.vhall.sdk.yinhesdk.*
+com.github.vhall.thirdsdk.*
+com.github.vhmeirelles.*
+com.github.viapp.*
+com.github.vibraedge.*
+com.github.vic317yeh.*
+com.github.vicenthy.filehelpers4j.*
+com.github.vicianm.*
+com.github.vicidroiddev.*
+com.github.vickumar1981.*
+com.github.viclovsky.*
+com.github.vicpara.*
+com.github.vicpinm.*
+com.github.victools.*
+com.github.victor-paltz.*
+com.github.victormpcmun.*
+com.github.victornoel.eo.*
+com.github.vidyard.*
+com.github.vielasis.*
+com.github.viethoa.*
+com.github.vignesh-iopex.*
+com.github.vignesh-s.*
+com.github.vigossq.*
+com.github.vihtarb.*
+com.github.viise.papka.*
+com.github.viise.stena.*
+com.github.vijay2win.*
+com.github.vikram1992.*
+com.github.viktority.*
+com.github.villadora.*
+com.github.villanianalytics.unsql.*
+com.github.vilmosnagy.elq.*
+com.github.vimfung.luascriptcore.*
+com.github.vincent-fuchs.*
+com.github.vincent-zurczak.*
+com.github.vincentfk.*
+com.github.vincentk.*
+com.github.vincentrussell.*
+com.github.vindell.*
+com.github.vineey.*
+com.github.vinhkhuc.*
+com.github.vinitius.*
+com.github.vinitsolanki.*
+com.github.vinoth5595.*
+com.github.vioao.*
+com.github.vip-zpf.*
+com.github.vipcchua.*
+com.github.vipulasri.*
+com.github.vipulasri.layouttoimage.*
+com.github.virtualcry.*
+com.github.virtuald.*
+com.github.virusdave.*
+com.github.virusdave.scalapb.zio-grpc.*
+com.github.visionaryappdev.*
+com.github.visket.*
+com.github.viswaramamoorthy.*
+com.github.vital-software.*
+com.github.vitaliihonta.*
+com.github.vitaliylevashin.*
+com.github.vitalyros.*
+com.github.vitess.*
+com.github.vitopn.*
+com.github.vitormota.*
+com.github.vivchar.*
+com.github.vivekkothari.*
+com.github.vixxx123.*
+com.github.viyadb.*
+com.github.vizaizai.*
+com.github.vizghar.circularview.*
+com.github.vjuge.*
+com.github.vjuranek.beaker4j.*
+com.github.vkorchik.*
+com.github.vkorobkov.*
+com.github.vkovalchuk.*
+com.github.vlachenal.*
+com.github.vlad2.*
+com.github.vladdossik.*
+com.github.vladimir-bukhtoyarov.*
+com.github.vladimirantin.*
+com.github.vladislavgoltjajev.*
+com.github.vladislavsevruk.*
+com.github.vladsige.*
+com.github.vladvysotsky.*
+com.github.vldrus.*
+com.github.vlmap.*
+com.github.vlsi.checksum-dependency.*
+com.github.vlsi.compactmap.*
+com.github.vlsi.crlf.*
+com.github.vlsi.gettext.*
+com.github.vlsi.gradle-extensions.*
+com.github.vlsi.gradle.*
+com.github.vlsi.ide.*
+com.github.vlsi.jandex.*
+com.github.vlsi.license-gather.*
+com.github.vlsi.mxgraph.*
+com.github.vlsi.pru.*
+com.github.vlsi.stage-vote-release.*
+com.github.vmazheru.codeless.*
+com.github.vmencik.*
+com.github.vmicelli.*
+com.github.vmironov.jetpack.*
+com.github.vmyasnik.*
+com.github.vnation.*
+com.github.vo-hong-thanh.*
+com.github.voffa.*
+com.github.volodya-lombrozo.*
+com.github.volyihin.*
+com.github.voncount.*
+com.github.vongosling.*
+com.github.vonnagy.*
+com.github.vonrosen.*
+com.github.vooolll.*
+com.github.voplex95.*
+com.github.votoanthuan.*
+com.github.vovapolu.*
+com.github.vowpalwabbit.*
+com.github.vporoxnenko.*
+com.github.vr-f.*
+com.github.vrushofficial.deadheat-lock.*
+com.github.vskrahul.*
+com.github.vsonnier.*
+com.github.vspr-ai.*
+com.github.vsspt.*
+com.github.vtex.*
+com.github.vveloso.*
+com.github.vvidovic.inspektr.*
+com.github.vzakharchenko.*
+com.github.w1tebear.*
+com.github.w4p.*
+com.github.waffle.*
+com.github.waffle.demo.*
+com.github.wagnerfonseca.*
+com.github.wagzhi.*
+com.github.waikato.*
+com.github.waikato.thirdparty.*
+com.github.wajda.*
+com.github.wakingrufus.*
+com.github.waleed-anjum.*
+com.github.walkersneps.sneps.utils.*
+com.github.walterfan.*
+com.github.walternyeko.*
+com.github.wandersnail.*
+com.github.wang007.*
+com.github.wangChen2345.*
+com.github.wangcanfeng01.*
+com.github.wangdasong.*
+com.github.wangdy.*
+com.github.wanggit.*
+com.github.wangji92.*
+com.github.wangjianxins.*
+com.github.wangjiegulu.*
+com.github.wangmingchang.*
+com.github.wangran99.*
+com.github.wangsongyan.*
+com.github.wangwei86609.*
+com.github.wangwenbincom.*
+com.github.wangxuangege.*
+com.github.wangyanrui.*
+com.github.wangyuheng.*
+com.github.wangzaixiang.*
+com.github.wangzihaogithub.*
+com.github.warmuuh.*
+com.github.wasiqb.boyka.*
+com.github.wasiqb.coteafs.*
+com.github.watertreestar.*
+com.github.watudou.*
+com.github.wautsns.*
+com.github.wave-zhang.*
+com.github.wavesoftware.*
+com.github.wayis.framework.*
+com.github.wayis.framework.test.*
+com.github.wblancqu.*
+com.github.wcvolcano.arbitrary.*
+com.github.wcy123.*
+com.github.wdguoqu.*
+com.github.weaselflink.*
+com.github.webdevandym.*
+com.github.webdriverextensions.*
+com.github.weblets.*
+com.github.wechatpay-apiv3.*
+com.github.wecking.*
+com.github.wednesday-solutions.*
+com.github.weeb-kun.*
+com.github.weekendwars.*
+com.github.weekens.*
+com.github.wehotel.*
+com.github.weibin268.*
+com.github.weibo1987.*
+com.github.weichun97.*
+com.github.weijj0528.*
+com.github.weisj.*
+com.github.weizhiwen.*
+com.github.wellingr.*
+com.github.wellsb1.*
+com.github.wellusion.*
+com.github.wenbo2018.*
+com.github.wendao76.*
+com.github.wendykierp.*
+com.github.wenerme.mapstruct-extras.*
+com.github.wenerme.postjava.*
+com.github.wenerme.wava.*
+com.github.wenhao.*
+com.github.wensimin.*
+com.github.wenweihu86.raft.*
+com.github.wenweihu86.rpc.*
+com.github.wenzhhu.*
+com.github.wesj.animatedtextview.*
+com.github.wesleyosantos91.*
+com.github.westonpace.jayvee.*
+com.github.wet-boew.*
+com.github.wgbvirtuals.*
+com.github.wglanzer.annosave.*
+com.github.wglanzer.obsoleteaccessors.*
+com.github.wheaties.*
+com.github.whensuc.*
+com.github.while-loop.*
+com.github.whirlwin.*
+com.github.white-sdev.*
+com.github.whitedg.*
+com.github.whsoul.*
+com.github.whuang022ai.*
+com.github.whujack.*
+com.github.whvcse.*
+com.github.whyrising.kedn.*
+com.github.whyrising.recompose.*
+com.github.whyrising.y.*
+com.github.wi101.*
+com.github.wiatec.*
+com.github.wicket-acc.*
+com.github.wideac.*
+com.github.widebase.*
+com.github.wihoho.*
+com.github.wilaszekg.*
+com.github.william-hill-online.*
+com.github.willisju.*
+com.github.willtong.*
+com.github.windriverteam.*
+com.github.winjaychan.*
+com.github.winnepooh.*
+com.github.winsonlim.*
+com.github.winter-cardinal.*
+com.github.winteryoung.*
+com.github.winx402.*
+com.github.winyiwin.*
+com.github.wirechen.*
+com.github.wirthan.*
+com.github.wisdommen.*
+com.github.wisebrains.archetypes.*
+com.github.wiselenium.*
+com.github.witoldsz.*
+com.github.wix-maven.*
+com.github.wizonqalabs.rhino.*
+com.github.wizonsoft.coteafs.*
+com.github.wjc133.*
+com.github.wjhstd.*
+com.github.wjrmffldrhrl.*
+com.github.wjw0315.*
+com.github.wjw465150.*
+com.github.wkangblog.*
+com.github.wkennedy.pubsubly.*
+com.github.wkp111.*
+com.github.wky72.*
+com.github.wlfcolin.*
+com.github.wmacevoy.*
+com.github.wmifsud.sumo.*
+com.github.wmixvideo.*
+com.github.wmlynar.*
+com.github.wmz7year.*
+com.github.wnameless.*
+com.github.wnameless.apt.*
+com.github.wnameless.aws.*
+com.github.wnameless.io.*
+com.github.wnameless.json.*
+com.github.wnameless.jsonapi.*
+com.github.wnameless.math.*
+com.github.wnameless.spring.*
+com.github.wnameless.spring.boot.up.*
+com.github.wnm3.*
+com.github.woerry.*
+com.github.wohatel.*
+com.github.woki.*
+com.github.wokier.*
+com.github.wokier.notify-test-progress.*
+com.github.wokier.progress-maven-plugin.*
+com.github.wolf480pl.*
+com.github.wolf480pl.maven-plugins.*
+com.github.wongelz.*
+com.github.wonwoo.*
+com.github.woojiahao.*
+com.github.wookietreiber.*
+com.github.wookietreiber.sfreechart.*
+com.github.woonsan.*
+com.github.woostju.*
+com.github.wooyme.*
+com.github.workerframework.*
+com.github.workerframework.messagebuilder.*
+com.github.workerframework.testing.*
+com.github.workhelpers.*
+com.github.workingDog.*
+com.github.workze.*
+com.github.woshikid.*
+com.github.woxiangbo.*
+com.github.woxthebox.*
+com.github.wpic.*
+com.github.wpyuan.*
+com.github.wqr503.*
+com.github.writethemfirst.*
+com.github.wrong-about-everything.*
+com.github.wseemann.*
+com.github.wselwood.*
+com.github.wshackle.*
+com.github.wshunvx.*
+com.github.wsiegenthaler.*
+com.github.wslf.*
+com.github.wslotkin.*
+com.github.wtbian.*
+com.github.wtekiela.*
+com.github.wtyicy.*
+com.github.wu191287278.*
+com.github.wufenyun.*
+com.github.wugenshui.*
+com.github.wuic.*
+com.github.wuic.extensions.*
+com.github.wuic.plugins.*
+com.github.wujiuye.*
+com.github.wujun234.*
+com.github.wumingsheng.*
+com.github.wumpz.*
+com.github.wustring.*
+com.github.wustrive2008.*
+com.github.wuxinbo.*
+com.github.wuxingyun.*
+com.github.wuyanlin.*
+com.github.wuyanzuplus.*
+com.github.wuyongfei-1.*
+com.github.wvanderdeijl.*
+com.github.wvengen.*
+com.github.ww2510095.*
+com.github.wwadge.*
+com.github.wwytake.*
+com.github.wxiaoqi.*
+com.github.wxisme.*
+com.github.wxpay.*
+com.github.wyd1248.*
+com.github.wydcn.*
+com.github.wyhb.joe.*
+com.github.wyukawa.elasticsearch.unofficial.jdbc.driver.*
+com.github.wywuzh.*
+com.github.wyy0117.*
+com.github.wz2cool.*
+com.github.wzc789376152.*
+com.github.x-hansong.*
+com.github.x25.*
+com.github.x4121.*
+com.github.xabgesagtx.*
+com.github.xaguzman.*
+com.github.xandb.*
+com.github.xandb.utils.*
+com.github.xapn.*
+com.github.xapptree.*
+com.github.xbynet.*
+com.github.xchendeveloper.*
+com.github.xcriptor.*
+com.github.xdcrafts.*
+com.github.xdyuchen.*
+com.github.xealredan.*
+com.github.xedin.*
+com.github.xemiru.*
+com.github.xemiru.sponge.*
+com.github.xenoby.*
+com.github.xeroapi.*
+com.github.xetorthio.*
+com.github.xfslove.*
+com.github.xfumihiro.data-inspector.*
+com.github.xfumihiro.rxbinding.*
+com.github.xfumihiro.view-inspector.*
+com.github.xg704863664.*
+com.github.xgp.*
+com.github.xh32t03.framework.*
+com.github.xian.*
+com.github.xiangtailiang.*
+com.github.xiangtailiang.tablayout.*
+com.github.xiangwangjianghu.*
+com.github.xiangweiJohn.*
+com.github.xianyujava.*
+com.github.xiao1wang.*
+com.github.xiao1wang.poitlextended.*
+com.github.xiaobingzhou.*
+com.github.xiaochong.*
+com.github.xiaocitiao.*
+com.github.xiaodongliang.*
+com.github.xiaodongw.*
+com.github.xiaofan1519.*
+com.github.xiaojoin.*
+com.github.xiaoliang0227.*
+com.github.xiaoluo1314.*
+com.github.xiaolyuh.*
+com.github.xiaoping1988.spring.boot.*
+com.github.xiaosalanqiao.*
+com.github.xiaour.*
+com.github.xiaoxiaoreader.*
+com.github.xiaoymin.*
+com.github.xiaoyuge5201.*
+com.github.xiaozhiliaoo.*
+com.github.xiaozhukk.*
+com.github.xiashuai-mr.*
+com.github.xidaokun.*
+com.github.xiefusi.*
+com.github.xiepengchong.*
+com.github.xincao9.*
+com.github.xingePush.*
+com.github.xingfudeshi.*
+com.github.xingshuangs.*
+com.github.xingyuezhiyun.*
+com.github.xinlc.*
+com.github.xinput123.*
+com.github.xinxiaomu.*
+com.github.xionghuicoder.*
+com.github.xiongxcodes.*
+com.github.xiprox.errorview.*
+com.github.xiprox.markview.*
+com.github.xiprox.simpleratingview.*
+com.github.xiqe.*
+com.github.xitren.data.*
+com.github.xitren.fx.*
+com.github.xitren.graph.*
+com.github.xiuyexye.*
+com.github.xiwh.*
+com.github.xiyuan-fengyu.*
+com.github.xjavathehutt.*
+com.github.xjch.*
+com.github.xjj59307.*
+com.github.xjtushilei.*
+com.github.xjzrc.spring.boot.*
+com.github.xkzhangsan.*
+com.github.xla145.*
+com.github.xlmkit.*
+com.github.xlongshu.maven.*
+com.github.xmarcusv.*
+com.github.xmlet.*
+com.github.xmybatis.*
+com.github.xmzkteco01.*
+com.github.xnart.yandextranslatorapi.*
+com.github.xpenatan.gdx-teavm.*
+com.github.xpenatan.jParser.*
+com.github.xphsc.*
+com.github.xpleaf.*
+com.github.xplosunn.*
+com.github.xprt64.*
+com.github.xqiangme.*
+com.github.xr2117.*
+com.github.xs0529.*
+com.github.xseris.jca.*
+com.github.xsflyblue.*
+com.github.xsi640.*
+com.github.xsonorg.*
+com.github.xu42.*
+com.github.xu6148152.Frameplayer.*
+com.github.xua744531854.*
+com.github.xuanyue202.*
+com.github.xuchen93.*
+com.github.xucheng-330.*
+com.github.xuchengen.*
+com.github.xuechuan3411.*
+com.github.xuejike.*
+com.github.xuerong.*
+com.github.xujiaji.*
+com.github.xujiaji.mk.*
+com.github.xujlibs.*
+com.github.xuwei-k.*
+com.github.xuyongkeji.*
+com.github.xuyuansheng.*
+com.github.xwine.*
+com.github.xxdxxs.*
+com.github.xxl6097.*
+com.github.xxscloud5722.*
+com.github.xynga.build.*
+com.github.xyyxhcj.*
+com.github.xyz-fly.*
+com.github.xzchaoo.*
+com.github.xzh0324.*
+com.github.y-moriguchi.*
+com.github.y-yu.*
+com.github.yadickson.*
+com.github.yafeiwang1240.*
+com.github.yafna.raspberry.*
+com.github.yairharel81.*
+com.github.yakivy.*
+com.github.yalinhuang.*
+com.github.yametech.*
+com.github.yamin8000.*
+com.github.yamingd.*
+com.github.yamingd.android.*
+com.github.yamingd.argo.*
+com.github.yamingd.qpush.*
+com.github.yan-lang.*
+com.github.yanana.*
+com.github.yanceking.*
+com.github.yang69.*
+com.github.yanghyu.*
+com.github.yangjiacheng.*
+com.github.yangjianzhou.*
+com.github.yanglifan.navi.*
+com.github.yangtu222.*
+com.github.yangweigbh.*
+com.github.yangyichao-mango.*
+com.github.yangyugang.*
+com.github.yangzc.*
+com.github.yanirta.*
+com.github.yannick-mayeur.*
+com.github.yannick-mayeur.mvnTest.*
+com.github.yannrichet.*
+com.github.yantingji.*
+com.github.yanyi5496.*
+com.github.yanzongpro.*
+com.github.yaoakeji.*
+com.github.yaoguoh.*
+com.github.yaooqinn.*
+com.github.yaroslav-orel.*
+com.github.yasenagat.*
+com.github.yazidjanati.*
+com.github.ydespreaux.spring.data.*
+com.github.ydespreaux.testcontainers.*
+com.github.ydespreaux.testcontainers.kafka.test.*
+com.github.yedp.*
+com.github.yeecode.dynamicdatasource.*
+com.github.yeecode.matrixauth.*
+com.github.yeecode.objectLogger.*
+com.github.yeecode.objectLogger.server.*
+com.github.yeecode.objectlogger.*
+com.github.yegorbabarykin.*
+com.github.yeksignal.*
+com.github.yelong0216.*
+com.github.yelong0216.dream.first.*
+com.github.yelong0216.dream.first.product.dataferry.*
+com.github.yelong0216.labbol.*
+com.github.yelzhasdev.*
+com.github.yenole.*
+com.github.yev.*
+com.github.yevheniivalkovskyi.*
+com.github.yfcai.*
+com.github.yferras.*
+com.github.yfhe2.*
+com.github.ygimenez.*
+com.github.yhcheng.ppc64native.*
+com.github.yhl452493373.*
+com.github.yhqy.*
+com.github.yiding-he.*
+com.github.yihaijun.*
+com.github.yihtserns.*
+com.github.yihukurama.*
+com.github.yijiue.*
+com.github.yimun.*
+com.github.yin.cli.*
+com.github.yin.flags.*
+com.github.yinfujing.*
+com.github.yingzhuo.*
+com.github.yinlou.*
+com.github.yinqiantong.*
+com.github.yishenggudou.*
+com.github.yitter.*
+com.github.yituhealthcare.*
+com.github.yiuman.*
+com.github.yiwangqingshui.*
+com.github.yiyan1992.*
+com.github.yiyingcanfeng.*
+com.github.yizhishang.*
+com.github.yizzuide.*
+com.github.yjagdale.webdriverutil.*
+com.github.yjgbg.*
+com.github.yjpan51020.*
+com.github.ykechan.*
+com.github.ykiselev.*
+com.github.ykrank.*
+com.github.ykrapiva.eventmap.*
+com.github.ykrasik.*
+com.github.ylegat.*
+com.github.ylgrgyq.*
+com.github.ymonnier.sql-helper.*
+com.github.ymstars.*
+com.github.ynfeng.*
+com.github.yoanngoular.*
+com.github.yoep.*
+com.github.yogurt-dev.*
+com.github.yoharaja.*
+com.github.yohayg.*
+com.github.yohohaha.*
+com.github.yonatankahana.*
+com.github.yonathan95.*
+com.github.yongchristophertang.*
+com.github.yongjacky.*
+com.github.yongshuaiji.*
+com.github.yongyongwang.*
+com.github.yoojia.*
+com.github.yooryan.*
+com.github.yordan-desta.*
+com.github.york-deng.*
+com.github.yoshiyoshifujii.*
+com.github.younesrahimi.*
+com.github.youngce.*
+com.github.youtongluan.*
+com.github.youwenwu.*
+com.github.youyinnn.*
+com.github.youyouxi.*
+com.github.youzan.*
+com.github.youziku.*
+com.github.yqy7.*
+com.github.yracnet.captcha.*
+com.github.yracnet.formatter.*
+com.github.yracnet.maven.*
+com.github.yracnet.zenkata.*
+com.github.yroffin.*
+com.github.yruslan.*
+com.github.ysnnuan.*
+com.github.ytai.ioio.*
+com.github.ytjojo.*
+com.github.ytjojo.retrofitex.*
+com.github.ytjojo.scrollmaster.*
+com.github.ytjojo.supernestedlayout.*
+com.github.yu-jay.*
+com.github.yu1234.JFinalPluginExt.*
+com.github.yuancihang.*
+com.github.yuanmomo.*
+com.github.yuantanchongzi.*
+com.github.yuanxy.*
+com.github.yuchi.*
+com.github.yuebinyun.debug-badge.*
+com.github.yugj.*
+com.github.yuizho.*
+com.github.yujiaao.*
+com.github.yujiaao.ictclas4j.*
+com.github.yujiaao.spring2ts.*
+com.github.yujintao529.*
+com.github.yukuku.*
+com.github.yulichang.*
+com.github.yumengliu.*
+com.github.yunchaoyun.*
+com.github.yundom.*
+com.github.yungyu16.*
+com.github.yungyu16.maven.*
+com.github.yungyu16.spring.*
+com.github.yungyu16.toolkit.*
+com.github.yunusmete.stf.*
+com.github.yunwjr.*
+com.github.yunyunhei.androidlibrary.*
+com.github.yunyunhei.minetestlibiary.*
+com.github.yurivasques.*
+com.github.yuxiangping.*
+com.github.yuxiaobin.*
+com.github.yuyenews.*
+com.github.yvasyliev.*
+com.github.ywchang.*
+com.github.ywelsch.*
+com.github.ywilkof.*
+com.github.yyc123xn.*
+com.github.yydf.*
+com.github.yydzxz.*
+com.github.yylingyun.*
+com.github.yzcheng90.*
+com.github.z-pro.*
+com.github.z3d1k.*
+com.github.z593492734.*
+com.github.z65600305.*
+com.github.zabawaba99.*
+com.github.zabetak.*
+com.github.zach-cloud.*
+com.github.zafarkhaja.*
+com.github.zahimessaoud.*
+com.github.zaihuishou.*
+com.github.zainab-ali.*
+com.github.zakgof.*
+com.github.zambelz48.*
+com.github.zaplatynski.*
+com.github.zaplatynski.testing.*
+com.github.zarkus13.*
+com.github.zavalit.*
+com.github.zavier.*
+com.github.zawataki.*
+com.github.zayim.*
+com.github.zaza.*
+com.github.zc-libre.*
+com.github.zcweng.*
+com.github.zdsiyan.*
+com.github.zdtjss.*
+com.github.zdylalala.*
+com.github.zeab.*
+com.github.zed-platform.*
+com.github.zeger-tak.*
+com.github.zeldigas.*
+com.github.zella.*
+com.github.zengde.*
+com.github.zengfr.*
+com.github.zengfr.conuniframework.*
+com.github.zengfr.platform.*
+com.github.zengfr.project.*
+com.github.zengxf.*
+com.github.zengxueqi-yu.*
+com.github.zeripath.*
+com.github.zerkseez.*
+com.github.zern-king.*
+com.github.zero9102.*
+com.github.zerocode.*
+com.github.zerocodeteam.*
+com.github.zeroleak.*
+com.github.zetten.*
+com.github.zevada.*
+com.github.zfq308.JavaCodeLib.*
+com.github.zg2pro.*
+com.github.zg2pro.copy.*
+com.github.zg2pro.dt.*
+com.github.zg2pro.forks.*
+com.github.zg2pro.formatter.*
+com.github.zgmnkv.*
+com.github.zgqq.*
+com.github.zh79325.*
+com.github.zh9131101.*
+com.github.zhan3333.*
+com.github.zhangchengji.*
+com.github.zhangchunsheng.*
+com.github.zhangdongsheng2.*
+com.github.zhangguangyong.*
+com.github.zhangguoning.plugin.*
+com.github.zhanghecn.*
+com.github.zhanghr.*
+com.github.zhangjianli.*
+com.github.zhangjiemiss.*
+com.github.zhangjinxu.*
+com.github.zhanglei0325.*
+com.github.zhanglei110912230.*
+com.github.zhangpenggh.*
+com.github.zhangquanli.*
+com.github.zhangxd1989.*
+com.github.zhangxianweihebei.*
+com.github.zhangxinhe.*
+com.github.zhangyingwei.*
+com.github.zhangyinhao1234.plugin.*
+com.github.zhangzhizhi.*
+com.github.zhangzhongjun.*
+com.github.zhangzw0505.*
+com.github.zhanhb.*
+com.github.zhanjixun.*
+com.github.zhaodong1106.*
+com.github.zhaohai1299002788.*
+com.github.zhaojiacan.*
+com.github.zhaoxiufei.*
+com.github.zhaoyao.*
+com.github.zhaoyunqi.*
+com.github.zheh12.*
+com.github.zheng93775.*
+com.github.zhengframework.*
+com.github.zhengjiajin.*
+com.github.zhengyoxin.*
+com.github.zhengyuyzhao.*
+com.github.zhengzhanpeng.*
+com.github.zherebjatjew.*
+com.github.zheshandonglu.*
+com.github.zhhe-me.*
+com.github.zhicwu.*
+com.github.zhiqiang94.*
+com.github.zhixiangyuan.*
+com.github.zhkl0228.*
+com.github.zhongjiqiang.*
+com.github.zhongl.*
+com.github.zhou6ang.framework.*
+com.github.zhoumingjiejie.*
+com.github.zhouxuanGithub.*
+com.github.zhouyinyan.*
+com.github.zhubo812.*
+com.github.zhuchao941.*
+com.github.zhuchinskyi.*
+com.github.zhujiebing.*
+com.github.zhujk.*
+com.github.zhuobinchan.*
+com.github.zhusir.*
+com.github.zhuxingxing.*
+com.github.zhuyb0614.*
+com.github.zhuyizhuo.*
+com.github.zhve.*
+com.github.zhxuebest.*
+com.github.zhycn.*
+com.github.zhzephi.*
+com.github.zijan.*
+com.github.zington.*
+com.github.ziplet.*
+com.github.zipu888.*
+com.github.zj-dreamly.*
+com.github.zjb-it.*
+com.github.zjulzq.*
+com.github.zjupure.*
+com.github.zjywill.*
+com.github.zjzcn.*
+com.github.zk1023lang.*
+com.github.zk1931.*
+com.github.zkoalas.*
+com.github.zlcb.*
+com.github.zlt2000.*
+com.github.zlzz-rec.*
+com.github.zm-dev.*
+com.github.zmzhou-star.*
+com.github.znacloud.*
+com.github.zomato.*
+com.github.zomin.*
+com.github.zon-g.*
+com.github.zonev.*
+com.github.zongzhang.*
+com.github.zou8944.*
+com.github.zouchongjin.*
+com.github.zoulejiu.*
+com.github.zouyq.*
+com.github.zoxzo.*
+com.github.zqchen-open.*
+com.github.zqq90.webit-script.*
+com.github.zrrobbins.*
+com.github.zsls-lang.*
+com.github.zsxneil.*
+com.github.ztan.ezy-locality.*
+com.github.zthulj.*
+com.github.ztq2016.*
+com.github.zuacaldeira.*
+com.github.zugaldia.noaa.*
+com.github.zuihou.*
+com.github.zuinnote.*
+com.github.zuochunsheng.*
+com.github.zurekp.*
+com.github.zutherb.gradle.*
+com.github.zw201913.*
+com.github.zwaldeck.*
+com.github.zwluo.*
+com.github.zxhTom.*
+com.github.zxhr.*
+com.github.zxhtom.*
+com.github.zxl0714.*
+com.github.zxmsdyz.*
+com.github.zyndev.*
+com.github.zyroy.*
+com.github.zywaiting.*
+com.github.zyzxxx.*
+com.github.zz666zz.*
+com.github.zzlhy.*
+com.github.zzt93.*
+com.github.zzwloves.*
+com.github.zzycjcg.*
+com.github.zzzzbw.*
+com.githup.liuyanggithup.*
+com.gitlab.*
+com.gitlab.9lukas5.*
+com.gitlab.ali36766.*
+com.gitlab.ali36766.sdk.*
+com.gitlab.allsimon.quickcheck.*
+com.gitlab.autofeedback.*
+com.gitlab.baniyaavaya.*
+com.gitlab.bennodev.*
+com.gitlab.bessemer.*
+com.gitlab.bhamilton.*
+com.gitlab.bigyantest.*
+com.gitlab.bsarter.belote.*
+com.gitlab.buger-od-ua.*
+com.gitlab.ccook.*
+com.gitlab.cdc-java.applic.*
+com.gitlab.cdc-java.deps.*
+com.gitlab.cdc-java.graphs.*
+com.gitlab.cdc-java.gv.*
+com.gitlab.cdc-java.impex.*
+com.gitlab.cdc-java.imports.*
+com.gitlab.cdc-java.io.*
+com.gitlab.cdc-java.issues.*
+com.gitlab.cdc-java.kernel.*
+com.gitlab.cdc-java.mf.*
+com.gitlab.cdc-java.office.*
+com.gitlab.cdc-java.perfs.*
+com.gitlab.cdc-java.pstrings.*
+com.gitlab.cdc-java.rdb.*
+com.gitlab.cdc-java.tuples.*
+com.gitlab.cdc-java.ui.*
+com.gitlab.cdc-java.util.*
+com.gitlab.chrisapps.*
+com.gitlab.cocommtech.*
+com.gitlab.colorata.*
+com.gitlab.dmtiryae.*
+com.gitlab.doeurnlab.*
+com.gitlab.dumonts.*
+com.gitlab.equusmonopectoralis.*
+com.gitlab.grout.*
+com.gitlab.haynes.*
+com.gitlab.haynes.paranamer.*
+com.gitlab.hinunbi.*
+com.gitlab.htcgroup.*
+com.gitlab.htcgroup.common.*
+com.gitlab.janecekpetr.*
+com.gitlab.java-ebms-adapter.*
+com.gitlab.java-heroes.*
+com.gitlab.jelondoca.*
+com.gitlab.jhonsapp.*
+com.gitlab.johnjvester.*
+com.gitlab.katsella.*
+com.gitlab.klamonte.*
+com.gitlab.lae.feistel.*
+com.gitlab.lae.gentext.*
+com.gitlab.lae.isomorphic.*
+com.gitlab.lae.stack.source.*
+com.gitlab.lema-suite.*
+com.gitlab.lozsvart.*
+com.gitlab.marvinh.*
+com.gitlab.matero.*
+com.gitlab.mattldulany.*
+com.gitlab.mercur3.*
+com.gitlab.morality.*
+com.gitlab.mvysny.apache-uribuilder.*
+com.gitlab.mvysny.icloud-photo-public-share.*
+com.gitlab.mvysny.jdbiorm.*
+com.gitlab.mvysny.jputils.*
+com.gitlab.mvysny.konsume-xml.*
+com.gitlab.mvysny.owmcityfinder.*
+com.gitlab.mvysny.slf4j.*
+com.gitlab.nopparat.*
+com.gitlab.oliverlj.*
+com.gitlab.ovidiucondrache.*
+com.gitlab.plantd.*
+com.gitlab.pointlessbox.*
+com.gitlab.privatik.publishtest.*
+com.gitlab.projectn-oss.*
+com.gitlab.rafoufoun.*
+com.gitlab.ragnese.*
+com.gitlab.samarkand-nomad.*
+com.gitlab.sashatkachov91.*
+com.gitlab.servertoolsbot.util.*
+com.gitlab.sharebear.*
+com.gitlab.siege-insights.*
+com.gitlab.smueller18.gitlab.*
+com.gitlab.spacetrucker.*
+com.gitlab.spring-boot-starters.*
+com.gitlab.spring-cloud-rest-connector.*
+com.gitlab.stevendobay.*
+com.gitlab.summer-cattle.*
+com.gitlab.taucher2003.*
+com.gitlab.taucher2003.t2003-utils.*
+com.gitlab.test-requester.*
+com.gitlab.testellator.*
+com.gitlab.tguseynov.buildersourcegeneratorlib.*
+com.gitlab.tixtix320.*
+com.gitlab.ts14ic.*
+com.gitlab.virtual-machinist.*
+com.gitlab.yishak.abraham.*
+com.givenocode.carouselpicker.*
+com.gizbel.excel.*
+com.gizwits.*
+com.gizwits.openapi.*
+com.gizwits.www.*
+com.gkatzioura.maven.cloud.*
+com.glancebar.*
+com.glancebar.aliyun.*
+com.glancebar.wechat.*
+com.glassdoor.*
+com.glassdoor.planout4j.*
+com.glasstowerstudios.gruel.*
+com.glazedlists.*
+com.gleantap.android.*
+com.glebfox.*
+com.glia.*
+com.glispa.*
+com.glispa.combo.*
+com.gliwka.hyperscan.*
+com.globallypaid.*
+com.globalmentor.*
+com.globalreachtech.*
+com.globo.aclapi.*
+com.globo.bigdata.*
+com.globo.dnsapi.*
+com.globo.globodns.*
+com.globo.globonetwork.*
+com.globo.graylog2.*
+com.globus-ltd.*
+com.glodon.aecore.*
+com.glodon.aecore.apollo.*
+com.glookast.api.*
+com.glookast.commons.*
+com.glovoapp.android-versioning.*
+com.glovoapp.gradle.*
+com.glovoapp.semantic-versioning.*
+com.glue42.*
+com.glue42.gateway.client.*
+com.glue42.metrics.*
+com.glue42.sticky-windows.*
+com.gluehome.*
+com.gluonhq.*
+com.gluonhq.attach.*
+com.gluonhq.plugin.*
+com.glureau.*
+com.gmail.tsuna0x00.ipfilteringtree4.*
+com.gmaslowski.*
+com.gmongo.*
+com.gmrodrigues.*
+com.gmrodrigues.js.sandbox.*
+com.gnerv.*
+com.gnerv.boot.*
+com.gnizr.*
+com.gnizr.aduna.*
+com.gnosly.*
+com.go2wheel.*
+com.gobistories.*
+com.gocardless.*
+com.gocartpay.*
+com.gocypher.cybench.client.*
+com.gocypher.cybench.launcher.plugin.*
+com.godaddy.*
+com.godaddy.android.colorpicker.*
+com.godaddy.asherah.*
+com.godatadriven.gatling.*
+com.godmonth.*
+com.godmonth.commons.*
+com.godmonth.eth.*
+com.godmonth.openapi.*
+com.godmonth.status.*
+com.godmonth.status2.*
+com.goebl.*
+com.goeuro.*
+com.goeuro.sync4j.*
+com.goforboom.*
+com.goforboom.hubspot.*
+com.gofore.fixme.*
+com.goharsha.*
+com.goikosoft.crawler4j.*
+com.goikosoft.reflection.*
+com.goikosoft.smartscrapper.*
+com.goikosoft.textprocessor.*
+com.goikosoft.utils.*
+com.goinstant.*
+com.gojek.*
+com.gojek.android.*
+com.gojek.clickstream.*
+com.gojek.courier.*
+com.gojek.draftsman.*
+com.gojek.parquet.*
+com.gojuno.hexgrid.*
+com.gojuno.hexgridgeo.*
+com.gojuno.morton.*
+com.goldmansachs.*
+com.goldmansachs.accelrx.*
+com.goldmansachs.jdmn.*
+com.goldmansachs.jrpip.*
+com.goldmansachs.obevo.*
+com.goldmansachs.reladomo.*
+com.goldmansachs.tablasco.*
+com.goldmansachs.xsd2bean.*
+com.gollahalli.azure.*
+com.gomcarter.frameworks.*
+com.gomyck.*
+com.goncalossilva.*
+com.gonitro.*
+com.gonvan.*
+com.gooboot.easyandroid.*
+com.gooddata.*
+com.goodow.realtime.*
+com.goodow.vertx.*
+com.google.*
+com.google.acai.*
+com.google.accompanist.*
+com.google.actions.*
+com.google.allenday.*
+com.google.analytics.*
+com.google.android.*
+com.google.android.apps.common.testing.accessibility.framework.*
+com.google.android.apps.dashclock.*
+com.google.android.apps.muzei.*
+com.google.android.catalog.framework.*
+com.google.android.filament.*
+com.google.android.glance.tools.*
+com.google.android.horologist.*
+com.google.android.mobly.*
+com.google.android.tools.*
+com.google.api-ads.*
+com.google.api-client.*
+com.google.api.*
+com.google.api.client.*
+com.google.api.graphql.*
+com.google.api.grpc.*
+com.google.apis.*
+com.google.appengine.*
+com.google.appengine.api.memcache.jsr107cache.*
+com.google.appengine.archetypes.*
+com.google.appengine.demos.*
+com.google.appengine.orm.*
+com.google.appengine.tools.*
+com.google.area120.*
+com.google.auth.*
+com.google.auto.*
+com.google.auto.factory.*
+com.google.auto.service.*
+com.google.auto.value.*
+com.google.budoux.*
+com.google.caliper.*
+com.google.census.*
+com.google.classpath-explorer.*
+com.google.closure-stylesheets.*
+com.google.closure.*
+com.google.cloud.*
+com.google.cloud.artifactregistry.*
+com.google.cloud.bigdataoss.*
+com.google.cloud.bigtable.*
+com.google.cloud.broker.*
+com.google.cloud.buildartifacts.*
+com.google.cloud.dataflow.*
+com.google.cloud.datastore.*
+com.google.cloud.functions.*
+com.google.cloud.functions.invoker.*
+com.google.cloud.genomics.*
+com.google.cloud.graphite.*
+com.google.cloud.healthcare.*
+com.google.cloud.hive.*
+com.google.cloud.opentelemetry.*
+com.google.cloud.samples.*
+com.google.cloud.spark.*
+com.google.cloud.sql.*
+com.google.cloud.tools.*
+com.google.cloud.tools.login.*
+com.google.cloud.trace.*
+com.google.cloud.trace.adapters.zipkin.*
+com.google.cloud.trace.instrumentation.*
+com.google.cloud.trace.instrumentation.jdbc.*
+com.google.cloud.trace.v1.*
+com.google.cloudspannerecosystem.*
+com.google.code.*
+com.google.code.axon-guice.*
+com.google.code.bali-java.*
+com.google.code.bean-matchers.*
+com.google.code.byteseek.*
+com.google.code.cli-parser.*
+com.google.code.cltool4j.*
+com.google.code.crawler-commons.*
+com.google.code.echo-maven-plugin.*
+com.google.code.eforceconfig.*
+com.google.code.externalsortinginjava.*
+com.google.code.facebook-java-api.*
+com.google.code.facebookapi.*
+com.google.code.findbugs.*
+com.google.code.flex-iframe.*
+com.google.code.flex-iframe.examples.*
+com.google.code.flexlib.*
+com.google.code.gaeom.*
+com.google.code.geocoder-java.*
+com.google.code.google-collections.*
+com.google.code.google-proto-simple-reader-writer.*
+com.google.code.greaze.*
+com.google.code.gson.*
+com.google.code.guice-repository.*
+com.google.code.guice-vaadin-mvp.*
+com.google.code.guice.*
+com.google.code.gwt-dnd.*
+com.google.code.gwt-log.*
+com.google.code.gwt-math.*
+com.google.code.gwtsecurity.*
+com.google.code.gwtx.*
+com.google.code.jain-sip-rfc3263-router.*
+com.google.code.java-allocation-instrumenter.*
+com.google.code.java2objc.*
+com.google.code.javaparser.*
+com.google.code.jbpm-guice.*
+com.google.code.jcaptcha4struts2.*
+com.google.code.jcouchdb.*
+com.google.code.jetm.*
+com.google.code.jgntp.*
+com.google.code.jhtmldiff.*
+com.google.code.jkippt.*
+com.google.code.jlibav.*
+com.google.code.joto.*
+com.google.code.jscep.*
+com.google.code.jsd-maven.*
+com.google.code.liquidform.*
+com.google.code.magja.*
+com.google.code.mathparser-java.*
+com.google.code.matlabcontrol.*
+com.google.code.maven-config-processor-plugin.*
+com.google.code.maven-license-plugin.*
+com.google.code.maven-play-plugin.*
+com.google.code.maven-play-plugin.com.asual.lesscss.*
+com.google.code.maven-play-plugin.com.github.branaway.japid.*
+com.google.code.maven-play-plugin.com.github.yeungda.jcoffeescript.*
+com.google.code.maven-play-plugin.com.google.code.eamelink-mockito.*
+com.google.code.maven-play-plugin.com.google.code.morphia.*
+com.google.code.maven-play-plugin.com.jamonapi.*
+com.google.code.maven-play-plugin.com.kjetland.*
+com.google.code.maven-play-plugin.com.mchange.*
+com.google.code.maven-play-plugin.com.sienaproject.siena.*
+com.google.code.maven-play-plugin.hsqldb.*
+com.google.code.maven-play-plugin.net.sf.jtidy.*
+com.google.code.maven-play-plugin.net.sourceforge.cobertura.*
+com.google.code.maven-play-plugin.net.tanesha.recaptcha4j.*
+com.google.code.maven-play-plugin.org.allcolor.shanidom.*
+com.google.code.maven-play-plugin.org.allcolor.yahp.*
+com.google.code.maven-play-plugin.org.apache.commons.*
+com.google.code.maven-play-plugin.org.apache.ddlutils.*
+com.google.code.maven-play-plugin.org.apache.hadoop.*
+com.google.code.maven-play-plugin.org.apache.hbase.*
+com.google.code.maven-play-plugin.org.apache.thrift.*
+com.google.code.maven-play-plugin.org.eclipse.jdt.*
+com.google.code.maven-play-plugin.org.hibernate.*
+com.google.code.maven-play-plugin.org.playframework.*
+com.google.code.maven-play-plugin.org.playframework.modules.accesslog.*
+com.google.code.maven-play-plugin.org.playframework.modules.associations.*
+com.google.code.maven-play-plugin.org.playframework.modules.betterlogs.*
+com.google.code.maven-play-plugin.org.playframework.modules.cobertura.*
+com.google.code.maven-play-plugin.org.playframework.modules.coffee.*
+com.google.code.maven-play-plugin.org.playframework.modules.constretto.*
+com.google.code.maven-play-plugin.org.playframework.modules.crud.*
+com.google.code.maven-play-plugin.org.playframework.modules.db.*
+com.google.code.maven-play-plugin.org.playframework.modules.deadbolt.*
+com.google.code.maven-play-plugin.org.playframework.modules.docviewer.*
+com.google.code.maven-play-plugin.org.playframework.modules.ebean.*
+com.google.code.maven-play-plugin.org.playframework.modules.excel.*
+com.google.code.maven-play-plugin.org.playframework.modules.fastergt.*
+com.google.code.maven-play-plugin.org.playframework.modules.fbgraph.*
+com.google.code.maven-play-plugin.org.playframework.modules.gae.*
+com.google.code.maven-play-plugin.org.playframework.modules.gravatar.*
+com.google.code.maven-play-plugin.org.playframework.modules.grizzly.*
+com.google.code.maven-play-plugin.org.playframework.modules.guice.*
+com.google.code.maven-play-plugin.org.playframework.modules.hazelcast.*
+com.google.code.maven-play-plugin.org.playframework.modules.japid.*
+com.google.code.maven-play-plugin.org.playframework.modules.less.*
+com.google.code.maven-play-plugin.org.playframework.modules.markdown.*
+com.google.code.maven-play-plugin.org.playframework.modules.messages.*
+com.google.code.maven-play-plugin.org.playframework.modules.mockito.*
+com.google.code.maven-play-plugin.org.playframework.modules.morphia.*
+com.google.code.maven-play-plugin.org.playframework.modules.paginate.*
+com.google.code.maven-play-plugin.org.playframework.modules.pdf.*
+com.google.code.maven-play-plugin.org.playframework.modules.postmark.*
+com.google.code.maven-play-plugin.org.playframework.modules.qunit.*
+com.google.code.maven-play-plugin.org.playframework.modules.recaptcha.*
+com.google.code.maven-play-plugin.org.playframework.modules.redis.*
+com.google.code.maven-play-plugin.org.playframework.modules.router.*
+com.google.code.maven-play-plugin.org.playframework.modules.sass.*
+com.google.code.maven-play-plugin.org.playframework.modules.search.*
+com.google.code.maven-play-plugin.org.playframework.modules.secure.*
+com.google.code.maven-play-plugin.org.playframework.modules.securesocial.*
+com.google.code.maven-play-plugin.org.playframework.modules.shibboleth.*
+com.google.code.maven-play-plugin.org.playframework.modules.siena.*
+com.google.code.maven-play-plugin.org.playframework.modules.spring.*
+com.google.code.maven-play-plugin.org.playframework.modules.springtester.*
+com.google.code.maven-play-plugin.org.playframework.modules.table.*
+com.google.code.maven-play-plugin.org.playframework.modules.testrunner.*
+com.google.code.maven-play-plugin.org.playframework.modules.webdrive.*
+com.google.code.maven-play-plugin.org.xhtmlrenderer.*
+com.google.code.maven-play-plugin.postgresql.*
+com.google.code.maven-play-plugin.spy.*
+com.google.code.maven-replacer-plugin.*
+com.google.code.maven-scm-provider-svnjava.*
+com.google.code.maven-svn-revision-number-plugin.*
+com.google.code.maven-svn-wagon.*
+com.google.code.mjl.*
+com.google.code.morphia.*
+com.google.code.narcissus-webtests.*
+com.google.code.ndef-tools-for-android.*
+com.google.code.p.*
+com.google.code.p.arat.*
+com.google.code.play2-maven-plugin.*
+com.google.code.plsqlgateway.*
+com.google.code.plsqlmaven.*
+com.google.code.pomhelper.*
+com.google.code.protoj.*
+com.google.code.reflection-utils.*
+com.google.code.retrovolley.*
+com.google.code.sbt-compiler-maven-plugin.*
+com.google.code.sbtrun-maven-plugin.*
+com.google.code.scoverage-maven-plugin.*
+com.google.code.scriptengines.*
+com.google.code.simple-spring-memcached.*
+com.google.code.simplelrucache.*
+com.google.code.simplestuff.*
+com.google.code.sortpom.*
+com.google.code.spring-crypto-utils.*
+com.google.code.sqlsheet.*
+com.google.code.struts2jscalendarplugin.*
+com.google.code.struts2webflow.*
+com.google.code.svenson.*
+com.google.code.tempus-fugit.*
+com.google.code.tld-generator.*
+com.google.code.tycho-eclipserun-plugin.*
+com.google.code.typica.*
+com.google.code.validationframework.*
+com.google.code.webworkwebflow.*
+com.google.code.xbean.*
+com.google.code.xmltool.*
+com.google.collections.*
+com.google.common.html.types.*
+com.google.common.inject.*
+com.google.crypto.tink.*
+com.google.dagger.*
+com.google.dagger.hilt.android.*
+com.google.devtools.ksp.*
+com.google.dexmaker.*
+com.google.diffable.*
+com.google.doclava.*
+com.google.doubleclick.*
+com.google.elemental2.*
+com.google.endpoints.*
+com.google.enterprise.cloudsearch.*
+com.google.errorprone.*
+com.google.escapevelocity.*
+com.google.fhir.gateway.*
+com.google.firebase.*
+com.google.flatbuffers.*
+com.google.flogger.*
+com.google.gag.*
+com.google.gcloud.*
+com.google.gcm.*
+com.google.gdata.*
+com.google.geometry.*
+com.google.gerrit.*
+com.google.gms.*
+com.google.googlejavaformat.*
+com.google.gradle.*
+com.google.graphite.*
+com.google.gsp.samples.*
+com.google.guava.*
+com.google.guiceberry.*
+com.google.gwt.*
+com.google.gwt.eventbinder.*
+com.google.gwt.google-apis.*
+com.google.gwt.gwtmockito.*
+com.google.gwt.inject.*
+com.google.gxp.*
+com.google.http-client.*
+com.google.identitytoolkit.*
+com.google.inject.*
+com.google.inject.extensions.*
+com.google.inject.integration.*
+com.google.instrumentation.*
+com.google.iot.cbor.*
+com.google.iot.coap.*
+com.google.iot.m2m.*
+com.google.j2objc.*
+com.google.java.contract.*
+com.google.javascript.*
+com.google.jimfs.*
+com.google.jse4conf.*
+com.google.jsilver.*
+com.google.jsinterop.*
+com.google.jstestdriver.*
+com.google.looker-open-source.*
+com.google.maps.*
+com.google.maps.android.*
+com.google.maps.api.grpc.*
+com.google.mockwebserver.*
+com.google.modernstorage.*
+com.google.monitoring-client.*
+com.google.mug.*
+com.google.myanmartools.*
+com.google.oauth-client.*
+com.google.okhttp.*
+com.google.openlocationcode.*
+com.google.openrtb.*
+com.google.ortools.*
+com.google.pay.button.*
+com.google.pdsl.*
+com.google.photos.library.*
+com.google.privacy.*
+com.google.privacy.differentialprivacy.*
+com.google.protobuf.*
+com.google.protobuf.nano.*
+com.google.pubsub.*
+com.google.re2j.*
+com.google.scm.svnjava.*
+com.google.security.*
+com.google.semanticlocators.*
+com.google.sgnodemapper.*
+com.google.sitebricks.*
+com.google.streetview.publish.*
+com.google.summit.*
+com.google.template.*
+com.google.testability-explorer.*
+com.google.testing.compile.*
+com.google.testparameterinjector.*
+com.google.transit.*
+com.google.truth.*
+com.google.truth.extensions.*
+com.google.tsunami.*
+com.google.uzaygezen.*
+com.google.visualization.*
+com.google.wallet.button.*
+com.google.web.bindery.*
+com.google.zetasketch.*
+com.google.zetasql.*
+com.google.zetasql.toolkit.*
+com.google.zxing.*
+com.googlecode.*
+com.googlecode.aaw.badgerfish.*
+com.googlecode.addjars-maven-plugin.*
+com.googlecode.aic-expresso.*
+com.googlecode.aic-praise.*
+com.googlecode.aic-util.*
+com.googlecode.aima-java.*
+com.googlecode.ajui.*
+com.googlecode.alfresco-repository-extensions.*
+com.googlecode.amssupport.*
+com.googlecode.android-player-root-archetype.*
+com.googlecode.android-query.*
+com.googlecode.android-wheel.*
+com.googlecode.androidannotations.*
+com.googlecode.apparat.*
+com.googlecode.appassembler-maven-plugin.*
+com.googlecode.armbrust-file-utils.*
+com.googlecode.autoincrement.*
+com.googlecode.aviator.*
+com.googlecode.backport-spi.*
+com.googlecode.batchfb.*
+com.googlecode.blacken.*
+com.googlecode.blaisemath.*
+com.googlecode.boost-maven-project.*
+com.googlecode.cassandra-jca.*
+com.googlecode.catch-exception.*
+com.googlecode.cedar-common.*
+com.googlecode.cernunnos.*
+com.googlecode.charpa.*
+com.googlecode.charpa.charpa-wicket.*
+com.googlecode.charts4j.*
+com.googlecode.cirrostratus.*
+com.googlecode.classgenerator.*
+com.googlecode.classgrep.*
+com.googlecode.clearnlp.*
+com.googlecode.clichemaven.*
+com.googlecode.clj4j.*
+com.googlecode.cmake-maven-project.*
+com.googlecode.combinatoricslib.*
+com.googlecode.concurrent-locks.*
+com.googlecode.concurrent-trees.*
+com.googlecode.concurrentlinkedhashmap.*
+com.googlecode.cqengine.*
+com.googlecode.crowdin-maven.*
+com.googlecode.data-object-generator.*
+com.googlecode.datainstiller.*
+com.googlecode.disruptor.*
+com.googlecode.dummyjdbc.*
+com.googlecode.dynaspring.*
+com.googlecode.easymockrule.*
+com.googlecode.efficient-java-matrix-library.*
+com.googlecode.ehcache-spring-annotations.*
+com.googlecode.entreri.*
+com.googlecode.etl-unit.*
+com.googlecode.eventio.*
+com.googlecode.events-on-fire.*
+com.googlecode.excavator.*
+com.googlecode.ez-vcard.*
+com.googlecode.fannj.*
+com.googlecode.fighting-layout-bugs.*
+com.googlecode.flexistate.*
+com.googlecode.flickrj-android.*
+com.googlecode.fluido-skin.*
+com.googlecode.flyway-test-extensions.*
+com.googlecode.flyway.*
+com.googlecode.fmpp-dataloaders.*
+com.googlecode.fmpp-maven-plugin.*
+com.googlecode.foresite-toolkit.*
+com.googlecode.funcito.*
+com.googlecode.functional-collections.*
+com.googlecode.gant-ext.*
+com.googlecode.gazpacho-examples.*
+com.googlecode.gbench.*
+com.googlecode.gendevcode.*
+com.googlecode.genericdao.*
+com.googlecode.genproject.*
+com.googlecode.gentyref.*
+com.googlecode.gettext-commons.*
+com.googlecode.gflot.*
+com.googlecode.gmail4j.*
+com.googlecode.googleplus.*
+com.googlecode.grep4j.*
+com.googlecode.gstreamer-java.*
+com.googlecode.guava-osgi.*
+com.googlecode.guice-autoreg.*
+com.googlecode.guice-junit4.*
+com.googlecode.gwt-action.*
+com.googlecode.gwt-charts.*
+com.googlecode.gwt-cropper.*
+com.googlecode.gwt-crypto.*
+com.googlecode.gwt-measure.*
+com.googlecode.gwt-proxy-servlet.*
+com.googlecode.gwt-streamer.*
+com.googlecode.gwt-table-to-excel.*
+com.googlecode.gwt-test-utils.*
+com.googlecode.gwt-usefull-logging.*
+com.googlecode.gwt-validation.*
+com.googlecode.gwt.inject.*
+com.googlecode.gwtcodemirror.*
+com.googlecode.gwtphonegap.*
+com.googlecode.gwtquery.*
+com.googlecode.gwtrpcplus.*
+com.googlecode.gwtupload.*
+com.googlecode.gwtutils.*
+com.googlecode.hiberpcml.*
+com.googlecode.horkizein.*
+com.googlecode.hs4j.*
+com.googlecode.htmlcompressor.*
+com.googlecode.httpliar.*
+com.googlecode.i18n-maven-plugin.*
+com.googlecode.ibaguice.*
+com.googlecode.ibaguice.cache.*
+com.googlecode.ibaguice.datasource.*
+com.googlecode.icegem.*
+com.googlecode.ictclas4j.*
+com.googlecode.injectlet.*
+com.googlecode.instinct.*
+com.googlecode.jace.*
+com.googlecode.jaitools.*
+com.googlecode.jannocessor.*
+com.googlecode.janrain4j.*
+com.googlecode.japi-checker.*
+com.googlecode.japis.*
+com.googlecode.jarjar.*
+com.googlecode.jasima.*
+com.googlecode.jatl.*
+com.googlecode.java-bit-arrays.*
+com.googlecode.java-cl-parser.*
+com.googlecode.java-diff-utils.*
+com.googlecode.java-ipv6.*
+com.googlecode.javacpp.*
+com.googlecode.javaeeutils.*
+com.googlecode.javaewah.*
+com.googlecode.jaxb-namespaceprefixmapper-interfaces.*
+com.googlecode.jazure.*
+com.googlecode.jbp.*
+com.googlecode.jcamp-dx.*
+com.googlecode.jchord.*
+com.googlecode.jcsv.*
+com.googlecode.jctree.*
+com.googlecode.jdatatables.*
+com.googlecode.jdbc-proc.*
+com.googlecode.jdbc-proc.jdbc-proc.*
+com.googlecode.jdbw.*
+com.googlecode.jeeunit.*
+com.googlecode.jen-api.*
+com.googlecode.jfilechooser-bookmarks.*
+com.googlecode.jfreesane.*
+com.googlecode.jgenhtml.*
+com.googlecode.jhocr.*
+com.googlecode.jinahya.*
+com.googlecode.jmapper-framework.*
+com.googlecode.jmcnet.*
+com.googlecode.jmockit.*
+com.googlecode.jpattern.*
+com.googlecode.jperipheral.*
+com.googlecode.jslint4java.*
+com.googlecode.jsmpp.*
+com.googlecode.json-simple.*
+com.googlecode.jsonschema2pojo.*
+com.googlecode.jsontoken.*
+com.googlecode.jsonwebservice.*
+com.googlecode.jsslutils.*
+com.googlecode.jstd-maven-plugin.*
+com.googlecode.jtype.*
+com.googlecode.juffrou.*
+com.googlecode.junice.*
+com.googlecode.junit-toolbox.*
+com.googlecode.juniversalchardet.*
+com.googlecode.jweb1t.*
+com.googlecode.jxquery.*
+com.googlecode.kevinarpe-papaya-swing.*
+com.googlecode.kevinarpe-papaya.*
+com.googlecode.kiama.*
+com.googlecode.komarro.*
+com.googlecode.l10n-maven-plugin.*
+com.googlecode.lambdaj.*
+com.googlecode.lanterna.*
+com.googlecode.lesscss4j.*
+com.googlecode.libphonenumber.*
+com.googlecode.lightity.*
+com.googlecode.linkedin-j.*
+com.googlecode.log4jdbc.*
+com.googlecode.loosejar.*
+com.googlecode.lucastody.*
+com.googlecode.luceneappengine.*
+com.googlecode.mad-mvntools.*
+com.googlecode.mapperdao.*
+com.googlecode.mapping4java.*
+com.googlecode.marrowboy.*
+com.googlecode.mate-tools.*
+com.googlecode.matrix-toolkits-java.*
+com.googlecode.maven-download-plugin.*
+com.googlecode.maven-gcu-plugin.*
+com.googlecode.maven-java-formatter-plugin.*
+com.googlecode.maven-javacodegen-plugin.*
+com.googlecode.maven-license-validator-plugin.*
+com.googlecode.maven-migration-plugin.*
+com.googlecode.maven-overview-plugin.*
+com.googlecode.maven-properties-enum-plugin.*
+com.googlecode.mavenfilesync.*
+com.googlecode.mavennatives.*
+com.googlecode.mdock.*
+com.googlecode.memcachefy.*
+com.googlecode.metridoc.*
+com.googlecode.mgwt.*
+com.googlecode.miyamoto.*
+com.googlecode.mobilityrpc.*
+com.googlecode.mojo-sprites.*
+com.googlecode.mp4parser.*
+com.googlecode.msidor.*
+com.googlecode.msidor.maven.plugins.*
+com.googlecode.msidor.springframework.*
+com.googlecode.msidor.springframework.integration.*
+com.googlecode.multithreadedtc.*
+com.googlecode.mvp4g.*
+com.googlecode.mycontainer.*
+com.googlecode.ndbc-buoy4j.*
+com.googlecode.netlib-java.*
+com.googlecode.objectify-appengine-spring.*
+com.googlecode.objectify-query.*
+com.googlecode.objectify.*
+com.googlecode.obvious.*
+com.googlecode.openbox.*
+com.googlecode.openid-discovery-maven-plugin.*
+com.googlecode.openpojo.*
+com.googlecode.owasp-java-html-sanitizer.*
+com.googlecode.page-component.*
+com.googlecode.paradoxdriver.*
+com.googlecode.perfect-hashes.*
+com.googlecode.places-api-client.*
+com.googlecode.playn.*
+com.googlecode.plist.*
+com.googlecode.pojosr.*
+com.googlecode.princeton-java-algorithms.*
+com.googlecode.princeton-java-introduction.*
+com.googlecode.protobuf-java-format.*
+com.googlecode.protobuf-rpc-pro.*
+com.googlecode.proxy4j.*
+com.googlecode.q-link.*
+com.googlecode.rapid-framework.*
+com.googlecode.redbox-mint.*
+com.googlecode.refit.*
+com.googlecode.refit.eg.*
+com.googlecode.refit.maven.*
+com.googlecode.refit.test.*
+com.googlecode.reflective.*
+com.googlecode.robotframework-maven-plugin.*
+com.googlecode.rocoto.*
+com.googlecode.s2rome.*
+com.googlecode.sarasvati.*
+com.googlecode.sarasvati.thirdparty.eclipse.*
+com.googlecode.sarasvati.thirdparty.netbeans.*
+com.googlecode.sardine.*
+com.googlecode.sbinary.*
+com.googlecode.scala-midi.*
+com.googlecode.scalaconcurrency.*
+com.googlecode.scalascriptengine.*
+com.googlecode.scalaz.*
+com.googlecode.selenium-uitaf.*
+com.googlecode.server-test-toolkit.*
+com.googlecode.servletfilters.*
+com.googlecode.shutdown-listener.*
+com.googlecode.simpleobjectassembler.*
+com.googlecode.siren4j.*
+com.googlecode.sizeofag.*
+com.googlecode.slf4j-maven-plugin-log.*
+com.googlecode.sli4j.*
+com.googlecode.slotted.*
+com.googlecode.smartgwt-maven-plugin.*
+com.googlecode.smartmodules-maven-extension.*
+com.googlecode.solr-geonames.*
+com.googlecode.soundlibs.*
+com.googlecode.sparsebitmap.*
+com.googlecode.spring-appengine.*
+com.googlecode.spring-contributions.*
+com.googlecode.spring-event-router.*
+com.googlecode.ssd-utils.*
+com.googlecode.stackexchange.*
+com.googlecode.static-ioc.*
+com.googlecode.streamflyer-regex-fast.*
+com.googlecode.streamflyer.*
+com.googlecode.struts2-conversation.*
+com.googlecode.struts2yuiplugin.*
+com.googlecode.surfaceplotter.*
+com.googlecode.swing-assignmentdialog.*
+com.googlecode.t7mp.*
+com.googlecode.testcase-annotation.*
+com.googlecode.texhyphj.*
+com.googlecode.the-fascinator.*
+com.googlecode.the-fascinator.maven-plugins.*
+com.googlecode.the-fascinator.plugins.*
+com.googlecode.thread-weaver.*
+com.googlecode.tinydi.*
+com.googlecode.todomap.*
+com.googlecode.usc.*
+com.googlecode.valogato.*
+com.googlecode.velocity-maven-plugin.*
+com.googlecode.vfsjfilechooser2.*
+com.googlecode.vmock.*
+com.googlecode.wabacus.*
+com.googlecode.web-commons.*
+com.googlecode.websphere-portal-plugin.*
+com.googlecode.webutilities.*
+com.googlecode.wicked-charts.*
+com.googlecode.wicked-forms.*
+com.googlecode.wicket-charts.*
+com.googlecode.wicket-continuous-calendar.*
+com.googlecode.wicket-jquery-ui.*
+com.googlecode.wicketelements.*
+com.googlecode.wicketforge.*
+com.googlecode.windowlicker.*
+com.googlecode.xades4j.*
+com.googlecode.xdoclet-plugin-ignore.*
+com.googlecode.xmemcached.*
+com.googlecode.xmlblackbox.*
+com.googlecode.xmlzen.*
+com.googlecode.xq-gwt-mvc.*
+com.googlecode.xremoting.*
+com.googlecode.zohhak.*
+com.gooten.*
+com.gopai.*
+com.gordonwong.*
+com.gorisse.thomas.*
+com.gorisse.thomas.sceneform.*
+com.gosalelab.*
+com.goshippo.*
+com.goterl.*
+com.gotoago.*
+com.gotocompany.*
+com.governikus.*
+com.goyeau.*
+com.gozefo.brahma.*
+com.gpshopper.firesearch.*
+com.gpstogis.android.*
+com.gpxblog.*
+com.grab.grabidpartnersdk.*
+com.grab.grazel.*
+com.graceens.foresee.*
+com.gracefulcode.*
+com.gracerun.*
+com.grack.*
+com.gradecak.alfresco-mvc.*
+com.gradle.*
+com.gradleup.*
+com.gradleup.gr8.*
+com.gradleup.gr8.external.*
+com.grafana.*
+com.graffend.maven.*
+com.grahamedgecombe.apiviz.*
+com.grahamedgecombe.db.*
+com.grahamedgecombe.jterminal.*
+com.grammatech.gtirb.*
+com.granturing.*
+com.grapecity.documents.*
+com.grapecity.documents.excel.*
+com.graphaware.*
+com.graphaware.es.*
+com.graphaware.integration.es.*
+com.graphaware.integration.neo4j.*
+com.graphaware.neo4j.*
+com.graphaware.neo4j.example.*
+com.graphaware.nlp.*
+com.graphaware.offheap.*
+com.graphhopper.*
+com.graphhopper.external.*
+com.graphql-java-calculator.*
+com.graphql-java-generator.*
+com.graphql-java-kickstart.*
+com.graphql-java.*
+com.graphqlio.*
+com.grarcht.shuttle.*
+com.gravitondigital.*
+com.gravitondigital.app.*
+com.gravity.*
+com.gravity9.*
+com.gravityrd.*
+com.graysonnorland.pdfmantis.*
+com.great-it.*
+com.greatmancode.*
+com.greedchina.*
+com.greedlab.*
+com.greedygame.sdkx.*
+com.greedystar.*
+com.greenback.*
+com.greenbird.*
+com.greenbird.camel.*
+com.greenbird.mule.*
+com.greenbird.utilihive.stubs.*
+com.greenbird.xml-formatter.*
+com.greencatsoft.*
+com.greenfiling.smclient.*
+com.greenfossil.*
+com.greenfoxacademy.huli-metrics-spring.*
+com.greengrowapps.*
+com.greenhalolabs.*
+com.greenhalolabs.emailautocompletetextview.*
+com.greenlabsfin.design.*
+com.greenlaw110.rythm.*
+com.greenmoonsoftware.*
+com.greensopinion.swagger.*
+com.greensqa.*
+com.greghaskins.*
+com.greglturnquist.spring.social.ecobee.*
+com.gregmarut.commons.*
+com.gregmarut.resty.*
+com.gregmarut.support.*
+com.gregorpurdy.*
+com.gregorpurdy.ident.*
+com.grevehagen.*
+com.greycellofp.*
+com.greysonparrelli.permiso.*
+com.griddynamics.qa.*
+com.griddynamics.qa.atg.*
+com.griddynamics.qa.datapool.*
+com.grigoriliev.jsampler.*
+com.grjky.*
+com.groocraft.*
+com.grookage.apps.*
+com.grookage.fsm.*
+com.grookage.jelastic.*
+com.grookage.qtrouper.*
+com.grossbart.*
+com.groundupworks.android.*
+com.groundupworks.wings.*
+com.groupbyinc.*
+com.groupcdg.*
+com.groupcdg.arcmutate.*
+com.groupcdg.gradle.*
+com.groupcdg.pitest.*
+com.groupcdg.pitest.azure.cloud.*
+com.groupcdg.pitest.bitbucket.cloud.*
+com.groupcdg.pitest.bitbucket.server.*
+com.groupcdg.pitest.git.*
+com.groupcdg.pitest.github.*
+com.groupcdg.pitest.gitlab.*
+com.groupdocs.*
+com.groupon.*
+com.groupon.aint.*
+com.groupon.android.dichecks.*
+com.groupon.android.feature-adapter.*
+com.groupon.api.*
+com.groupon.dse.*
+com.groupon.grox.*
+com.groupon.jtier.*
+com.groupon.mapreduce.*
+com.groupon.maven.plugin.json.*
+com.groupon.mesos.*
+com.groupon.messagebus.*
+com.groupon.mysql.*
+com.groupon.novie.*
+com.groupon.odo.*
+com.groupon.promise.*
+com.groupon.roboremote.*
+com.groupon.roboremote.roboremoteclient.*
+com.groupon.sparklint.*
+com.groupon.vertx.*
+com.growin.*
+com.growingintech.*
+com.growingio.*
+com.growingio.android.*
+com.growingio.android.autotracker.*
+com.growingio.android.gpush.*
+com.growingio.android.sdk.upgrade.*
+com.growingio.android.widget.*
+com.growingio.giokit.*
+com.growingio.giokit.saas.*
+com.growse.*
+com.growthbeat.*
+com.gruchalski.*
+com.gruelbox.*
+com.grunka.json.*
+com.grunka.random.fortuna.*
+com.grunka.random.rfc11495.*
+com.grunka.random.xorshift.*
+com.gruuf.*
+com.gryphonet.*
+com.grzm.*
+com.gskinner.*
+com.gsralex.*
+com.gsralex.gdata.*
+com.gsssoftwaresolution.java.utility.restfulservices.*
+com.gtcgroup.*
+com.gtomato.android.library.*
+com.gu.*
+com.gu.android.*
+com.gu.elasticsearch.plugin.cloudwatch.*
+com.gu.etag-caching.*
+com.gu.identity.*
+com.gu.identity.api.*
+com.gu.kotlin.*
+com.gu.play-googleauth.*
+com.gu.play-secret-rotation.*
+com.gu.tmp.*
+com.guaboy.*
+com.guance.*
+com.guanmengyuan.*
+com.guanmengyuan.spring-ex.*
+com.guaranteedrate.*
+com.guardanis.*
+com.guardianapp.connect.*
+com.guardsquare.*
+com.guardtime.*
+com.guardtime.envelope.*
+com.guavaapps.components.*
+com.gubbns.*
+com.gucci.*
+com.guerlab.cloud.uploader.*
+com.guerwan.*
+com.guhungry.android.*
+com.guicedee.*
+com.guicedee.activitymaster.*
+com.guicedee.examples.*
+com.guicedee.examples.faces.*
+com.guicedee.examples.hazelcast.*
+com.guicedee.examples.jaxrs.*
+com.guicedee.examples.jaxws.*
+com.guicedee.examples.jpa.*
+com.guicedee.examples.openapi.*
+com.guicedee.examples.servlets.*
+com.guicedee.persistence.*
+com.guicedee.services.*
+com.guicedee.services.extensions.*
+com.guicedee.servlets.*
+com.guichaguri.*
+com.guidewire.tools.*
+com.guidoschmidt17.*
+com.guigarage.*
+com.guiltry.dummy.*
+com.guiyec.similar.*
+com.guizmaii.*
+com.gullerya.*
+com.gumlet.gumlet-insights-sdk-exoplayer.*
+com.guokr.*
+com.guolindev.glance.*
+com.guolindev.permissionx.*
+com.guoshiyao.rely.*
+com.gurtam.*
+com.guseyn.broken-xml.*
+com.gushangjie.*
+com.gutils.*
+com.guujiang.*
+com.gw2tb.api-generator.*
+com.gw2tb.gw2api.*
+com.gw2tb.gw2chatlinks.*
+com.gw2tb.gw2ml.*
+com.gwidgets.*
+com.gwidgets.maven.*
+com.gwsystems.*
+com.gwtincubator.*
+com.gwtplatform.*
+com.gwtplatform.extensions.*
+com.gwttween.*
+com.gxun.*
+com.gxun.core.*
+com.gyawaliamit.*
+com.gyftedstore.core.*
+com.gyftedstore.currency.*
+com.gyftedstore.library.*
+com.gyftedstore.scrapper.*
+com.gyurigrell.rxreactor.*
+com.gzoltar.*
+com.gzsolartech.*
+com.h2database.*
+com.h3xstream.findsecbugs.*
+com.h3xstream.maven.*
+com.h3xstream.retirejs.*
+com.h6ah4i.android.*
+com.h6ah4i.android.colortransitiondrawable.*
+com.h6ah4i.android.compat.*
+com.h6ah4i.android.materialshadowninepatch.*
+com.h6ah4i.android.musicvisualizerapi.*
+com.h6ah4i.android.preference.*
+com.h6ah4i.android.scrollableviewpagercontent.*
+com.h6ah4i.android.tablayouthelper.*
+com.h6ah4i.android.widget.*
+com.h6ah4i.android.widget.advrecyclerview.*
+com.h6ah4i.android.widget.verticalseekbar.*
+com.haaksmash.*
+com.habds.*
+com.hablutzel.spwing.*
+com.hack-gov.*
+com.hack23.cia.*
+com.hack23.maven.*
+com.hack23.sonar.*
+com.hackerrank.applications.*
+com.hackerrank.archetypes.*
+com.hacklanta.*
+com.hackoeur.*
+com.hackorama.m.core.*
+com.hacocms.sdk.*
+com.hadoop.compression.*
+com.hadoopz.*
+com.hagoapp.*
+com.hairyfatguy.*
+com.haiwanwan.*
+com.haiwanwan.common.*
+com.haiyiyang.*
+com.hajhouj.fastsico.*
+com.halfhp.fig.*
+com.halfism.*
+com.halibobor.*
+com.halilibo.compose-richtext.*
+com.halversondm.*
+com.halxy.*
+com.hamburgsud.aludratest.*
+com.hamburgsud.log4testing.*
+com.hamdikavak.*
+com.hamweather.*
+com.handcraftedbits.*
+com.handcraftedbits.archetype.*
+com.handcraftedbits.arquillian.*
+com.handcraftedbits.edgeifier.*
+com.handcraftedbits.web.*
+com.handheldgroup.developertools.*
+com.handpoint.*
+com.handpoint.api.*
+com.handpoint.api.cloud.*
+com.handpoint.api.shared.*
+com.handpoint.api.transactionfeed.*
+com.handpoint.api.txnfeed.*
+com.handstandsam.kmp4free.*
+com.hanframework.*
+com.hanframework.kit.*
+com.hanhuy.*
+com.hanhuy.android.*
+com.hanhuy.keepassj.*
+com.hanhuy.sbt.*
+com.hankcs.*
+com.hankcs.hanlp.restful.*
+com.hankcs.nlp.*
+com.hannesdorfmann.*
+com.hannesdorfmann.adaptercommands.*
+com.hannesdorfmann.annotatedadapter.*
+com.hannesdorfmann.fragmentargs.*
+com.hannesdorfmann.instantiator.*
+com.hannesdorfmann.mosby.*
+com.hannesdorfmann.mosby3.*
+com.hannesdorfmann.parcelableplease.*
+com.hannesdorfmann.smoothprogressbar.*
+com.hannesdorfmann.sqlbrite.*
+com.hanqunfeng.*
+com.hanzhigu.frm.*
+com.hanzoy.*
+com.haodanku.sdk.*
+com.haohere.ecpay.*
+com.haooho.spark.*
+com.haoxuer.*
+com.haoxuer.bigworld.*
+com.haoxuer.discover.*
+com.haoxuer.maven.archetype.*
+com.haoxuer.plugs.*
+com.haoxuer.school.*
+com.happinesea.*
+com.happy-dev.*
+com.happy3w.*
+com.happy3w.etl.*
+com.happyblueduck.lembas.*
+com.hapsunday.algo.*
+com.harana.*
+com.hardis.adelia.*
+com.hardis.collectd.*
+com.hardis.log4j.*
+com.hardis.logback.*
+com.hardis.reflex.*
+com.hardkernel.*
+com.hardsoftstudio.*
+com.hardsoftstudio.real.textview.*
+com.harium.*
+com.harium.android.*
+com.harium.api.*
+com.harium.blakfisk.*
+com.harium.chatbot.*
+com.harium.database.*
+com.harium.etyl.*
+com.harium.etyl.geometry.*
+com.harium.etyl.networking.*
+com.harium.gdx.*
+com.harium.graph.*
+com.harium.hci.*
+com.harium.keel.*
+com.harium.loader.*
+com.harium.malt.*
+com.harium.marine.*
+com.harium.propan.*
+com.harium.storage.*
+com.harium.suneidesis.*
+com.harium.suneidesis.sunbot.*
+com.harium.sunflow.*
+com.harium.supabase.*
+com.harium.util.*
+com.harium.web.*
+com.harlap.*
+com.haroldstudios.*
+com.haroldstudios.protectionapi.*
+com.harrys.hyppo.*
+com.harshil.gradle.*
+com.harshild.gradle.*
+com.hartle-klug.*
+com.hashedin.logan.*
+com.hashicorp.*
+com.hashicorp.nomad.*
+com.hashmapinc.tempus.*
+com.hastybox.*
+com.hathora.*
+com.haulmont.thirdparty.*
+com.haulmont.yarg.*
+com.haventec.*
+com.hawcode.*
+com.haxianhe.*
+com.hazelcast.*
+com.hazelcast.azure.*
+com.hazelcast.cloud.*
+com.hazelcast.jenkins.plugins.*
+com.hazelcast.jet.*
+com.hazelcast.jet.contrib.*
+com.hazelcast.jet.examples.*
+com.hazelcast.jsurfer.*
+com.hazelcast.maven.*
+com.hazelcast.simulator.*
+com.hazelcast.stabilizer.*
+com.hazeltask.*
+com.hb0730.*
+com.hbakkum.maven.plugins.*
+com.hbakkum.rundeck.plugins.*
+com.hbakkum.template.*
+com.hbb20.*
+com.hbm.*
+com.hccake.*
+com.hcehk.*
+com.hcgstudio.*
+com.hcl.*
+com.hcl.commerce.*
+com.hcl.domino.*
+com.hcl.security.*
+com.hcyacg.*
+com.hczhang.*
+com.hczhang.hummingbird.*
+com.hds.hcpaw.*
+com.heaboy.*
+com.headius.*
+com.headstartech.beansgraph.*
+com.headstartech.burro.*
+com.headstartech.scheelite.*
+com.headstartech.sermo.*
+com.healthcarelocator.*
+com.healthlx.cdshooks.*
+com.healthlx.smartonfhir.*
+com.healthmarketscience.*
+com.healthmarketscience.common.*
+com.healthmarketscience.jackcess.*
+com.healthmarketscience.rmiio.*
+com.healthmarketscience.sqlbuilder.*
+com.healthy-chn.cloud.*
+com.healthy-chn.security.*
+com.heanbian.*
+com.heanbian.block.*
+com.heanbian.boot.*
+com.heapanalytics.android.*
+com.heapbrain.*
+com.heartlandpaymentsystems.*
+com.heavenark.infrastructure.*
+com.hectorlopezfernandez.pebble.*
+com.hedera.evm.*
+com.hedera.fullstack.*
+com.hedera.hashgraph.*
+com.hedera.pbj.*
+com.heershingenmosiken.*
+com.hehuelet.permissionx.*
+com.heidelpay.*
+com.heidelpay.payment.*
+com.heimuheimu.*
+com.heinrichreimersoftware.material_drawer.*
+com.heinrichreimersoftware.materialdrawer.*
+com.heinrichreimersoftware.shapetouchlistener.*
+com.heinrichreimersoftware.singleinputform.*
+com.hejinonline.*
+com.hejinonline.silk.*
+com.helger.*
+com.helger.as2.*
+com.helger.bdve.*
+com.helger.bdve.rules.*
+com.helger.cii.*
+com.helger.commons.*
+com.helger.dcng.*
+com.helger.en16931.*
+com.helger.erechnung.gv.at.*
+com.helger.font.*
+com.helger.masterdata.*
+com.helger.maven.*
+com.helger.peppol.*
+com.helger.phase4.*
+com.helger.phive.*
+com.helger.phive.rules.*
+com.helger.photon.*
+com.helger.rdc.*
+com.helger.schedule.*
+com.helger.schematron.*
+com.helger.smp-mate.*
+com.helger.toop.*
+com.helger.ubl.*
+com.helger.web.*
+com.helger.xsd.*
+com.heliorm.*
+com.heliosapm.jmxlocal.*
+com.heliosapm.jvm.*
+com.heliosapm.utils.*
+com.hello2morrow.*
+com.hellokaton.*
+com.hellosign.*
+com.hellosoda.rmq.*
+com.helmstetter.*
+com.helospark.*
+com.helpchoice.kotlin.*
+com.helpcrunch.*
+com.helppier.*
+com.helppier.helppiersdk.*
+com.helpscout.*
+com.helpscout.internal.*
+com.helpshift.*
+com.helpshift.mvnhello.*
+com.hencjo.summer.*
+com.hendraanggrian.*
+com.hendraanggrian.appcompat.*
+com.hendraanggrian.material.*
+com.hendraanggrian.rulebook.*
+com.henorek.*
+com.henricook.*
+com.henrymxu.openaikotlin.*
+com.heqilin.*
+com.here.account.*
+com.here.platform.*
+com.here.platform.artifact.*
+com.heretere.hdl.*
+com.heretere.hdl.plugin.*
+com.herminiogarcia.*
+com.hermit-reasoner.*
+com.herobigdata.*
+com.heroestools.*
+com.herogi.client.*
+com.herohan.*
+com.heroiclabs.*
+com.heroku.*
+com.heroku.agent.*
+com.heroku.api.*
+com.heroku.platform.api.*
+com.heroku.sdk.*
+com.heronarts.*
+com.hetang.*
+com.heutelbeck.*
+com.hevelian.activemq.*
+com.hevelian.olastic.*
+com.hevodata.*
+com.hevodata.project2.*
+com.hexadevlabs.*
+com.hexagonkt.*
+com.hexagonkt.extra.*
+com.hexaid.struts2.junit.*
+com.hexascribe.*
+com.hextremelabs.*
+com.hextremelabs.log4j.*
+com.hextremelabs.permiscus.*
+com.hextremelabs.pinpad.*
+com.hextremelabs.sms.*
+com.hextremelabs.ussd.*
+com.hexwit.ninja.jongo.*
+com.heymis.hiveshield.*
+com.heymis.openbpm.*
+com.heystage.*
+com.heytap.*
+com.heytap.ad.*
+com.heytap.ads.omni.*
+com.heytap.nearx.*
+com.heytap.sdk.*
+com.heytap.test.*
+com.heytap.webview.*
+com.heywatch.*
+com.hfcsbc.sdk.*
+com.hgobox.*
+com.hgwen.hgutils.*
+com.hh-medic.android.sdk.*
+com.hhandoko.*
+com.hhoss.*
+com.hi-dhl.*
+com.hi-dhl.library.*
+com.hi-dhl.test.*
+com.hi3project.broccoli.*
+com.hi3project.unida.*
+com.hi3project.unida.tools.*
+com.hi3project.vineyard.*
+com.hi3project.vineyard.comm.*
+com.hianzuo.android.*
+com.hiarias.*
+com.hibegin.*
+com.hibernix.finnhub.*
+com.hiczp.*
+com.hiddenstage.easysharedpreferences.*
+com.hiddenswitch.*
+com.hierynomus.*
+com.hierynomus.asn-one.*
+com.hifiveai.*
+com.higgschain.trust.*
+com.high-mobility.*
+com.highcapable.sweetdependency.*
+com.highcapable.sweetproperty.*
+com.highcapable.yukihookapi.*
+com.highcapable.yukireflection.*
+com.higherfrequencytrading.*
+com.highgo.*
+com.highill.base.*
+com.highrung.*
+com.highstreet-technologies.aaa.*
+com.highstreet-technologies.netconf.*
+com.highstreet-technologies.opendaylight.*
+com.highstreet-technologies.ops4j.pax.web.*
+com.highway2urhell.*
+com.highwise.*
+com.higlowx.*
+com.hihooda.*
+com.hijackermax.*
+com.hikvh.*
+com.hikvision.ezviz.*
+com.hikvision.ga.*
+com.hillfly.*
+com.himanshoe.*
+com.himanshuvirmani.*
+com.hinadt.hicloud.android.*
+com.hinadt.hicloud.java.*
+com.hindog.grid.*
+com.hindog.spark.*
+com.hipay.fullservice.*
+com.hippocp.*
+com.hiskasoft.antlr4.*
+com.hiskasoft.hsk.*
+com.hiskasoft.maven.*
+com.hit-pay.*
+com.hit-pay.android.*
+com.hitherejoe.leanback.*
+com.hitherejoe.leanbackcards.*
+com.hivemq.*
+com.hkupty.maple.*
+com.hkupty.penna.*
+com.hlag.oversigt.*
+com.hlag.tools.commvis.*
+com.hltech.*
+com.hluhovskyi.camerabutton.*
+com.hmemcpy.*
+com.hmhco.*
+com.hmiard.leaves.*
+com.hmilyylimh.cloud.*
+com.hmsonline.*
+com.hmtmcse.fileutil.*
+com.hmtmcse.httputil.*
+com.hmtmcse.parser4java.*
+com.hmware.android.*
+com.ho1ho.springboot.*
+com.hoioy.*
+com.hokdo.sdk.*
+com.hokolinks.*
+com.holdenkarau.*
+com.holidaycheck.*
+com.holix.android.*
+com.holmos.*
+com.holon-platform.*
+com.holon-platform.artisan.*
+com.holon-platform.core.*
+com.holon-platform.jaxrs.*
+com.holon-platform.jdbc.*
+com.holon-platform.jpa.*
+com.holon-platform.json.*
+com.holon-platform.mongo.*
+com.holon-platform.reactor.*
+com.holon-platform.test.*
+com.holon-platform.vaadin.*
+com.holon-platform.vaadin7.*
+com.homeaway.*
+com.homeaway.devtools.jenkins.*
+com.homeaway.streamingplatform.*
+com.homeaway.streamplatform.*
+com.homedepot.*
+com.homedepot.gitprops.*
+com.homeofthewizard.*
+com.homihq.*
+com.homolo.*
+com.honerfor.*
+com.hong610.*
+com.hootsuite.*
+com.hopper.cloud.*
+com.horntell.*
+com.hortonworks.registries.*
+com.hotels.*
+com.hotels.beans.*
+com.hotels.road.*
+com.hotels.styx.*
+com.hotwire.image-assert.*
+com.houkunlin.*
+com.houkunlin.easypoi.*
+com.houlangmark.*
+com.housihai.*
+com.houxinlin.*
+com.hovans.android.*
+com.hovans.dynamicgrid.*
+com.hovans.flipview.*
+com.hovans.netty.*
+com.hovans.network.*
+com.hovans.preference.*
+com.hovans.pulltorefresh.*
+com.hovans.recyclerview.*
+com.hovans.resource.*
+com.hovans.standout.*
+com.hovans.support.*
+com.hovans.translucent.*
+com.hp.autonomy.*
+com.hp.autonomy.aci.client.*
+com.hp.autonomy.aci.content.*
+com.hp.autonomy.frontend.*
+com.hp.autonomy.frontend.configuration.*
+com.hp.autonomy.frontend.reports.powerpoint.*
+com.hp.autonomy.frontend.user.*
+com.hp.autonomy.frontend.view.*
+com.hp.autonomy.hod.*
+com.hp.autonomy.hod.redis.*
+com.hp.autonomy.idol.*
+com.hp.autonomy.iod.*
+com.hp.autonomy.test.*
+com.hp.autonomy.test.xml.*
+com.hp.bigdata.frontend.*
+com.hp.gagawa.*
+com.hp.hpl.jena.*
+com.hp.jipp.*
+com.hp.kalexa.*
+com.hp.score.sdk.*
+com.hpe.adm.nga.sdk.*
+com.hpe.adm.nga.sdk.extension.*
+com.hpe.adm.octane.ciplugins.*
+com.hpe.adm.octane.ideplugins.*
+com.hpe.alm.octane.*
+com.hpe.dna.*
+com.hpe.kraal.*
+com.hpe.nv.*
+com.hpe.oneview.*
+com.hpfxd.configurate.*
+com.hrakaroo.*
+com.hreeinfo.commons.*
+com.hreeinfo.plugins.*
+com.hreeinfo.vaadin.addons.*
+com.hribol.bromium.*
+com.hsbc.cranker.*
+com.hsbc.engineering.*
+com.hsiliev.*
+com.htecgroup.androidcore.*
+com.htliang.*
+com.htmlhifive.*
+com.httprunnerjava.*
+com.htyleo.*
+com.htyleo.extsort.*
+com.huaban.*
+com.huangwenhuan.*
+com.huangyunkun.*
+com.huanmeng-qwq.*
+com.huanshankeji.*
+com.huawei.*
+com.huawei.dli.*
+com.huawei.hilink.c2c.integration.*
+com.huawei.openstack4j.connectors.*
+com.huaweicloud.*
+com.huaweicloud.cs.*
+com.huaweicloud.devspore.*
+com.huaweicloud.dis.*
+com.huaweicloud.dubbo-servicecomb.*
+com.huaweicloud.dws.*
+com.huaweicloud.nosql.*
+com.huaweicloud.sdk.*
+com.huaweicloud.sermant.*
+com.huaweicloud.sermant.examples.*
+com.hubbledouble.*
+com.hubburu.*
+com.hubio.*
+com.hubject.*
+com.hubject.datex.*
+com.hubrick.*
+com.hubrick.client.*
+com.hubrick.lib.*
+com.hubrick.maven.*
+com.hubrick.storm.*
+com.hubrick.vertx.*
+com.hubspot.*
+com.hubspot.chrome.*
+com.hubspot.dataloader.*
+com.hubspot.dropwizard.*
+com.hubspot.guice.*
+com.hubspot.immutables.*
+com.hubspot.jackson.*
+com.hubspot.jinjava.*
+com.hubspot.liveconfig.*
+com.hubspot.maven.plugins.*
+com.hubspot.mesos.rx.java.*
+com.hubspot.mesos.rx.java.example.*
+com.hubspot.rosetta.*
+com.hubspot.slack.*
+com.hubspot.slimfast.*
+com.hubspot.snapshots.*
+com.hubtel.*
+com.hudomju.*
+com.huemulsolutions.bigdata.*
+com.huibozhixin.*
+com.huibur.furion.*
+com.huifu.adapay.*
+com.huifu.adapay.core.*
+com.huifu.bspay.sdk.*
+com.huilan.app.aikf.*
+com.huipeng1982.*
+com.humegatech.*
+com.hummeling.*
+com.hummingwave.*
+com.hungerhaken.*
+com.hunorkovacs.*
+com.hunterwb.*
+com.huongdanjava.*
+com.hupubao.*
+com.huramkin.toolbox.*
+com.hurence.logisland.*
+com.hurryyu.android.*
+com.hushaorui.*
+com.huskycode.*
+com.husseinala.*
+com.husseinala.neon.*
+com.hutuxiaogui.*
+com.hwaipy.*
+com.hwangjr.proguard.*
+com.hwangjr.rxbus.*
+com.hwangjr.utils.*
+com.hxuanyu.*
+com.hybhub.*
+com.hydrogenplatform.*
+com.hynnet.*
+com.hyosakura.*
+com.hyp3r.*
+com.hypercubetools.*
+com.hyperether.*
+com.hypers.analytics.*
+com.hyperscience.*
+com.hypertino.*
+com.hyperwallet.*
+com.hyperwallet.android.*
+com.hyperwallet.android.ui.*
+com.hypnoticocelot.*
+com.hyprmx.android.*
+com.hyzland.bean.converter.*
+com.hzdingmao.platformsdk.*
+com.hzhanghuan.*
+com.hzlinks.*
+com.hzlinks.swagger.*
+com.hzsparrow.framework.*
+com.hzzxxd.sdk.*
+com.i18next.*
+com.i360day.*
+com.iabgpp.*
+com.iabtcf.*
+com.iajrz.*
+com.iakuil.*
+com.iamceph.resulter.*
+com.iamceph.springed.rsocket.*
+com.iamnbty.*
+com.iamnbty.android.*
+com.iampass.iampass.*
+com.iamsoft.*
+com.iamverylovely.*
+com.iandadesign.*
+com.iangclifton.android.*
+com.ianhattendorf.sensi.*
+com.ianrumac.redukks.*
+com.iaphub.*
+com.iarcuschin.*
+com.ibanity.apis.*
+com.ibasco.agql.*
+com.ibasco.gifreader.*
+com.ibasco.glcdemulator.*
+com.ibasco.ucgdisplay.*
+com.ibatis.*
+com.ibatix.*
+com.ibeetl.*
+com.iblotus.*
+com.iblotus.exchange.*
+com.ibm.*
+com.ibm.SparkTC.*
+com.ibm.aem.aem-tenant-specific-vanity-urls.*
+com.ibm.async.*
+com.ibm.bamoe.*
+com.ibm.batch.*
+com.ibm.bluemix.deploymenttracker.*
+com.ibm.bluemixmobileservices.clientsdk.android.*
+com.ibm.cfenv.*
+com.ibm.cics.*
+com.ibm.cics.bundle.*
+com.ibm.cloud.*
+com.ibm.cloud.diesel.*
+com.ibm.cloud.sdk.*
+com.ibm.cos-aspera.*
+com.ibm.cos.*
+com.ibm.cos.config.*
+com.ibm.cp4waiops.connectors.*
+com.ibm.cp4waiops.connectors.sdk.*
+com.ibm.cusp.*
+com.ibm.darpc.*
+com.ibm.db2.*
+com.ibm.db2.jcc.*
+com.ibm.disni.*
+com.ibm.docplexcloud.*
+com.ibm.etcd.*
+com.ibm.event.*
+com.ibm.eventstreams.*
+com.ibm.eventstreams.schemaregistry.*
+com.ibm.fhir.*
+com.ibm.g11n.pipeline.*
+com.ibm.gitignorezipper.*
+com.ibm.graph.*
+com.ibm.ibmos2spark.*
+com.ibm.icu.*
+com.ibm.ims.*
+com.ibm.informix.*
+com.ibm.io.*
+com.ibm.ioc.*
+com.ibm.jaggr.*
+com.ibm.jbatch.*
+com.ibm.jbatch.tck.*
+com.ibm.jnvmf.*
+com.ibm.journeycode.metricstracker.*
+com.ibm.jsonata4java.*
+com.ibm.maximo.*
+com.ibm.mdfromhtml.*
+com.ibm.mdfromhtml.services.*
+com.ibm.messaging.*
+com.ibm.mfp.*
+com.ibm.mobile.foundation.*
+com.ibm.mobile.services.*
+com.ibm.mobilefirstplatform.clientsdk.android.*
+com.ibm.mobilefirstplatform.serversdk.java.*
+com.ibm.mq.*
+com.ibm.mqlight.*
+com.ibm.narpc.*
+com.ibm.pi.*
+com.ibm.research.kar.*
+com.ibm.runtimetools.*
+com.ibm.sbt.*
+com.ibm.security.*
+com.ibm.spss.hive.serde2.xml.*
+com.ibm.stocator.*
+com.ibm.storage.*
+com.ibm.streams.*
+com.ibm.ta.sdk.*
+com.ibm.urbancode.plugins.*
+com.ibm.util.merge.*
+com.ibm.utils.*
+com.ibm.utils.litelinks.*
+com.ibm.wala.*
+com.ibm.watson.*
+com.ibm.watson.data.*
+com.ibm.watson.developer_cloud.*
+com.ibm.watson.health.cognitive-services.*
+com.ibm.websphere.appmod.tools.*
+com.ibm.websphere.appserver.api.*
+com.ibm.websphere.appserver.features.*
+com.ibm.websphere.appserver.runtime.*
+com.ibm.websphere.appserver.spi.*
+com.ibm.whitelistmasker.*
+com.ibm.wiotp.*
+com.ibm.ws.componenttest.*
+com.ibm.ws.java.*
+com.ibm.zosconnect.*
+com.ibm.zosconnect.gradle.*
+com.ibm.zosconnect.requester.*
+com.ibuildapp.*
+com.icapps.android.*
+com.icapps.build.gradle.*
+com.icapps.crashreporter.*
+com.icapps.swaggervalidator.*
+com.icasue.*
+com.icegreen.*
+com.icemachined.*
+com.icemobile.*
+com.iceolive.*
+com.icerockdev.*
+com.icerockdev.boko.*
+com.icerockdev.service.*
+com.iceteck.silicompressorr.*
+com.icexls.*
+com.icexxx.*
+com.iceyyy.*
+com.icfolson.aem.*
+com.icfolson.aem.akamai.*
+com.icfolson.aem.groovy.console.*
+com.icfolson.aem.groovy.extension.*
+com.icfolson.aem.harbor.*
+com.icfolson.aem.library.*
+com.icfolson.aem.namespace.*
+com.icfolson.aem.prosper.*
+com.icfolson.maven.plugins.*
+com.icfolson.sling.*
+com.icfolson.sling.objectmap.*
+com.ichifun.*
+com.icoderman.*
+com.icodeyou.*
+com.icosillion.podengine.*
+com.icthh.xm.commons.*
+com.icthh.xm.lep.*
+com.id-photo-verify.*
+com.idapgroup.*
+com.idc.webchannel.pac4j.*
+com.idea-aedi.*
+com.ideaheap.barelyfunctional.*
+com.idealista.*
+com.idefav.*
+com.idemeum.*
+com.idemidov.*
+com.identityblitz.*
+com.identityx.*
+com.identityx.auth.*
+com.idfconnect.devtools.*
+com.idfy.*
+com.idfy.eve.*
+com.idilia.*
+com.idiotalex.*
+com.idrsolutions.*
+com.ieooc.cloud.*
+com.ieooc.nacos.*
+com.ieooc.simplify.*
+com.ifeng.*
+com.ifeng.newssdk.*
+com.ifengxue.*
+com.ifnoelse.*
+com.ifrabbit.*
+com.ifttt.*
+com.ifwallet.walletcore.*
+com.ig.orchestra.avro.*
+com.ig.orchestrations.*
+com.ig.orchestrations.chart.data.*
+com.ig.orchestrations.fixp.*
+com.ig.orchestrations.us.rfed.*
+com.ig.us.otc.*
+com.igaworks.offerwall.*
+com.igaworks.ssp.*
+com.igeak.tools.build.*
+com.igeeksky.*
+com.igeeksky.xtool.*
+com.iggroup.oss.restdoclet.*
+com.igitras.*
+com.ignidata.api.plugin.*
+com.igoodcom.*
+com.igormaznitsa.*
+com.igumnov.*
+com.igumnov.scala.*
+com.igumnov.scalautil.*
+com.iheart.*
+com.iheartradio.m3u8.*
+com.ihsinformatics.*
+com.iih5.*
+com.iiifi.*
+com.iinteractive.*
+com.ijson.*
+com.ijson.common.*
+com.ikangtai.*
+com.ikangtai.buletoothsdk.*
+com.ikangtai.papersdk.*
+com.ikasoa.*
+com.ikelin.*
+com.ikimuhendis.*
+com.ikokoon.serenity.hudson.*
+com.ikzen.*
+com.ileler.*
+com.ilkeiapps.*
+com.illicitonion.*
+com.illposed.osc.*
+com.illtamer.infinite.bot.*
+com.illucit.*
+com.illuzor.*
+com.ilsmp.*
+com.ilummc.eagletdl.*
+com.iluwatar.*
+com.iluwatar.urm.*
+com.ilxqx.*
+com.imadcn.framework.*
+com.imadethatcow.*
+com.image-charts.*
+com.imageworks.scala-migrations.*
+com.imaginary.*
+com.imaginatelabs.*
+com.imagingbook.*
+com.imalittletester.*
+com.imangazaliev.material-prefs.*
+com.imcys.deeprecopy.*
+com.imdadareeph.*
+com.imdsc.*
+com.imgix.*
+com.imiconnect.*
+com.imiconnect.test.*
+com.iminling.*
+com.immibytes.*
+com.imminentmeals.*
+com.imminentmeals.android.*
+com.immomo.apm.*
+com.immomo.baseutil.*
+com.immomo.cosmos.*
+com.immomo.cosmos.apm.*
+com.immomo.cosmos.auth.*
+com.immomo.cosmos.baseutil.*
+com.immomo.cosmos.effect.*
+com.immomo.cosmos.mediax.*
+com.immomo.cosmos.mmenc.*
+com.immomo.cosmos.photon.*
+com.immomo.cosmos.radar.*
+com.immomo.cosmos.rifle.*
+com.immomo.justice.*
+com.immomo.litebuild.*
+com.immomo.molive.hello.*
+com.immomo.momomedia.*
+com.immomo.momons.*
+com.immomo.plugin.lib.*
+com.immomo.rifle.*
+com.immomo.wink.*
+com.immomo.xengine.*
+com.immutable.sdk.*
+com.immutable.wallet.*
+com.imohsenb.*
+com.imojiapp.*
+com.imp2002.*
+com.impact.*
+com.impactradius.*
+com.impactupgrade.*
+com.impactupgrade.integration.*
+com.impartus.*
+com.impartus.live.*
+com.imperva.*
+com.imperva.ddc.*
+com.imperva.sampler.*
+com.imperva.shcf4j.*
+com.imperva.stepping.*
+com.impetus.*
+com.impetus.blkchn.*
+com.impetus.client.*
+com.impetus.core.*
+com.impetus.eth.*
+com.impetus.fabric.*
+com.impetus.kundera.*
+com.impetus.kundera.client.*
+com.impetus.kundera.core.*
+com.impetus.kundera.rest.*
+com.impinj.*
+com.importio.*
+com.impossibl.pgjdbc-ng.*
+com.impossibl.pgjdbc-ng.tools.*
+com.impossibl.stencil.*
+com.impressiveinteractive.synapse.*
+com.imsweb.*
+com.imwot.db.*
+com.imwot.distributed.*
+com.imwot.middleware.socket.*
+com.imwot.socket.*
+com.imwyh.*
+com.in-and-win.*
+com.in-telligent.openapi.*
+com.in-telligent.uat.openapi.*
+com.inaccel.*
+com.inaos.jam.*
+com.incarcloud.*
+com.includesecurity.*
+com.incognia.*
+com.incors.*
+com.incors.plaf.*
+com.incountry.*
+com.increase.api.*
+com.increff.commons.*
+com.indeed.*
+com.indeed.logstash.log4j.*
+com.indeed.sandbox.*
+com.indeni.*
+com.independentid.*
+com.indextank.*
+com.indicative.client.android.*
+com.indicative.client.java.*
+com.indico.*
+com.indigitall.*
+com.indix.*
+com.indix.api.*
+com.indoles.clj.*
+com.indoorvivants.*
+com.indoorvivants.cloudflare.*
+com.indoorvivants.detective.*
+com.indoorvivants.gnome.*
+com.indoorvivants.langoustine.*
+com.indoorvivants.playwright.*
+com.indoorvivants.roach.*
+com.indoorvivants.vcpkg.*
+com.indoorvivants.weaver.*
+com.indoqa.*
+com.indoqa.quickstart.*
+com.indoqa.solr.*
+com.indoqa.thirdparty.*
+com.inductiveautomation.ignitionsdk.*
+com.indusnode.*
+com.indvd00m.ascii.render.*
+com.ineat-group.*
+com.ineat-group.lab.*
+com.inetsoft.connectors.*
+com.ineunet.*
+com.inexas.*
+com.inferlytics.*
+com.infilos.*
+com.infinario.android.infinariosdk.*
+com.infinitumframework.*
+com.infinityrefactoring.*
+com.infinum.*
+com.infinum.collar.*
+com.infinum.complexify.*
+com.infinum.dbinspector.*
+com.infinum.halley.*
+com.infinum.jsonapix.*
+com.infinum.jsonhal.*
+com.infinum.localian.*
+com.infinum.sentinel.*
+com.infinum.thimble.*
+com.infinyon.*
+com.influxdb.*
+com.infobip.*
+com.infobip.jib.*
+com.infobip.kafkistry.*
+com.infocarriers.fm.*
+com.infomaximum.*
+com.infonotary.*
+com.infor.m3.*
+com.informix.hq.*
+com.infospica.*
+com.infotel.seleniumRobot.*
+com.infradna.tool.*
+com.inframeworks.inandroid.*
+com.infstory.*
+com.infuse-ev.*
+com.infusion.*
+com.ing.*
+com.ing.baker.*
+com.ing.data.*
+com.ing.wbaa.druid.*
+com.ingenico.connect.gateway.*
+com.ingenico.direct.*
+com.ingensi.data.*
+com.ingonoka.*
+com.ingres.jdbc.*
+com.ingsoftware.oss.*
+com.inin.analytics.*
+com.ininmm.*
+com.initiative-soft.*
+com.inkapplications.*
+com.inkapplications.ack.*
+com.inkapplications.kimchi-firebase.*
+com.inkapplications.kimchi.*
+com.inkapplications.lol.dot.*
+com.inkapplications.publishing.*
+com.inkapplications.shade.*
+com.inkapplications.spondee.*
+com.inkapplications.spondee.math-macosx64.0.0.3.com 2.inkapplications.spondee.*
+com.inkapplications.spondee.math-macosx64.0.0.3.com 3.inkapplications.spondee.*
+com.inkapplications.spondee.math-macosx64.0.0.3.com 4.inkapplications.spondee.*
+com.inkapplications.spondee.math-macosx64.0.0.3.com.inkapplications.spondee.*
+com.inkapplications.subatomic.*
+com.inkapplications.telegram.*
+com.inkapplications.viewpageindicator.*
+com.inkapplications.watermelon.*
+com.inkonote.*
+com.inlocomedia.android.*
+com.inmobi.analyticssdk.*
+com.inmobi.ares.*
+com.inmobi.ares.setest.*
+com.inmobi.glance.gamecenter.*
+com.inmobi.helloyou.*
+com.inmobi.monetization.*
+com.inmobi.omsdk.*
+com.inmobi.swishfolder.*
+com.inmoment.sdk.*
+com.inmorn.*
+com.innahema.*
+com.inneex.www.customfonts.*
+com.innogames.*
+com.innoq.*
+com.innoq.liqid.*
+com.innoq.qmqp.*
+com.innoq.webjars.*
+com.innov8tif.OkayIDNFC.*
+com.innov8tif.facedetector.*
+com.innov8tif.okaycam.*
+com.innov8tif.okaydoc.*
+com.innov8tif.okayid.*
+com.innov8tif.okayidlite.*
+com.innovativeastrosolutions.*
+com.innovattic.*
+com.innovenso.eventsourcing.*
+com.innovenso.townplanner.*
+com.innoventsolutions.birt-spring-boot.*
+com.innoventsolutions.birt.runtime.*
+com.innowhere.*
+com.inocybe.api.*
+com.inomera.telco.commons.*
+com.inova8.*
+com.inpaas.*
+com.inqbarna.util.*
+com.inrupt.*
+com.inrupt.client.*
+com.inrupt.rdf.*
+com.insanitydesign.*
+com.insanityengine.*
+com.insanusmokrassar.*
+com.inscopemetrics.build.*
+com.inscopemetrics.client.*
+com.inscreen.*
+com.insidecoding.*
+com.insidion.*
+com.insidion.axon.microscope.*
+com.insightfullogic.*
+com.insightfullogic.release.*
+com.insightml.*
+com.insightmon.*
+com.insightssv.tech.*
+com.insilicalabs.*
+com.insistingon.binlogportal.*
+com.insistingon.utility.*
+com.inspire-software.lib.dto.geda.*
+com.instabug.library.*
+com.instacart.formula.*
+com.instaclustr.*
+com.instagram.*
+com.instagram.igdiskcache.*
+com.instamojo.*
+com.instana.*
+com.instructure.*
+com.instrumentalapp.*
+com.intapp.*
+com.integralblue.*
+com.integreety.*
+com.intel.*
+com.intel.analytics.bigdl.*
+com.intel.analytics.bigdl.bigquant.*
+com.intel.analytics.bigdl.core.*
+com.intel.analytics.bigdl.core.dist.*
+com.intel.analytics.bigdl.core.native.*
+com.intel.analytics.bigdl.core.native.bigquant.*
+com.intel.analytics.bigdl.core.native.ckks.*
+com.intel.analytics.bigdl.core.native.dnn.*
+com.intel.analytics.bigdl.core.native.math.*
+com.intel.analytics.bigdl.core.native.mkl.*
+com.intel.analytics.bigdl.core.native.opencv.*
+com.intel.analytics.bigdl.core.native.ppml.*
+com.intel.analytics.bigdl.dnn.*
+com.intel.analytics.bigdl.dnn.native.*
+com.intel.analytics.bigdl.native.*
+com.intel.analytics.bigdl.spark-version.*
+com.intel.analytics.zoo.*
+com.intel.arrow.*
+com.intel.bigdata.xgboost.*
+com.intel.chimera.*
+com.intel.daal.*
+com.intel.dal.*
+com.intel.gkl.*
+com.intel.icecp.*
+com.intel.icecp.module.*
+com.intel.ie.analytics.*
+com.intel.jndn.management.*
+com.intel.jndn.mock.*
+com.intel.jndn.utils.*
+com.intel.oap.*
+com.intel.pmem.*
+com.intel.qat.*
+com.intel.sgx.*
+com.intel.spark.*
+com.intele.chimera.*
+com.intelemage.*
+com.inteligr8.*
+com.inteligr8.activiti.*
+com.inteligr8.alfresco.*
+com.inteligr8.ootbee.*
+com.intellectfactory.maven.plugins.*
+com.intellective.archetypes.*
+com.intellectualsites.arkitektonika.*
+com.intellectualsites.bom.*
+com.intellectualsites.fastasyncvoxelsniper.*
+com.intellectualsites.http.*
+com.intellectualsites.informative-annotations.*
+com.intellectualsites.mvdwplaceholderapi.*
+com.intellectualsites.paster.*
+com.intellectualsites.plotsquared.*
+com.intellectualsites.prtree.*
+com.intellectualsites.rorledning.*
+com.intellifylearning.*
+com.intellifylearning.stream.*
+com.intelligt.modbus.*
+com.intellij.*
+com.intellisig.*
+com.intellisrc.*
+com.intelliware.*
+com.intendia.gwt.*
+com.intendia.gwt.autorest.*
+com.intendia.gwt.autorpc.*
+com.intendia.gwt.rxgwt.*
+com.intendia.gwt.rxgwt2.*
+com.intendia.mapboxgl-jsinterop.*
+com.intendia.qualifier.*
+com.intendia.reactivity.*
+com.intenthq.*
+com.intenthq.icicle.*
+com.intenthq.pucket.*
+com.intentmedia.*
+com.intentmedia.mario.*
+com.interactivebrokers.tws.*
+com.interactuamovil.apps.contactosms.*
+com.interaso.*
+com.intercom.*
+com.intercoordinator.*
+com.interelgroup.*
+com.intergral.deep.*
+com.intergral.deep.plugins.*
+com.internetitem.*
+com.internetitem.spring.*
+com.internetitem.web.*
+com.intershop.gradle.architectural.report.*
+com.intershop.gradle.buildinfo.*
+com.intershop.gradle.escrow.*
+com.intershop.gradle.icm.*
+com.intershop.gradle.icm.docker.*
+com.intershop.gradle.isml.*
+com.intershop.gradle.javacc.*
+com.intershop.gradle.jaxb.*
+com.intershop.gradle.jobrunner.*
+com.intershop.gradle.publish.*
+com.intershop.gradle.repoconfig.*
+com.intershop.gradle.resourcelist.*
+com.intershop.gradle.scm.*
+com.intershop.gradle.sonarqube.*
+com.intershop.gradle.test.*
+com.intershop.gradle.version.*
+com.intershop.gradle.versionrecommender.*
+com.intershop.gradle.wsdl.*
+com.intershop.guice.*
+com.intershop.icm.*
+com.intershop.mycila-guice.*
+com.intershop.oms.*
+com.intershop.oms.archetype.*
+com.intershop.version.*
+com.intershop.xsd.*
+com.intersult.*
+com.interswitch.*
+com.interswitchng.*
+com.intersystems.*
+com.intesens.*
+com.inthebacklog.*
+com.inthecheesefactory.thecheeselibrary.*
+com.intilery.analytics.android.*
+com.intistele.*
+com.intoverflow.*
+com.intoverflow.base.*
+com.intoverflow.booster.*
+com.intoverflow.booster.dependencies.*
+com.intoverflow.dependencies.*
+com.intropro.*
+com.intropro.meta.generator.*
+com.intropro.prairie.*
+com.introproventures.*
+com.intsoftdev.*
+com.intuit.apl.*
+com.intuit.async.*
+com.intuit.autumn.*
+com.intuit.benten.*
+com.intuit.cloudraider.*
+com.intuit.commons.*
+com.intuit.data.autumn.*
+com.intuit.dsl.*
+com.intuit.dsl.expression.*
+com.intuit.dsl.service.*
+com.intuit.dsl.service.parent.*
+com.intuit.fuzzymatcher.*
+com.intuit.graphql.*
+com.intuit.graphql.adapter.*
+com.intuit.hooks.*
+com.intuit.innersource.*
+com.intuit.karate.*
+com.intuit.player.*
+com.intuit.player.android.*
+com.intuit.player.jvm.*
+com.intuit.player.plugins.*
+com.intuit.pulsar.*
+com.intuit.quickbooks-online.*
+com.intuit.sdp.*
+com.intuit.ssp.*
+com.intuit.wasabi.*
+com.inventage.tools.versiontiger.*
+com.inventiosystems.*
+com.inversoft.*
+com.inversoft.passport.*
+com.invincea.*
+com.invincibletec.windntrees.*
+com.invisiblecollector.*
+com.invisiblecommerce.*
+com.invitereferrals.invitereferrals.*
+com.invitereferrals.plugin-contacts.*
+com.invms.*
+com.invoiced.*
+com.invoiced.invoiced-java.*
+com.inwx.*
+com.io-informatics.oss.*
+com.io7m.anethum.*
+com.io7m.bishopsgate.*
+com.io7m.blackthorne.*
+com.io7m.blueberry.*
+com.io7m.bodyrecomp.*
+com.io7m.boxwood.*
+com.io7m.brooklime.*
+com.io7m.bundles.*
+com.io7m.calino.*
+com.io7m.canonmill.*
+com.io7m.cedarbridge.*
+com.io7m.certusine.*
+com.io7m.changelog.*
+com.io7m.checkstyle_rules.*
+com.io7m.chione.*
+com.io7m.claypot.*
+com.io7m.coffeepick.*
+com.io7m.coffeepick.gui.*
+com.io7m.cxbutton.*
+com.io7m.digal.*
+com.io7m.dixmont.*
+com.io7m.ervilla.*
+com.io7m.ethermaker.*
+com.io7m.flail.*
+com.io7m.genevan.*
+com.io7m.gtyrell.*
+com.io7m.halite.*
+com.io7m.hibiscus.*
+com.io7m.historian.*
+com.io7m.idstore.*
+com.io7m.ieee754b16.*
+com.io7m.immutables.style.*
+com.io7m.jade.*
+com.io7m.jaffirm.*
+com.io7m.jareas.*
+com.io7m.jattribute.*
+com.io7m.jaux.*
+com.io7m.jboxes.*
+com.io7m.jbssio.*
+com.io7m.jcamera.*
+com.io7m.jcanephora.*
+com.io7m.jcathinone.*
+com.io7m.jcip.*
+com.io7m.jcolorspace.*
+com.io7m.jcoords.*
+com.io7m.jdae.*
+com.io7m.jdeferthrow.*
+com.io7m.jdextrosa.*
+com.io7m.jdownload.*
+com.io7m.jequality.*
+com.io7m.jeucreader.*
+com.io7m.jfsm.*
+com.io7m.jfunctional.*
+com.io7m.jgrapht.*
+com.io7m.jintegers.*
+com.io7m.jinterp.*
+com.io7m.jlexing.*
+com.io7m.jlog.*
+com.io7m.jmulticlose.*
+com.io7m.jmurmur.*
+com.io7m.jnfp.*
+com.io7m.jnoisetype.*
+com.io7m.jnull.*
+com.io7m.jobj.*
+com.io7m.jodist.*
+com.io7m.jorchard.*
+com.io7m.jpita.*
+com.io7m.jpplib.*
+com.io7m.jpra.*
+com.io7m.jproperties.*
+com.io7m.jptbox.*
+com.io7m.jpuddle.*
+com.io7m.jqpage.*
+com.io7m.jrai.*
+com.io7m.jranges.*
+com.io7m.jregions.*
+com.io7m.jrpack.*
+com.io7m.jsamplebuffer.*
+com.io7m.jsay.*
+com.io7m.jserial.*
+com.io7m.jspatial.*
+com.io7m.jspatial.core.*
+com.io7m.jspatial.examples-jogl.*
+com.io7m.jspatial.examples-swing.*
+com.io7m.jspiel.*
+com.io7m.jstructural.*
+com.io7m.jsx.*
+com.io7m.jtensors.*
+com.io7m.junreachable.*
+com.io7m.junsigned.*
+com.io7m.jvindicator.*
+com.io7m.jvvfs.*
+com.io7m.jvvfs.core.*
+com.io7m.jvvfs.shell.*
+com.io7m.jwheatsheaf.*
+com.io7m.jwhere.*
+com.io7m.jxe.*
+com.io7m.jxtrand.*
+com.io7m.kstructural.*
+com.io7m.lanark.*
+com.io7m.looseleaf.*
+com.io7m.medrina.*
+com.io7m.mesquida.*
+com.io7m.mime2045.*
+com.io7m.minisite.*
+com.io7m.mkcsr.*
+com.io7m.modulechaser.*
+com.io7m.music.kit.dust_yard.*
+com.io7m.mutable.numbers.*
+com.io7m.oakleaf.*
+com.io7m.pallene.*
+com.io7m.percentpass.*
+com.io7m.portero.*
+com.io7m.primogenitor.*
+com.io7m.quarrel.*
+com.io7m.quixote.*
+com.io7m.r2.*
+com.io7m.readme.*
+com.io7m.repetoir.*
+com.io7m.saxon-plugin.*
+com.io7m.scando.*
+com.io7m.seltzer.*
+com.io7m.sigiltron.*
+com.io7m.smfj.*
+com.io7m.smfj.jcanephora.*
+com.io7m.sombrero.*
+com.io7m.stmp.*
+com.io7m.streamtime.*
+com.io7m.sunburst.*
+com.io7m.tabla.*
+com.io7m.taskrecorder.*
+com.io7m.testartifact.*
+com.io7m.timehack6435126.*
+com.io7m.trasco.*
+com.io7m.verdant.*
+com.io7m.verona.*
+com.io7m.wastebasket.*
+com.io7m.waxmill.*
+com.io7m.wendover.*
+com.io7m.xoanon.*
+com.io7m.xom.*
+com.io7m.xstructural.*
+com.io7m.zelador.*
+com.io7m.zeptoblog.*
+com.iobeam.*
+com.iodesystems.*
+com.iodesystems.android.*
+com.iodesystems.dataset.*
+com.iodesystems.selenium-jquery.*
+com.ioenv.preferences.*
+com.iofairy.*
+com.iohao.game.*
+com.iohao.widget.*
+com.iomolecule.*
+com.ionic.*
+com.ionic.cloudstorage.*
+com.ionicsecurity.ipcs.awss3.*
+com.ionicsecurity.ipcs.google.*
+com.ionoscloud.*
+com.ionoscloud.certmanager.*
+com.ionoscloud.containerregistry.*
+com.ionoscloud.dataplatform.*
+com.ionoscloud.dbaasmongo.*
+com.ionoscloud.dbaaspostgres.*
+com.ionspin.kotlin.*
+com.iopipe.*
+com.iorga.*
+com.iotake.suller.*
+com.iotecksolutions.*
+com.iovation.launchkey.*
+com.ip2location.*
+com.ip2proxy.*
+com.ipeakoin.*
+com.ipisces42.*
+com.ippopay.*
+com.iprogrammerr.*
+com.iptiq.*
+com.iqarr.bean.*
+com.iqarr.cache.*
+com.iqarr.compiler.*
+com.iqarr.extension.spi.*
+com.iqarr.http.*
+com.iqarr.keywords.*
+com.iqarr.maven.plugin.*
+com.iqarr.redis.*
+com.iqarr.security.*
+com.iqarr.session.*
+com.iqiny.silly.*
+com.iqiyi.xcrash.*
+com.iravid.*
+com.ircclouds.irc.*
+com.iremembr.jtraxxs.*
+com.ireul.azuki.*
+com.ireul.nerf.*
+com.irobotzz.cache.*
+com.ironcorelabs.*
+com.ironhorsesoftware.silhouette.*
+com.ironoreserver.*
+com.ironsoftware.*
+com.ironsrc.atom.*
+com.irotsoma.cloudbackenc.*
+com.irotsoma.cloudbackenc.common.*
+com.irotsoma.web.*
+com.irurueta.*
+com.isaacrf.epicbitmaprenderer.*
+com.isadounikau.*
+com.isalldigital.*
+com.isapp.android.*
+com.iselsoft.*
+com.isenshi.*
+com.iserviceapi.*
+com.isfett.*
+com.ishumei.smantifraud.*
+com.islepark.*
+com.ismailisleem.automation.*
+com.ismailmekni.*
+com.ismetozozturk.*
+com.isomorphic.*
+com.isoops.*
+com.isoterik.*
+com.isotrol.impe3.*
+com.isotrol.impe3.extensions.*
+com.isotrol.impe3.maven.*
+com.isotrol.impe3.tickets.*
+com.isthisone.*
+com.isupatches.*
+com.isupatches.android.*
+com.isupatches.android.wisefy.*
+com.isuwang.*
+com.iswsc.*
+com.isxcode.acorn.*
+com.isxcode.oxygen.*
+com.isxcode.star.*
+com.isycat.*
+com.it-surmann.*
+com.itachi1706.appupdater.*
+com.itachi1706.cepaslib.*
+com.itachi1706.helpers.*
+com.itagile.logic.*
+com.itangcent.*
+com.itcoon.*
+com.itcoon.boot.*
+com.itcuc.*
+com.itdevcloud.sprout.*
+com.iteaj.*
+com.iteblog.*
+com.itechtopus.tanks.*
+com.itelg.*
+com.itelg.spring.*
+com.itemis.*
+com.itemis.maven.plugins.*
+com.itenebris.*
+com.iterable.*
+com.iterable.pulsar4s.*
+com.iterable.scalasoup_2.13.0.1.0.0.1.0.com.iterable.*
+com.iteratehq.*
+com.itextpdf.*
+com.itextpdf.android.*
+com.itextpdf.maven.*
+com.itextpdf.tool.*
+com.iteye.yangdong.*
+com.itfsw.*
+com.itheima.em.*
+com.itheima.em.auth.*
+com.ithit.webdav.*
+com.ithit.webdav.integration.*
+com.ithit.webdav.server.*
+com.itith.common.*
+com.itlgl.*
+com.itlgl.android.*
+com.itmaoo.common.convert.*
+com.itmuch.*
+com.itmuch.redis.*
+com.itmuch.security.*
+com.itnove.corball.*
+com.itplh.opensource.*
+com.itquasar.multiverse.*
+com.itranswarp.*
+com.itranswarp.openweixin.*
+com.itranswarp.summer.*
+com.itsaky.androidide.*
+com.itsaky.androidide.gradle.*
+com.itsallbinary.*
+com.itsccn.*
+com.itshidu.commons.*
+com.itshidu.ffmpeg.*
+com.itshidu.web.*
+com.itsmeijers.*
+com.itspz.dtp.*
+com.itude.mobile.android.mobbl.*
+com.itude.mobile.android.util.*
+com.itv.*
+com.itv.chuckwagon.*
+com.itxca.msa.*
+com.itxca.spannablex.*
+com.itxiaoer.commons.*
+com.itxiaoer.dis.*
+com.itxiaoer.maven.plugins.*
+com.itzhai.tools.*
+com.iusmob.adklein.ad.*
+com.iusmob.adklein.ad.adapter.*
+com.iusmob.adklein.ad.third.*
+com.iussoft.*
+com.iuyun.*
+com.ivanceras.*
+com.ivanempire.*
+com.ivankocijan.*
+com.iveely.*
+com.ivianuu.essentials.*
+com.ivianuu.essentials.compose.*
+com.ivianuu.injekt.*
+com.ivmoreau.*
+com.ivona.*
+com.ivonacloud.*
+com.iwaconsolti.*
+com.iwantunlimited.*
+com.iwbfly.*
+com.iwdnb.*
+com.iwillfailyou.*
+com.iwinback.*
+com.iwuyc.tools.*
+com.iwuyc.tpg4j.*
+com.ixaris.ope.*
+com.ixaris.oss.*
+com.ixortalk.*
+com.iyetoo.mpm.*
+com.iyzipay.*
+com.iz2use.*
+com.izettle.*
+com.izettle.wrench.*
+com.izivia.*
+com.izliang.common.*
+com.izooto.*
+com.j256.*
+com.j256.cloudwatchlogbackappender.*
+com.j256.ormlite.*
+com.j256.simplecsv.*
+com.j256.simplejmx.*
+com.j256.simplelogging.*
+com.j256.simplemagic.*
+com.j256.simplemetrics.*
+com.j256.simplewebframework.*
+com.j256.spring-request-doclet.*
+com.j256.testcheckpublisher.*
+com.j256.two-factor-auth.*
+com.j2bugzilla.*
+com.j2html.*
+com.j2mvc.*
+com.j2speed.*
+com.ja-netfilter.*
+com.jacarrichan.*
+com.jack90john.*
+com.jackhallam.*
+com.jackpocket.*
+com.jackson42.play.*
+com.jackson42.play.jooq.*
+com.jacobmountain.*
+com.jacobtread.blaze.*
+com.jacobtread.morse.*
+com.jacobtread.netty.*
+com.jacobtread.shttp.*
+com.jacobtread.xml.*
+com.jaeksoft.*
+com.jafpl.*
+com.jahnelgroup.cartographer.*
+com.jahnelgroup.flogger.*
+com.jahnelgroup.jackson.*
+com.jajuka.*
+com.jakehschwartz.*
+com.jakewharton.*
+com.jakewharton.android.repackaged.*
+com.jakewharton.auto.value.*
+com.jakewharton.byteunits.*
+com.jakewharton.cite.*
+com.jakewharton.confundus.*
+com.jakewharton.crossword.*
+com.jakewharton.dagger.*
+com.jakewharton.dex.*
+com.jakewharton.espresso.*
+com.jakewharton.fliptables.*
+com.jakewharton.hugo.*
+com.jakewharton.madge.*
+com.jakewharton.mosaic.*
+com.jakewharton.moshi.*
+com.jakewharton.nopen.*
+com.jakewharton.picasso.*
+com.jakewharton.picnic.*
+com.jakewharton.retrofit.*
+com.jakewharton.retrolambda.*
+com.jakewharton.rx.*
+com.jakewharton.rx2.*
+com.jakewharton.rx3.*
+com.jakewharton.rxbinding.*
+com.jakewharton.rxbinding2.*
+com.jakewharton.rxbinding3.*
+com.jakewharton.rxbinding4.*
+com.jakewharton.rxrelay.*
+com.jakewharton.rxrelay2.*
+com.jakewharton.rxrelay3.*
+com.jakewharton.scalpel.*
+com.jakewharton.sdkmanager.*
+com.jakewharton.threetenabp.*
+com.jakewharton.timber.*
+com.jakewharton.twirl.*
+com.jakewharton.wormhole.*
+com.jakewins.*
+com.jalalkiswani.*
+com.jaliansystems.*
+com.jam2in.arcus.*
+com.jamcracker.adapter.jit.*
+com.jamcracker.jifs.*
+com.jamcracker.testsoti.*
+com.jameskleeh.*
+com.jamesmcg.easylib.*
+com.jamesmurty.utils.*
+com.jamesratzlaff.*
+com.jamesstapleton.checkstyle.*
+com.jameswald.skinnylatte.*
+com.jamesward.*
+com.jamierf.*
+com.jamierf.db-table.*
+com.jamierf.dropwizard.*
+com.jamieswhiteshirt.*
+com.jamiussiam.*
+com.jamonapi.*
+com.jamshedalamqaderi.*
+com.jamshedalamqaderi.anview.*
+com.jamshedalamqaderi.ktransport.*
+com.jamshedalamqaderi.spintaxkt.*
+com.janduja.*
+com.janeluo.*
+com.janloong.*
+com.jano7.*
+com.janosgats.*
+com.janosgats.logging.*
+com.janramm.*
+com.janyee.bladea.*
+com.jaooooo.*
+com.japplis.*
+com.jappyframework.*
+com.jarcasting.*
+com.jardoapps.*
+com.jaredholdcroft.java.*
+com.jaredrummler.*
+com.jaredsburrows.*
+com.jaredsburrows.license.*
+com.jaredsburrows.retrofit.*
+com.jaredsburrows.spoon.*
+com.jaregu.*
+com.jaroop.*
+com.jarredweb.repo.*
+com.jarrodwb.*
+com.jarslab.maven.*
+com.jarslab.skippy.*
+com.jarslab.ts.*
+com.jartah.*
+com.jarunj.xml.*
+com.jarxi.*
+com.jashmore.*
+com.jason-goodwin.*
+com.jasonbaldridge.*
+com.jasonclawson.*
+com.jasonclawson.dropwizardry.*
+com.jasonwjones.griddly.*
+com.jasonwjones.jolo.*
+com.jasonwjones.pbcs.*
+com.jasperdenkers.*
+com.jatinpuri.*
+com.jatun.open.tools.*
+com.jauntsdn.netty.*
+com.jauntsdn.rsocket.*
+com.java-adventures.glassfish.realm.salted.*
+com.java-adventures.junit.*
+com.java-adventures.rsc.*
+com.java-adventures.security.*
+com.java-adventures.smarkdown.*
+com.java-adventures.yuml.*
+com.java2e.*
+com.javabaas.*
+com.javadocmd.*
+com.javadude.*
+com.javaear.*
+com.javaen.*
+com.javaetmoi.core.*
+com.javaetmoi.util.*
+com.javaexchangeconnector.*
+com.javaforge.scriptella.*
+com.javafx.*
+com.javakoan.*
+com.javalbert.*
+com.javamicroservice.*
+com.javamis.*
+com.javanut.*
+com.javaoffers.*
+com.javaquery.*
+com.javarepl.*
+com.javashun.cloud.*
+com.javaslang.*
+com.javasolver.*
+com.javastreets.*
+com.javatechnics.com.edugility.*
+com.javatechnics.flexfx.*
+com.javax0.*
+com.javax0.aptools.*
+com.javax0.concordion.extensions.*
+com.javax0.fluflu.*
+com.javax0.geci.*
+com.javax0.jamal.*
+com.javax0.javaLex.*
+com.javax0.license3j.*
+com.javax0.mavenDownload.*
+com.javax0.repl.*
+com.javax0.scriapt.*
+com.javax0.sourcebuddy.*
+com.javax0.util.*
+com.javax0.yamaledt.*
+com.javax1.geci.*
+com.javedrpi.*
+com.javierllorente.*
+com.javiersc.androidsearchview.*
+com.javiersc.arrow.*
+com.javiersc.compose-resources.*
+com.javiersc.compose.*
+com.javiersc.compose.resources.*
+com.javiersc.detekt-rules.*
+com.javiersc.either.*
+com.javiersc.gradle-extensions.*
+com.javiersc.gradle-plugins.*
+com.javiersc.gradle.*
+com.javiersc.gradle.plugins.all.projects.*
+com.javiersc.gradle.plugins.android.library.*
+com.javiersc.gradle.plugins.build.version.catalogs.*
+com.javiersc.gradle.plugins.build.version.catalogs.updater.*
+com.javiersc.gradle.plugins.changelog.*
+com.javiersc.gradle.plugins.code.analysis.*
+com.javiersc.gradle.plugins.code.coverage.*
+com.javiersc.gradle.plugins.code.formatter.*
+com.javiersc.gradle.plugins.dependency.updates.*
+com.javiersc.gradle.plugins.docs.*
+com.javiersc.gradle.plugins.gradle.wrapper.updater.*
+com.javiersc.gradle.plugins.kotlin.config.*
+com.javiersc.gradle.plugins.kotlin.jvm.*
+com.javiersc.gradle.plugins.kotlin.library.*
+com.javiersc.gradle.plugins.kotlin.multiplatform.*
+com.javiersc.gradle.plugins.kotlin.multiplatform.no.android.*
+com.javiersc.gradle.plugins.massive.catalogs.updater.*
+com.javiersc.gradle.plugins.nexus.*
+com.javiersc.gradle.plugins.projects.version.catalog.*
+com.javiersc.gradle.plugins.publish.*
+com.javiersc.gradle.plugins.publish.android.library.*
+com.javiersc.gradle.plugins.publish.gradle.plugin.*
+com.javiersc.gradle.plugins.publish.kotlin.jvm.*
+com.javiersc.gradle.plugins.publish.kotlin.multiplatform.*
+com.javiersc.gradle.plugins.publish.version.catalog.*
+com.javiersc.gradle.plugins.readme.badges.generator.*
+com.javiersc.gradle.plugins.versioning.*
+com.javiersc.hubdle.*
+com.javiersc.hubdle.project.*
+com.javiersc.hubdle.settings.*
+com.javiersc.kamp.*
+com.javiersc.kotlin.*
+com.javiersc.kotlinx.*
+com.javiersc.logger.*
+com.javiersc.massive-catalogs.*
+com.javiersc.mokoki.*
+com.javiersc.network-response.*
+com.javiersc.network.*
+com.javiersc.resource.*
+com.javiersc.resources.*
+com.javiersc.run-blocking-kmp.*
+com.javiersc.run-blocking.*
+com.javiersc.semantic-versioning.*
+com.javiersc.semver.*
+com.javiersc.semver.gradle.plugin.*
+com.javiersc.semver.project.*
+com.javiersc.semver.settings.*
+com.javonet.*
+com.jawnnypoo.*
+com.jaxio.*
+com.jaxio.celerio.*
+com.jaxio.celerio.packs.*
+com.jayantkrish.*
+com.jayantkrish.jklol.*
+com.jayantkrish.pnp.*
+com.jayasuryat.mendable.*
+com.jaynewstrom.*
+com.jayqqaa12.*
+com.jayway.android.robotium.*
+com.jayway.awaitility.*
+com.jayway.facebooktestjavaapi.*
+com.jayway.facebooktestjavaapi.examples.*
+com.jayway.forest.*
+com.jayway.jax-rs-hateoas.*
+com.jayway.jsonpath.*
+com.jayway.maven.plugins.android.generation1.*
+com.jayway.maven.plugins.android.generation1.plugins.*
+com.jayway.maven.plugins.android.generation2.*
+com.jayway.maven.plugins.lab.*
+com.jayway.restassured.*
+com.jayway.restassured.examples.*
+com.jayway.restfuljersey.*
+com.jayxu.*
+com.jazeee.*
+com.jbangit.app.*
+com.jbirdvegas.groovy.utils.*
+com.jblur.*
+com.jblv.*
+com.jcabi.*
+com.jcabi.incubator.*
+com.jcarrey.*
+com.jccworld.*
+com.jcdecaux.opendata.*
+com.jcdecaux.setl.*
+com.jcex.open.*
+com.jcohy.*
+com.jcohy.asciidoctor.backends.*
+com.jcohy.gradle.*
+com.jcovalent.junit.*
+com.jcraft.*
+com.jcsk100.*
+com.jd.alpha.*
+com.jd.binaryproto.*
+com.jd.blockchain.*
+com.jd.custom.*
+com.jd.easyflow.*
+com.jd.httpservice.*
+com.jd.joyqueue.*
+com.jd.laf.web.*
+com.jd.utils.*
+com.jdapi.*
+com.jdcloud.*
+com.jdcloud.api.*
+com.jdcloud.apigateway.*
+com.jdcloud.function.*
+com.jdcloud.jdsf.*
+com.jdcloud.jmsf.*
+com.jdcloud.logs.*
+com.jdcloud.poi.*
+com.jdcloud.sdk.*
+com.jdcloud.sdk.apim.*
+com.jdcloud.sgm.*
+com.jdersen.jcommandlib.*
+com.jdiai.*
+com.jdiai.tools.*
+com.jdkhome.blzo.*
+com.jdkhome.twiggy.*
+com.jdotsoft.*
+com.jdroidframework.*
+com.jdroidtools.*
+com.jdsu.drivetest.ims.interfaces.*
+com.jdsu.drivetest.polqa.manager.interfaces.*
+com.jeantuffier.statemachine.*
+com.jeasyplus.*
+com.jecklgamis.*
+com.jedlix.*
+com.jeeapp.*
+com.jeequan.*
+com.jeestack.*
+com.jeesuite.*
+com.jeesys.framework.*
+com.jeevansurendran.*
+com.jeff-media.*
+com.jeffknecht.dynadao.*
+com.jeffpdavidson.kotwords.*
+com.jeffreypasternack.*
+com.jeffrodriguez.*
+com.jejking.*
+com.jelastic.*
+com.jenjinstudios.*
+com.jenmaarai.*
+com.jensfendler.*
+com.jentis.*
+com.jenzz.appstate.*
+com.jenzz.noop.*
+com.jenzz.test.*
+com.jeongen.cosmos.*
+com.jeppeman.*
+com.jeppeman.globallydynamic.*
+com.jeppeman.globallydynamic.android.*
+com.jeppeman.globallydynamic.gradle.*
+com.jeppeman.globallydynamic.server.*
+com.jeppeman.locallydynamic.*
+com.jeppeman.locallydynamic.server.*
+com.jeppeman.mockposable.*
+com.jeramtough.*
+com.jerehao.*
+com.jeremiahzucker.test.bazel.*
+com.jereztech.*
+com.jeroensteenbeeke.*
+com.jeroensteenbeeke.vavr.*
+com.jerolba.*
+com.jeromeloisel.*
+com.jessecorbett.*
+com.jesus-crie.*
+com.jetbeep.*
+com.jetbrains.format-ripper.*
+com.jetbrains.hub.*
+com.jetbrains.rd.*
+com.jetdrone.*
+com.jetprobe.*
+com.jewelexx.*
+com.jexbox.connector.*
+com.jfastnet.*
+com.jfinal.*
+com.jfinalplus.*
+com.jfireframework.*
+com.jfirer.*
+com.jflyfox.*
+com.jfoenix.*
+com.jfolson.*
+com.jfrog.*
+com.jgalgo.*
+com.jgazula.*
+com.jgcomptech.tools.*
+com.jgeppert.struts2.*
+com.jgeppert.struts2.bootstrap.*
+com.jgeppert.struts2.jquery.*
+com.jgoodies.*
+com.jhickman.*
+com.jhlabs.*
+com.jia54321.*
+com.jiabangou.*
+com.jianggujin.*
+com.jiangkedev.*
+com.jianglibo.easyinstaller.*
+com.jiangruyi.summer.*
+com.jiangyc.*
+com.jiangyy.core.*
+com.jiangyy.dialog.*
+com.jiangyy.third.*
+com.jiankangyouyi.*
+com.jiankangyouyi.healthai.*
+com.jianpage.*
+com.jibo.apptoolkit.*
+com.jibo.apptoolkit.android.*
+com.jibug.cetty.*
+com.jidesoft.*
+com.jiechic.android.library.*
+com.jiechic.library.*
+com.jiechic.library.sqlbrite.*
+com.jiechic.library.sqlbrite2.*
+com.jiechic.library.wire.*
+com.jiechic.proto.wire.*
+com.jiedangou.*
+com.jijiancode.*
+com.jillesvangurp.*
+com.jimbru.posix.*
+com.jimetevenard.xml.*
+com.jimmoores.*
+com.jimulabs.mirrorsandbox.*
+com.jimulabs.motionkit.*
+com.jinais.android.*
+com.jincanshen.*
+com.jingsky.*
+com.jingtum.*
+com.jinrishici.*
+com.jintegrity.*
+com.jinvovo.pay.sdk.*
+com.jinxiuyun.*
+com.jinyframework.*
+com.jirvan.*
+com.jituancaiyun.openapi.*
+com.jiubanqingchen.*
+com.jiutianniao.*
+com.jiuxian.*
+com.jive.foss.*
+com.jive.foss.commons.*
+com.jive.foss.pnky.*
+com.jivesoftware.*
+com.jivesoftware.os.jive.*
+com.jivesoftware.os.jive.utils.*
+com.jivesoftware.os.jive.utils.inheritance.poms.*
+com.jivesoftware.os.mlogger.*
+com.jivesoftware.os.mlogger.inheritance.poms.*
+com.jivesoftware.os.tasmo.*
+com.jivosite.sdk.*
+com.jizhi7.*
+com.jizhi7.org.apache.maven.plugins.*
+com.jjeanjacques.*
+com.jjlharrison.*
+com.jjmoo.*
+com.jjoe64.*
+com.jkojote.types.*
+com.jkoolcloud.*
+com.jkoolcloud.client.api.*
+com.jkoolcloud.jesl.net.*
+com.jkoolcloud.tnt4j.*
+com.jkoolcloud.tnt4j.logger.*
+com.jkoolcloud.tnt4j.stream.*
+com.jkoolcloud.tnt4j.stream.java.*
+com.jkoolcloud.tnt4j.streams.*
+com.jlbtuz.fire.helper.*
+com.jlefebure.*
+com.jleth.util.*
+com.jlhood.*
+com.jmethods.*
+com.jmuscles.*
+com.jnape.dynamic-collections.*
+com.jnape.loan-shark.*
+com.jnape.palatable.*
+com.jnericks.*
+com.jnericks.testlib.*
+com.jnngl.*
+com.jnpersson.*
+com.jntoo.*
+com.joanzapata.android.*
+com.joanzapata.android.asyncservice.*
+com.joanzapata.android.iconify.*
+com.joanzapata.android.kiss.*
+com.joanzapata.iconify.*
+com.joanzapata.mapper.*
+com.joanzapata.pdfview.*
+com.joanzapata.tilesview.*
+com.joanzapata.utils.*
+com.joaoassuncao.osgi-utils.*
+com.joaomgcd.*
+com.joaquimverges.helium.*
+com.jobhive.*
+com.jobhive.saki-monkey.*
+com.jobisjob.*
+com.jobjects.*
+com.joecwu.*
+com.joefkelley.*
+com.joehalliwell.*
+com.joehxblog.*
+com.joepritzel.*
+com.joescii.*
+com.joestelmach.*
+com.johnathangilday.*
+com.johnbnelson.*
+com.johnowl.*
+com.johnpili.*
+com.johnsnowlabs.nlp.*
+com.johnsoncs.gwt.*
+com.join-stories.*
+com.joinesty.*
+com.joinforage.*
+com.joinstoriessdk.*
+com.jolbox.*
+com.joliciel.jochre.*
+com.joliciel.ljtrad.*
+com.joliciel.talismane.*
+com.jolira.*
+com.jolira.enzian.*
+com.jolira.logdb.*
+com.jolira.types.checkers.*
+com.jollydays.camel.*
+com.jollymax.*
+com.jonathanfinerty.once.*
+com.jonfreer.*
+com.jonganhf.*
+com.jonganhf.horizontaltimeline.*
+com.jongsoft.finance.*
+com.jongsoft.lang.*
+com.jongsoft.test.*
+com.jongsoft.utils.*
+com.jonlandrum.*
+com.jonnymatts.*
+com.jonnymatts.prometheus.*
+com.jonnywray.vertx.*
+com.jontodd.*
+com.joom.colonist.*
+com.joom.grip.*
+com.joom.lightsaber.*
+com.joom.paranoid.*
+com.joom.smuggler.*
+com.joom.spark.*
+com.joom.tracing.*
+com.joom.xxhash.*
+com.joonsang.graylog.*
+com.joooonho.*
+com.jopss.*
+com.joptimizer.*
+com.jordansamhi.*
+com.jordial.datimprint.*
+com.jorsek.publishing.*
+com.joseflavio.*
+com.joseph-dwyer.katana.*
+com.josephpconley.*
+com.josesamuel.*
+com.joshcanfield.*
+com.joshlong.*
+com.josketres.*
+com.jounaidr.*
+com.journeyapps.*
+com.jovezhao.nest.*
+com.jovx.*
+com.joyent.http-signature.*
+com.joyent.manta.*
+com.joyent.triton.*
+com.joyent.util.*
+com.joyzl.*
+com.jpaquery.*
+com.jparams.*
+com.jpardogo.flabbylistview.*
+com.jpardogo.googleprogressbar.*
+com.jpardogo.listbuddies.*
+com.jpardogo.materialtabstrip.*
+com.jpardus.*
+com.jpardus.cron.*
+com.jpardus.db.*
+com.jpardus.spider.*
+com.jpattern.*
+com.jpaulmorrison.*
+com.jpmilhau.*
+com.jpmorgan.quorum.*
+com.jpomykala.*
+com.jporm.*
+com.jpragma.*
+com.jptangchina.*
+com.jquicker.*
+com.jquicker.plugin.*
+com.jr-database-tools.dbworkbench.*
+com.jramoyo.*
+com.jramoyo.flowee.*
+com.jraska.*
+com.jraska.livedata.*
+com.jremoter.*
+com.jrmf360.*
+com.jrodeo.*
+com.jrodmanu.*
+com.jrtzcloud.*
+com.jrummyapps.*
+com.js-lib.*
+com.jsceasy.edp.*
+com.jsexecutor.*
+com.jsftoolkit.*
+com.jshobe.secrethub.*
+com.jsibbold.*
+com.jsimplec.*
+com.jsjrong.*
+com.jskierbi.*
+com.jslint.*
+com.jslsolucoes.*
+com.jsmartframework.*
+com.jsoftbiz.*
+com.json4orm.*
+com.jsonex.*
+com.jsoniter.*
+com.jsontypedef.jtd.*
+com.jspcore.*
+com.jspha.*
+com.jssolo.*
+com.jstarczewski.kstate.*
+com.jsuereth.*
+com.jsunsoft.*
+com.jsunsoft.commons.*
+com.jsunsoft.http.*
+com.jsunsoft.util.*
+com.jtattoo.*
+com.jtconnors.*
+com.jtconnors.socket.*
+com.jtdowney.*
+com.jtechdev.*
+com.jteigen.*
+com.jtelegram.*
+com.jtfmumm.*
+com.jthinking.common.*
+com.jthinking.jdbaudit.*
+com.jthinking.jsecscan.*
+com.jtransc.*
+com.jtransc.gdx.*
+com.jtransc.media.*
+com.jtravan3.*
+com.jtschwartz.*
+com.juanmuscaria.*
+com.jubalrife.*
+com.jubiman.*
+com.juconcurrent.infra.*
+com.judopay.*
+com.jug6ernaut.*
+com.jug6ernaut.debugdrawer.*
+com.jug6ernaut.saber.*
+com.juhuasuan.*
+com.jujunie.service.*
+com.jukta.*
+com.jukusoft.*
+com.juliaaano.*
+com.juliangip.*
+com.julianohsf.*
+com.julianpeeters.*
+com.julienarzul.*
+com.julienlavergne.*
+com.julienvey.trello.*
+com.julienviet.*
+com.juliozynger.floorplan.*
+com.july-cloud.*
+com.july-cloud.nacos.*
+com.jumper-health.*
+com.junichi11.netbeans.modules.*
+com.junkchen.blelib.*
+com.junmoyu.*
+com.juntaki.*
+com.junziqian.*
+com.jupiter-tools.*
+com.juracus.api.*
+com.just-ai.aimybox.*
+com.just-ai.jaicf.*
+com.justdavis.karl.jessentials.*
+com.justifiedsolutions.*
+com.justinblank.*
+com.justtoplay.*
+com.justtoplay.panda.*
+com.juul.able.*
+com.juul.datadog.*
+com.juul.exercise.*
+com.juul.indexeddb.*
+com.juul.kable.*
+com.juul.koap.*
+com.juul.krayon.*
+com.juul.pommel.*
+com.juul.stropping.*
+com.juul.tuulbox.*
+com.juvenxu.portable-config-maven-plugin.*
+com.jvj28.homeworks.*
+com.jvm123.*
+com.jvmbytes.*
+com.jvmbytes.agent.*
+com.jvmbytes.commons.*
+com.jvmbytes.spy.*
+com.jvmbytes.spy.plugin.*
+com.jwebmp.*
+com.jwebmp.apps.*
+com.jwebmp.core.*
+com.jwebmp.examples.*
+com.jwebmp.examples.undertow.*
+com.jwebmp.guicedee.*
+com.jwebmp.guicedee.persistence.*
+com.jwebmp.guicedee.servlets.*
+com.jwebmp.inject.*
+com.jwebmp.inject.extensions.*
+com.jwebmp.jackson.*
+com.jwebmp.jackson.core.*
+com.jwebmp.jackson.datatype.*
+com.jwebmp.jackson.module.*
+com.jwebmp.jpms.*
+com.jwebmp.jpms.commons.*
+com.jwebmp.jpms.guice.*
+com.jwebmp.jpms.jackson.*
+com.jwebmp.jpms.jackson.core.*
+com.jwebmp.jpms.jackson.datatype.*
+com.jwebmp.jpms.jackson.module.*
+com.jwebmp.jpms.sqlserver.*
+com.jwebmp.jre10.*
+com.jwebmp.jre11.*
+com.jwebmp.jre11.jackson.*
+com.jwebmp.jre11.jackson.core.*
+com.jwebmp.plugins.*
+com.jwebmp.plugins.angular.*
+com.jwebmp.plugins.blueimp.*
+com.jwebmp.plugins.bootstrap.*
+com.jwebmp.plugins.effects.*
+com.jwebmp.plugins.forms.*
+com.jwebmp.plugins.graphing.*
+com.jwebmp.plugins.iconsets.*
+com.jwebmp.plugins.ion.*
+com.jwebmp.plugins.javascript.*
+com.jwebmp.plugins.jquery.*
+com.jwebmp.plugins.security.*
+com.jwebmp.themes.*
+com.jwebmp.thirdparty.*
+com.jwebmp.thirdparty.jcache.*
+com.jwebmp.thirdparty.jms.*
+com.jwoolston.android.*
+com.jworx.logfacade.*
+com.jwplayer.*
+com.jwsphere.*
+com.jwt4j.*
+com.jxrisesun.*
+com.jyuzawa.*
+com.jzallas.*
+com.jzbrooks.*
+com.jzbrooks.vgo.*
+com.jzeromq.*
+com.jzhangdeveloper.newsapi.*
+com.k-teq.gwt.*
+com.k2future.*
+com.k317h.*
+com.k4hub.*
+com.kaaprotech.*
+com.kaazing.*
+com.kabouterlabs.*
+com.kacheyi.ureport.*
+com.kaching.platform.*
+com.kaderate.*
+com.kafeblog.vertx.*
+com.kafkata.*
+com.kageiit.*
+com.kagurabi.*
+com.kagurabi.contrib.*
+com.kagurabi.example.*
+com.kagurabi.services.*
+com.kagurabi.shared.*
+com.kailuowang.*
+com.kaissersoft.*
+com.kakao.cuesheet.*
+com.kakao.mango.*
+com.kakawait.*
+com.kaleido.*
+com.kalman03.*
+com.kaltura.*
+com.kaltura.dtg.*
+com.kaltura.netkit.*
+com.kaltura.player.*
+com.kaltura.playkit.*
+com.kalynx.*
+com.kameleoon.*
+com.kameocode.*
+com.kamingpan.infrastructure.*
+com.kamingpan.pay.*
+com.kamomileware.maven.plugin.*
+com.kamomileware.maven.plugin.opencms.*
+com.kangaroohy.*
+com.kangaroorewards.*
+com.kangxiaoguang.auto-app-version.*
+com.kangxiaoguang.gradle.tools.*
+com.kangyonggan.*
+com.kanyun.kace.*
+com.kaozgamer.android.*
+com.kapeta.*
+com.kapilvirenahuja.*
+com.kapoorlabs.*
+com.kappadrive.*
+com.kappadrive.testcontainers.*
+com.karacca.*
+com.karakays.hibernate.*
+com.karalabe.iris.*
+com.karmios.modulo.*
+com.karumi.*
+com.karumi.hagu.*
+com.karumi.kotlinsnapshot.*
+com.karumi.rosie.*
+com.karuslabs.*
+com.kasem-sm.easystore.*
+com.kashoo.*
+com.kasinf.*
+com.kasisoft.*
+com.kasisoft.cdi.*
+com.kasisoft.mgnl.*
+com.kasisto.*
+com.kasonchan.*
+com.kasparpeterson.*
+com.kaspersky.android-components.*
+com.kastkode.*
+com.kasukusakura.*
+com.kasukusakura.kamiloply.*
+com.kasukusakura.mirai-console-junit5.*
+com.katalon.*
+com.katalon.testops.*
+com.katanox.*
+com.katedraclases.sdk.*
+com.katujo.*
+com.kauailabs.navx.frc.*
+com.kauailabs.vmx.first.hal.*
+com.kauailabs.vmx.first.phoenix.*
+com.kauailabs.vmx.platform.*
+com.kauridev.lunar.*
+com.kaylves.jeasy.*
+com.kayrasolutions.aem.experienceframework.*
+com.kayrasolutions.aem.foundation.*
+com.kazakago.cryptore.*
+com.kazakago.friedtoast.*
+com.kazakago.parallaximageview.*
+com.kazakago.stateawaredialogfragment.*
+com.kazakago.storeflowable.*
+com.kazakago.swr.compose.*
+com.kazurayam.*
+com.kbakhtiari.*
+com.kbanquan.*
+com.kbeanie.*
+com.kbkbqiang.*
+com.kborowy.*
+com.kboyarshinov.*
+com.kcthota.*
+com.kdgregory.bcelx.*
+com.kdgregory.log4j.*
+com.kdgregory.logging.*
+com.kdgregory.util.*
+com.keaixiang.*
+com.kebest.cloud.*
+com.kedauis.*
+com.keenencharles.*
+com.keepersecurity.secrets-manager.*
+com.keiferstone.*
+com.keimons.deepjson.*
+com.keimons.platform.*
+com.keithbranton.mojo.*
+com.keithtmiller.*
+com.kelveden.*
+com.kelveden.rastajax.*
+com.kemean.*
+com.kemichal.*
+com.kenai.jbosh.*
+com.kenai.jxse.*
+com.kenai.nbpwr.*
+com.kenai.swingjavabuilderext.*
+com.kendamasoft.*
+com.kennethjorgensen.*
+com.kennycason.*
+com.kenshoo.*
+com.kentico.delivery.*
+com.kenticocloud.*
+com.kenzan.*
+com.kenzan.hystrix.*
+com.kenzan.rxjava.*
+com.kerb4j.*
+com.kerbaya.*
+com.kerbaya.maven.*
+com.kerbores.*
+com.kernelstudio.*
+com.kernelstudio.component.*
+com.kerooker.simplefeaturethrottler.*
+com.kerooker.simpleproperties.*
+com.kescoode.*
+com.kestreldigital.conjuror.*
+com.kestreldigital.json-schema-simplifier.*
+com.kevingann.*
+com.kevinten.*
+com.keyark.*
+com.keyboardsamurais.maven.*
+com.keyholesoftware.*
+com.keypoint.*
+com.keyri.*
+com.keysolutions.*
+com.kf5.*
+com.kfaraj.support.*
+com.kflorence.*
+com.kgcorner.*
+com.kgit2.*
+com.kgurgul.flipper.*
+com.khalti.*
+com.khimung.*
+com.khipu.*
+com.khjxiaogu.*
+com.khubla.antlr.*
+com.khubla.antlr4formatter.*
+com.khubla.cbean.*
+com.khubla.com.pragmatach.examples.*
+com.khubla.dot4j.*
+com.khubla.elk4j.*
+com.khubla.gml4j.*
+com.khubla.gxl4j.*
+com.khubla.hsclient.*
+com.khubla.hsinflux.*
+com.khubla.hsmqqt.*
+com.khubla.hsmqtt.*
+com.khubla.kgraphml.*
+com.khubla.kpascal.*
+com.khubla.krepl.*
+com.khubla.kriff.*
+com.khubla.ktelnet.*
+com.khubla.olmreader.*
+com.khubla.pdxreader.*
+com.khubla.pragmatach.*
+com.kiblerdude.*
+com.kibocommerce.*
+com.kichik.pecoff4j.*
+com.kickstarter.*
+com.kickstarter.dropwizard.*
+com.kifi.*
+com.kifile.*
+com.kifile.android.cornerstone.*
+com.kifile.android.utils.*
+com.kifile.android.widget.*
+com.kiiadi.ktfriendly.*
+com.kiilin.*
+com.kik.*
+com.kik.config.*
+com.kilnhg.tim-sparg.*
+com.kilumanga.play.*
+com.kinbiko.*
+com.kinde.*
+com.king.*
+com.king.bravo.*
+com.king.king-http-client.*
+com.king.tratt.*
+com.kingofnerds.*
+com.kingsleyadio.deeplink.*
+com.kingsoft.services.table.*
+com.kinja.*
+com.kinnarastudio.*
+com.kinnerapriyap.*
+com.kinoroy.expo.push.*
+com.kinotic.*
+com.kintone.*
+com.kipodopik.*
+com.kirekov.*
+com.kirgor.enklib.*
+com.kirkk.*
+com.kitfox.svg.*
+com.kiuwan.*
+com.kiwi.navigation-compose.typed.*
+com.kiwigrid.*
+com.kiwigrid.maven.enforce.*
+com.kiwrious.sdk.android.*
+com.kizitonwose.calendar.*
+com.kjetland.*
+com.kjetland.akka-http-tools.*
+com.kjetland.dropwizard.*
+com.kjzero.*
+com.kkmcn.kbeaconlib.*
+com.kkmcn.kbeaconlib2.*
+com.klangoo.*
+com.klarna.*
+com.klarna.ondemand.*
+com.klaytn.caver.*
+com.klemm-scs.util.*
+com.klibisz.*
+com.klibisz.elastiknn.*
+com.klibisz.futil.*
+com.klinec.*
+com.klinkerapps.*
+com.kliuchkovskii.*
+com.kllso.*
+com.kloenlansfiel.*
+com.kloenlansfiel.jiconfont.*
+com.kloudless.*
+com.kloudtek.*
+com.kloudtek.anypoint-tools.*
+com.kloudtek.devmagic.*
+com.kloudtek.elogging.*
+com.kloudtek.enterprisecloudconfig.*
+com.kloudtek.enterprisecloudconfig.server.*
+com.kloudtek.genesis.*
+com.kloudtek.genesis.mule.*
+com.kloudtek.idvkey.*
+com.kloudtek.idvkey.sdk.*
+com.kloudtek.kryptotek.*
+com.kloudtek.ktcli.*
+com.kloudtek.ktserializer.*
+com.kloudtek.ktspring.*
+com.kloudtek.ktutils.*
+com.kloudtek.mule-elogging.*
+com.kloudtek.mule.*
+com.kloudtek.mule.elogging.*
+com.kloudtek.slf4j.*
+com.kloudtek.unpack.*
+com.klout.*
+com.kmecpp.*
+com.knappsack.*
+com.kncept.*
+com.kncept.abacemtex.*
+com.kncept.httprouter.*
+com.kncept.httpserver.*
+com.kncept.junit.reporter.*
+com.kncept.junit5.dataprovider.*
+com.kncept.junit5.reporter.*
+com.kncept.ksuid.*
+com.kncept.sp.*
+com.knewton.dynamok.*
+com.knewton.mapreduce.*
+com.knightlia.yuna.*
+com.knitelius.*
+com.knockdata.*
+com.knoema.*
+com.knotapi.cardonfileswitcher.*
+com.knowably.*
+com.knowgate.*
+com.knuddels.*
+com.ko-sys.av.*
+com.kobakei.*
+com.kochava.base.*
+com.kochava.consent.*
+com.kochava.core.*
+com.kochava.entitlements.*
+com.kochava.tracker.*
+com.kodcu.*
+com.koddi.*
+com.kodeblox.*
+com.kodnito.*
+com.kodroid.*
+com.koekiebox.*
+com.koenv.*
+com.kohlschutter.*
+com.kohlschutter.junixsocket.*
+com.kohlschutter.mavenplugins.*
+com.koivusolutions.vfc.*
+com.kolemannix.*
+com.kolibrifx.common.*
+com.kolibrifx.lancebill.*
+com.kolibrifx.mq.*
+com.kolibrifx.napo.*
+com.kolibrifx.plovercrest.*
+com.koloboke.*
+com.komputation.*
+com.konaire.numeric-keyboard.*
+com.konduto.sdk.*
+com.konfigthis.*
+com.konfigthis.dojah.*
+com.konfigthis.leap.*
+com.konfigthis.newscatcherapi.*
+com.konfigthis.nuitee.*
+com.konghq.*
+com.kongzue.baseframework.*
+com.kongzue.dialogx.*
+com.kongzue.dialogx.style.*
+com.kongzue.stacklabel.*
+com.konloch.*
+com.konmik.rxstate.*
+com.konnectkode.*
+com.konotor.*
+com.kony.appfactory.ws.*
+com.kony.dbp.*
+com.kony.middleware.*
+com.konyaco.*
+com.koonny.wheelview.*
+com.koralix.security.*
+com.koralix.stepfn.*
+com.kordar.*
+com.koriit.kotlin.*
+com.korwe.*
+com.kosherjava.*
+com.kosprov.jargon2.*
+com.kostasdrakonakis.*
+com.kotcrab.annotation.*
+com.kotcrab.kmips.*
+com.kotcrab.nyx.*
+com.kotcrab.remark.*
+com.kotcrab.vis.*
+com.kotcrab.vne.*
+com.koterpillar.*
+com.kotlindiscord.kord.extensions.*
+com.kotlinizer.*
+com.kotlinnlp.*
+com.kotlinx.*
+com.kotliny.network.*
+com.kotmol.kotmolpdbparser.*
+com.kotmol.testlib.*
+com.kotoframework.*
+com.koubei.cavalry.*
+com.kount.*
+com.koushikdutta.androidasync.*
+com.koushikdutta.async.*
+com.koushikdutta.ion.*
+com.koushikdutta.urlimageviewhelper.*
+com.kovacivan.*
+com.koverse.*
+com.kovizone.*
+com.kpelykh.*
+com.kpi4j.*
+com.kpouer.*
+com.kraftful.analytics.kotlin.*
+com.kraftics.*
+com.kramer425.*
+com.kreait.slack.*
+com.kreattiewe.*
+com.kreattiewe.akka.*
+com.kremote-files.*
+com.krestfield.ezsign.*
+com.kroegerama.*
+com.kroegerama.android-kaiteki.*
+com.kroegerama.kgen.*
+com.kroegerama.magic-catalogs.*
+com.kroegerama.openapi-kgen.*
+com.kroger.*
+com.kroger.cache.*
+com.kroger.oss.*
+com.kroger.oss.snowGlobe.*
+com.kroger.telemetry.*
+com.krrrr38.*
+com.krux.*
+com.kryptokrauts.*
+com.kryshchuk.*
+com.kryshchuk.imcollector.*
+com.kryshchuk.maven.plugins.*
+com.kryshchuk.mirror.be.objectify.*
+com.kryshchuk.mirror.com.feth.*
+com.ksc.mission.base.*
+com.kshitijpatil.lazydagger.*
+com.ksidelta.library.*
+com.ksmpartners.*
+com.kstruct.*
+com.ksust.qq.*
+com.ksyun.*
+com.ksyun.kmr.*
+com.ktanx.*
+com.kttdevelopment.*
+com.kuaihuoyun.ctms.*
+com.kuaihuoyun.server.*
+com.kuaishou.*
+com.kuaishou.koom.*
+com.kuangkie.*
+com.kuassivi.annotation.*
+com.kuassivi.compiler.*
+com.kuassivi.october.*
+com.kuassivi.view.*
+com.kubedb.*
+com.kubukoz.*
+com.kubukoz.playground.*
+com.kubuszok.*
+com.kucoin.*
+com.kucoin.futures.*
+com.kuda.library.*
+com.kuflow.*
+com.kuflow.engine.client.*
+com.kuflow.rest.client.*
+com.kuhnza.*
+com.kuisama.*
+com.kuisama.zxing.*
+com.kujtimhoxha.plugins.*
+com.kukababy.*
+com.kulfyapp.sdk.*
+com.kumulos.android.*
+com.kumuluz.ee.*
+com.kumuluz.ee.amqp.*
+com.kumuluz.ee.config.*
+com.kumuluz.ee.cors.*
+com.kumuluz.ee.database-schema-migrations.*
+com.kumuluz.ee.discovery.*
+com.kumuluz.ee.fault.tolerance.*
+com.kumuluz.ee.graphql.*
+com.kumuluz.ee.grpc.*
+com.kumuluz.ee.health.*
+com.kumuluz.ee.jcache.*
+com.kumuluz.ee.jwt.*
+com.kumuluz.ee.logs.*
+com.kumuluz.ee.metrics.*
+com.kumuluz.ee.openapi.*
+com.kumuluz.ee.opentracing.*
+com.kumuluz.ee.rest-client.*
+com.kumuluz.ee.rest.*
+com.kumuluz.ee.security.*
+com.kumuluz.ee.streaming.*
+com.kumuluz.ee.swagger.*
+com.kumuluz.ee.testing.*
+com.kumuluz.ee.version.*
+com.kunbao.weixin.*
+com.kunminx.arch.*
+com.kunminx.linkage.*
+com.kunminx.player.*
+com.kunminx.unpeeklivedata.*
+com.kunstmusik.*
+com.kupal.*
+com.kupal.ahk4j.*
+com.kupal.commons.*
+com.kuparty.webflux.*
+com.kurento.*
+com.kurento.kmf.*
+com.kurento.kms.*
+com.kurento.kws.*
+com.kursaha.*
+com.kurzdigital.*
+com.kushkipagos.*
+com.kustomer.chat.*
+com.kvaithin.*
+com.kvc0.*
+com.kwebble.*
+com.kwince.*
+com.kwince.contribs.*
+com.kxindot.*
+com.kxjf.talos.*
+com.kyleduo.switchbutton.*
+com.kyleu.*
+com.kylewm.*
+com.kylins.libs.*
+com.kynetics.*
+com.l2fprod.common.*
+com.laamella.*
+com.laamella.properteer.*
+com.lab-440.*
+com.label305.kama-for-android.*
+com.label305.stan.*
+com.labetu.*
+com.labijie.*
+com.labijie.application.*
+com.labijie.bom.*
+com.labijie.infra.*
+com.labijie.orm.*
+com.labs2160.*
+com.labs64.commons.*
+com.labs64.mojo.*
+com.labs64.netlicensing.*
+com.labs64.utils.*
+com.labstack.*
+com.labun.*
+com.labun.buildnumber.*
+com.labymedia.*
+com.lacorepayments.processing.client.*
+com.lacunasoftware.amplia.*
+com.lacunasoftware.cloudhub.*
+com.lacunasoftware.pkiexpress.*
+com.lacunasoftware.restpki.*
+com.lacunasoftware.signer.*
+com.lafouche.*
+com.lahsivjar.*
+com.laimiux.*
+com.laimiux.lce.*
+com.laimiux.rxactivity.*
+com.laimiux.rxnetwork.*
+com.laimiux.rxtube.*
+com.laiwanzhou.eie.*
+com.laiye.wulai.javasdk.*
+com.lalafo.conductor.*
+com.lamatek.*
+com.lambdaminute.*
+com.lambdapioneer.argon2kt.*
+com.lambdaworks.*
+com.lambdazen.bitsy.*
+com.lambdazen.htmlsplicer.*
+com.lambdazen.pixy.*
+com.lambdazen.websocket.*
+com.lambdista.*
+com.lambeta.*
+com.lambkit.*
+com.lamdaer.*
+com.lamergameryt.*
+com.lancethomps.*
+com.landasource.*
+com.landawn.*
+com.landoop.*
+com.langdashu.*
+com.languagelatte.*
+com.languageweaver.sdk.*
+com.laohand.*
+com.lapanthere.*
+com.lapis.jsfexporter.*
+com.laputapp.*
+com.larksuite.appframework.*
+com.larksuite.oapi.*
+com.larroy.milight.*
+com.larroy.openquant.*
+com.larrymite.*
+com.larrymyers.*
+com.larseckart.*
+com.larsreimann.*
+com.larsreimann.safe-ds.*
+com.larswerkman.*
+com.laserfiche.*
+com.lasmanis.*
+com.lasmanis.maven.*
+com.lasmanis.maven.composites.*
+com.lasmanis.maven.tiles.*
+com.lassitercg.*
+com.lastB7.*
+com.lastwall.authenticator.*
+com.latch.*
+com.latentview.koalas.*
+com.lateral-thoughts.*
+com.lateral-thoughts.stub.*
+com.latitech.android.*
+com.lattica.oss.*
+com.launchableinc.*
+com.launchdarkly.*
+com.launchkey.pom.*
+com.launchkey.sdk.*
+com.lauvinson.source.open.*
+com.layer-net.*
+com.layer.*
+com.laylib.*
+com.laysonx.*
+com.lazerycode.appium.*
+com.lazerycode.jmeter.*
+com.lazerycode.selenium.*
+com.lazinessdevs.*
+com.laztdev.module.*
+com.lazycece.au.*
+com.lazycece.ddla.*
+com.lazycece.rapidf.*
+com.lazydsr.*
+com.lazydsr.commons.*
+com.lazygeniouz.*
+com.lazygeniouz.methlog.*
+com.lazythought.*
+com.lbayer.*
+com.lbyiot.*
+com.lcristalli.*
+com.ldclrcq.*
+com.ldhdev.*
+com.leacox.dagger.*
+com.leacox.dagger.example.*
+com.leacox.motif.*
+com.leacox.process.*
+com.leadiq.*
+com.leaguekit.*
+com.leakyabstractions.*
+com.leandronunes85.jax-rs.*
+com.leandronunes85.lfe.*
+com.leanplum.*
+com.leanplum.segment.*
+com.leaprnd.deltadom.*
+com.leaprnd.migrannotate.*
+com.learningobjects.*
+com.leazxl.*
+com.lectra.*
+com.ledgefarm.core.*
+com.leegality.sdk.*
+com.leeguoo.*
+com.leftins.*
+com.legalimpurity.expandablerecyclerview.*
+com.legalshield.*
+com.legiti.*
+com.legsem.legstar.*
+com.legyver.*
+com.lehaine.littlekt.*
+com.lehaine.littlekt.gradle.*
+com.lehaine.littlekt.gradle.texturepacker.*
+com.lei2j.*
+com.leigh-plumley.*
+com.leinardi.android.*
+com.lemmingapex.trilateration.*
+com.lemonappdev.*
+com.lemondronor.*
+com.lemoulinstudio.jnag.*
+com.lendistry.*
+com.lendup.fs2-blobstore.*
+com.lenguyenthanh.nimble.*
+com.lenzhao.*
+com.leobenkel.*
+com.leonarduk.*
+com.leondesilva.jcor.*
+com.leondesilva.persistentcache.*
+com.leonds.*
+com.lephix.*
+com.lerna-stack.*
+com.lesfurets.*
+com.leshana.*
+com.leshazlewood.scms.*
+com.leshazlewood.spin.*
+com.lesstif.*
+com.lessvoid.*
+com.lethanh98.*
+com.lethanh98.java.*
+com.lethanh98.performance.*
+com.letscooee.*
+com.letsdoapps.depsio.maven.*
+com.letters7.wuchen.*
+com.letxgo.*
+com.levelmoney.observefragment.*
+com.levelmoney.velodrome.*
+com.levelrin.*
+com.levelupstudio.*
+com.levigo.*
+com.levigo.barcode.*
+com.levigo.jbig2.*
+com.levonk.*
+com.levonk.codequality.*
+com.lewisd.*
+com.lewisjkl.*
+com.lewuathe.*
+com.lexalytics.semantria.*
+com.lexicalscope.contest.*
+com.lexicalscope.eventcast.*
+com.lexicalscope.fluent-collections.*
+com.lexicalscope.fluent-reflection.*
+com.lexicalscope.hamcrest.*
+com.lexicalscope.jewelcli.*
+com.lexicalscope.junit.*
+com.lexisnexis.uniqueid.*
+com.lexmark.gridlock.*
+com.leyongzuche.*
+com.leyunone.*
+com.lframework.*
+com.lge.developer.*
+com.lgou2w.*
+com.lhings.java.*
+com.lhkbob.entreri.*
+com.liaison.*
+com.liangwj.*
+com.lianquna.*
+com.lib16.*
+com.libawall.*
+com.liberorignanese.android.*
+com.libertyglobal.common.maven.*
+com.liberxue.*
+com.libfintech.*
+com.librato.*
+com.librato.disco.*
+com.librato.metrics.*
+com.librato.rollout.*
+com.librato.watchconf.*
+com.librecoder.*
+com.libutil.*
+com.licel.*
+com.licheedev.*
+com.lichongbing.*
+com.lidengju.*
+com.liepin.*
+com.lieuu.*
+com.lifengdi.*
+com.lifeofcoding.*
+com.lifeomic.*
+com.lifeonwalden.*
+com.liferay.*
+com.liferay.alloy-taglibs.*
+com.liferay.arquillian.*
+com.liferay.blade.*
+com.liferay.cdi.*
+com.liferay.commerce.*
+com.liferay.content-targeting.*
+com.liferay.etl.*
+com.liferay.faces.*
+com.liferay.faces.archetype.*
+com.liferay.faces.demo.*
+com.liferay.faces.demos.*
+com.liferay.faces.patches.*
+com.liferay.faces.support.*
+com.liferay.faces.test.*
+com.liferay.maven.*
+com.liferay.maven.archetypes.*
+com.liferay.maven.plugins.*
+com.liferay.mobile.*
+com.liferay.neo4j.*
+com.liferay.org.apache.commons.fileupload.*
+com.liferay.plugins.*
+com.liferay.portal.*
+com.liferay.portletmvc4spring.*
+com.liferay.portletmvc4spring.archetype.*
+com.liferay.portletmvc4spring.demo.*
+com.liferay.poshi.runner.resources.*
+com.liferay.view.state.*
+com.liferay.webjars.*
+com.liferay.workspace.*
+com.lifeway.*
+com.lifeway.aws.*
+com.liffft.*
+com.liftric.*
+com.liftyad.*
+com.lightbend.*
+com.lightbend.akka.*
+com.lightbend.akka.discovery.*
+com.lightbend.akka.grpc.*
+com.lightbend.akka.management.*
+com.lightbend.cloudflow.*
+com.lightbend.constructr.*
+com.lightbend.lagom.*
+com.lightbend.microprofile.reactive.streams.*
+com.lightbend.paradox.*
+com.lightbend.play.*
+com.lightbend.rp.*
+com.lightform.*
+com.lightningkite.*
+com.lightningkite.androidlayouttranslator.*
+com.lightningkite.butterfly.*
+com.lightningkite.khrysalis.*
+com.lightningkite.ktor-batteries.*
+com.lightningkite.ktorbatteries.*
+com.lightningkite.ktorkmongo.*
+com.lightningkite.lightningserver.*
+com.lightningkite.rx.*
+com.lightningkite.xmltoxib.*
+com.lightrail.*
+com.lightspark.*
+com.lightstep.opencensus.*
+com.lightstep.opentelemetry.*
+com.lightstep.tracer.*
+com.lightstreamer.*
+com.lightszentip.module.*
+com.liguanqiao.*
+com.lihansir.platform.*
+com.lihaoyi.*
+com.lihaoyi.acyclic.*
+com.lihaoyi.utest.*
+com.lihongkun.*
+com.lijianhy.groovy.*
+com.lijinchao.*
+com.likeligood.*
+com.likeness.*
+com.likeness.components.*
+com.likeness.mojo.*
+com.likethecolor.*
+com.likethesalad.android.*
+com.likethesalad.dagger.*
+com.likethesalad.tools.*
+com.likethesalad.tools.resources.*
+com.likethesalad.tools.testing.*
+com.lilbaek.recordbuilder.*
+com.lilittlecat.*
+com.limemojito.oss.aws.*
+com.limemojito.oss.spring-boot.*
+com.limemojito.oss.spring-boot.development-test.*
+com.limemojito.oss.standards.*
+com.limemojito.oss.test.*
+com.limemojito.oss.trading.trading-data-stream.*
+com.limitra.sdk.*
+com.limyel.*
+com.linagora.*
+com.linbit.linstor.api.*
+com.linchtech.*
+com.lindar.*
+com.lindzh.*
+com.linecorp.*
+com.linecorp.abc.*
+com.linecorp.adsnetwork.*
+com.linecorp.armeria.*
+com.linecorp.bot.*
+com.linecorp.centraldogma.*
+com.linecorp.clova.*
+com.linecorp.conditional.*
+com.linecorp.decaton.*
+com.linecorp.kotlin-jdsl.*
+com.linecorp.lbd.*
+com.linecorp.lich.*
+com.linecorp.linesdk.*
+com.ling5821.*
+com.lingcreative.*
+com.lingd600.*
+com.lingdonge.*
+com.lingfengerick.commons.*
+com.lingmoyun.*
+com.lingocoder.*
+com.lingyun-x.*
+com.link-intersystems.*
+com.link-intersystems.commons.*
+com.link-intersystems.dbunit.*
+com.link-intersystems.dbunit.maven.*
+com.link-intersystems.dbunit.migration.*
+com.link-intersystems.dbunit.testcontainers.*
+com.link-intersystems.maven.plugins.*
+com.link-time.ktor.*
+com.link-time.maven.plugin.atlassian.*
+com.link184.*
+com.linkall.*
+com.linkall.cdk.*
+com.linkare.*
+com.linked-planet.*
+com.linked-planet.client.*
+com.linked-planet.maven.*
+com.linked-planet.ui.*
+com.linkedin.*
+com.linkedin.agentloader.*
+com.linkedin.android.litr.*
+com.linkedin.android.spyglass.*
+com.linkedin.azkaban.*
+com.linkedin.bobo.*
+com.linkedin.calcite.*
+com.linkedin.coral.*
+com.linkedin.cytodynamics.*
+com.linkedin.dagli.*
+com.linkedin.datafu.*
+com.linkedin.dexmaker.*
+com.linkedin.dextestparser.*
+com.linkedin.dualip.*
+com.linkedin.feathr.*
+com.linkedin.gobblin.*
+com.linkedin.iceberg.*
+com.linkedin.isolation-forest.*
+com.linkedin.kamikaze.*
+com.linkedin.li-deequ.*
+com.linkedin.lift.*
+com.linkedin.migz.*
+com.linkedin.paldb.*
+com.linkedin.parseq.*
+com.linkedin.pegasus.*
+com.linkedin.play-parseq.*
+com.linkedin.play-restli.*
+com.linkedin.sbt-restli.*
+com.linkedin.sensei.*
+com.linkedin.shaky.*
+com.linkedin.sparktfrecord.*
+com.linkedin.testbutler.*
+com.linkedin.tony.*
+com.linkedin.transport.*
+com.linkedin.transport.plugin.*
+com.linkedin.urls.*
+com.linkedin.zoie.*
+com.linkinstars.*
+com.linkmobility.events.*
+com.linroid.filtermenu.*
+com.linshuaishuai.*
+com.linuxense.*
+com.lionbridge.content.sdk.*
+com.lionbridge.ondemand.*
+com.lionscribe.open.libphonenumber.*
+com.lipaluma.*
+com.lipcha.*
+com.lipisha.sdk.*
+com.listeningframework.boot.*
+com.listennotes.*
+com.literatejava.*
+com.lithic.api.*
+com.lithium.*
+com.lithium.dbi.rdbi.*
+com.lithium.flow.*
+com.lithium.luces.*
+com.lithium.mineraloil.*
+com.lithium.multiverse-test.*
+com.litl.*
+com.litongjava.*
+com.littcore.*
+com.little-fluffy-clouds.*
+com.littlenb.*
+com.liucf.*
+com.liuguangqiang.cookie.*
+com.liuguangqiang.depot.*
+com.liuguangqiang.ipicker.*
+com.liuguangqiang.ripplelayout.*
+com.liuguangqiang.support.*
+com.liuguangqiang.twosidedlayout.*
+com.liukaizhen.*
+com.liulimi.*
+com.liulimi.fastboot.*
+com.liulishuo.filedownloader.*
+com.liulishuo.magicprogresswidget.*
+com.liulishuo.okcheck.*
+com.liulishuo.okdownload.*
+com.liulishuo.percentsmoothhandler.*
+com.liulishuo.qiniuimageloader.*
+com.liumapp.*
+com.liumapp.ali.*
+com.liumapp.ca.*
+com.liumapp.ca.tw.*
+com.liumapp.certificate.*
+com.liumapp.convert.cell.*
+com.liumapp.convert.doc.*
+com.liumapp.convert.html.*
+com.liumapp.convert.html.fromdoc.*
+com.liumapp.convert.img.*
+com.liumapp.datapay.*
+com.liumapp.datapay.bankcard.*
+com.liumapp.datapay.face.*
+com.liumapp.datapay.government.*
+com.liumapp.datapay.ocr.*
+com.liumapp.datapay.ocr.bankcard.*
+com.liumapp.datapay.phone.*
+com.liumapp.datapay.realname.*
+com.liumapp.jks.core.*
+com.liumapp.keystore.*
+com.liumapp.keywordsign.*
+com.liumapp.keywordsign.core.*
+com.liumapp.keywordsign.starter.*
+com.liumapp.notarial.*
+com.liumapp.operator.baidu.ocr.*
+com.liumapp.pattern.*
+com.liumapp.qtools.*
+com.liumapp.qtools.all.*
+com.liumapp.qtools.collection.*
+com.liumapp.qtools.core.*
+com.liumapp.qtools.date.*
+com.liumapp.qtools.file.*
+com.liumapp.qtools.http.*
+com.liumapp.qtools.pic.*
+com.liumapp.qtools.property.*
+com.liumapp.qtools.security.*
+com.liumapp.qtools.security.encrypt.*
+com.liumapp.qtools.starter.*
+com.liumapp.qtools.starter.springboot.*
+com.liumapp.qtools.str.*
+com.liumapp.rabbitmq.*
+com.liumapp.redis.*
+com.liumapp.signature.*
+com.liumapp.simple.convert.*
+com.liumapp.sms.*
+com.liumapp.ukey.*
+com.liumapp.ukey.core.*
+com.liumapp.ukey.starter.*
+com.liumapp.workable.converter.*
+com.liumapp.ysk.*
+com.liumapp.ysk.core.*
+com.liumapp.ysk.starter.*
+com.liuvei.common.*
+com.liuvei.pom.*
+com.liuvei.third.*
+com.liuyanzhao.*
+com.livae.*
+com.livefyre.*
+com.livejournal.*
+com.liveperson.*
+com.liveperson.android.*
+com.liveperson.api.*
+com.liveperson.archetypes.*
+com.liveperson.ephemerals.*
+com.liveperson.faas.*
+com.liveramp.*
+com.liveramp.generative.*
+com.liveramp.workflow2.*
+com.liveshopper.sdk.*
+com.livestorehub.shas.*
+com.livestream.*
+com.livetheoogway.commons.*
+com.livetheoogway.crudstore.*
+com.livetheoogway.forage.*
+com.livetheoogway.teflon.*
+com.livetyping.*
+com.livingobjects.*
+com.livingobjects.fluenthttp.*
+com.livingobjects.myrddin.*
+com.livingobjects.neo4j.*
+com.livingobjects.wisdom.*
+com.liwenwei.pinyintextview.*
+com.lixar.lwayve.*
+com.liyaos.*
+com.liyuan3210.*
+com.liyutech.*
+com.lizhifm.sdk.live.*
+com.lizhifm.sdk.live.base.*
+com.lizhifm.sdk.live.comment.*
+com.lizhifm.sdk.live.engine.*
+com.lizhifm.sdk.live.flow.*
+com.lizhifm.sdk.live.prop.*
+com.lizhifm.sdk.live.room.*
+com.lizhifm.sdk.live.yoga.*
+com.lizhifm.sdk.lzauthorize.*
+com.lizhifm.sdk.lzcobub.*
+com.lizhifm.sdk.lzdbliteorm.*
+com.lizhifm.sdk.lzdeviceidentification.*
+com.lizhifm.sdk.lzdownload.*
+com.lizhifm.sdk.lzfirework.*
+com.lizhifm.sdk.lzglide.*
+com.lizhifm.sdk.lzitnet.*
+com.lizhifm.sdk.lzitnet.pbhelper.*
+com.lizhifm.sdk.lzitnet.token.*
+com.lizhifm.sdk.lzlmmap.*
+com.lizhifm.sdk.lzlogan.*
+com.lizhifm.sdk.lznetworkmanage.*
+com.lizhifm.sdk.lznetworkmanager.*
+com.lizhifm.sdk.lzpermission.*
+com.lizhifm.sdk.lzplatformtools.*
+com.lizhifm.sdk.lzrds.*
+com.lizhifm.sdk.lzrtmp.*
+com.lizhifm.sdk.lzsvga.*
+com.lizhifm.sdk.lztencent.x5.*
+com.ljhgo.*
+com.lkeehl.*
+com.lkroll.*
+com.llqqww.*
+com.llsfw.*
+com.lmax.*
+com.lmaye.*
+com.lmco.shindig.*
+com.lnngle.hstone.*
+com.lnold.*
+com.lnx10.*
+com.loadcoder.*
+com.loadimpact.*
+com.lob.*
+com.locadz.*
+com.localebro.*
+com.localhost22.*
+com.locurasoft.*
+com.lodborg.*
+com.lodgon.dalicore.*
+com.lodsve.*
+com.lodsve.boot.*
+com.loeyae.component.*
+com.loftechs.sdk.*
+com.log1992.*
+com.logaritex.data.*
+com.logdyn.*
+com.logentries.*
+com.logfaces.*
+com.logicalsapien.dataformat.*
+com.logicartisan.*
+com.logicartisan.intrepid.*
+com.logicbig.*
+com.logicbig.cli.*
+com.logiclander.jaasmine.*
+com.logicmonitor.*
+com.logicommerce.*
+com.logicovercode.*
+com.logikaldb.*
+com.logimethods.*
+com.loginradius.android.*
+com.loginradius.androidsdk.*
+com.loginradius.sdk.*
+com.logitags.*
+com.logmein.*
+com.logonlabs.*
+com.logscale.*
+com.logsense.*
+com.logsentinel.*
+com.logsentinel.sentineldb.*
+com.logstruck.*
+com.logtail.*
+com.logunify.*
+com.lohika.alp.*
+com.lokalized.*
+com.lokiy.*
+com.lokiy.core.*
+com.lokiy.databinding.*
+com.lokiy.support.*
+com.lomagicode.spring.boot.*
+com.lonacloud.*
+com.londogard.*
+com.lonelylang.data.*
+com.lonelystorm.air.*
+com.lonepulse.*
+com.longmaosoft.sdk.*
+com.longpengz.*
+com.loocme.*
+com.loongwind.ardf.*
+com.loopeer.*
+com.loopeer.android.*
+com.loopeer.android.apps.bootstrap.*
+com.loopeer.android.reader.*
+com.loopeer.android.thirdparty.*
+com.loopeer.android.thirdparty.pulltorefresh.*
+com.loopfor.scalop.*
+com.loopfor.zookeeper.*
+com.loopj.android.*
+com.lopezezequiel.*
+com.lorandszakacs.*
+com.lordcodes.turtle.*
+com.lordofthejars.*
+com.lordofthejars.diferencia.*
+com.lordofthejars.thymeleafarchetype.*
+com.lorentzos.*
+com.lorentzos.pj.*
+com.lorentzos.rxservices.*
+com.lorentzos.swipecards.*
+com.lostjs.*
+com.lostsidewalk.newsgears.*
+com.lotame.*
+com.lotaris.api.*
+com.lotaris.jee.*
+com.lotaris.junit.*
+com.lotaris.junitee.*
+com.lotaris.maven.plugins.*
+com.lotaris.maven.rox.plugins.*
+com.lotaris.minirox.client.*
+com.lotaris.rox.client.*
+com.lotaris.test.frameworks.*
+com.loudsight.*
+com.loudsight.test.*
+com.loudsight.utilities.*
+com.louis993546.*
+com.louiscad.incubator.*
+com.louiscad.splitties.*
+com.louislivi.fastdep.*
+com.louwrenstechnologies.*
+com.lovelycatv.ark.*
+com.lovenull.*
+com.lovinjoy.*
+com.lowagie.*
+com.lowdad.*
+com.lowdad.thrift.*
+com.lowentry.*
+com.lowentry.ue4.*
+com.loyagram.android.*
+com.loyalsound.*
+com.loyayz.*
+com.loyayz.gaia.*
+com.lqiong.*
+com.lsjwzh.*
+com.lsnju.*
+com.lsqboy.common-adapter.*
+com.lt-peacock.*
+com.ltonetwork.*
+com.luamas.*
+com.luamas.easypoi.*
+com.luamas.kaptcha.*
+com.lucadev.*
+com.lucadev.trampoline.*
+com.lucfish.*
+com.lucfish.openapi.*
+com.lucidchart.*
+com.lucidworks.*
+com.lucidworks.spark.*
+com.lucidworks.zeppelin.*
+com.luciocossio.*
+com.luciocossio.android.*
+com.luckycatlabs.*
+com.luckypeng.mock.*
+com.luckypines.*
+com.lucrumdmp.*
+com.lugeek.*
+com.lugew.winsim.*
+com.luhonghai.*
+com.luhuiguo.*
+com.luhuiguo.archetype.*
+com.luhuiguo.archetypes.*
+com.luhuiguo.bouncycastle.*
+com.luhuiguo.fabric-sdk-java.*
+com.luhuiguo.fasttext.*
+com.luhuiguo.grpc.*
+com.luhuiguo.hyperledger.fabric-sdk-java.*
+com.luhuiguo.netty.*
+com.luhuiguo.speech.*
+com.luigiagosti.*
+com.luigivampa92.*
+com.luisonthekeyboard.*
+com.luissoares.*
+com.luixtech.*
+com.lujiatao.*
+com.lukario45.*
+com.lukaspradel.*
+com.lukegb.mojo.*
+com.lukekorth.*
+com.lukeshay.proto.*
+com.luketebbs.uniform.*
+com.lumaserv.*
+com.lumiastream.*
+com.luminiasoft.ethereum.*
+com.luminiasoft.ethereum.blockiesandroid.*
+com.lumiomedical.*
+com.lunaryorn.*
+com.lunatech.*
+com.lunatech.jax-doclets.*
+com.luoaijun.*
+com.luoaijun.mcp.*
+com.luoluocode.*
+com.luoxudong.base.*
+com.luszczuk.makebillingeasy.*
+com.luszczuk.makeeventseasy.*
+com.lutzseverino.discordbooks.*
+com.luuuis.*
+com.luxiliu.*
+com.luxoft.mybatis.*
+com.luxsuen.*
+com.luzi82.hakase.*
+com.luzi82.nagatoquery.*
+com.lvack.*
+com.lvliangjun.*
+com.lvonce.*
+com.lwink.*
+com.lwjlol.initializer.*
+com.lwjlol.privacyhook.*
+com.lwkandroid.library.*
+com.lwohvye.*
+com.lwohvye.captcha.*
+com.lwohvye.log4jdbc-log4j2.*
+com.lxgnb.*
+com.lxzh123.*
+com.lyders.*
+com.lyft.*
+com.lyft.kronos.*
+com.lykke.hft.*
+com.lyloou.*
+com.lympid.*
+com.lyncode.*
+com.lyncode.builder.*
+com.lyncode.xml.*
+com.lynden.*
+com.lyonesgamer.*
+com.lyra.*
+com.lyrieek.*
+com.lyrieek.i18n.*
+com.lzhpo.*
+com.lzhpo.cache.*
+com.lzhpo.nacos.*
+com.lzmcro.*
+com.m-creations.*
+com.m-creations.isis.*
+com.m-creations.renderer.*
+com.m-creations.symmetricds.*
+com.m14n.*
+com.m14n.billib.*
+com.m3.*
+com.m31skytech.*
+com.m3958.*
+com.m3958.apps.*
+com.m3958.vertxio.*
+com.m3958.vertxprj.*
+com.macasaet.auth.*
+com.macasaet.fernet.*
+com.macasaet.google.conversation.*
+com.macasaet.lambda.*
+com.macdservices.*
+com.maceve.*
+com.machbase.*
+com.machbase.ycsb.*
+com.machbird.*
+com.machinepublishers.*
+com.machinezoo.closeablescope.*
+com.machinezoo.fingerprintio.*
+com.machinezoo.hookless.*
+com.machinezoo.noexception.*
+com.machinezoo.pmdata.*
+com.machinezoo.pmsite.*
+com.machinezoo.pushmode.*
+com.machinezoo.sourceafis.*
+com.machinezoo.stagean.*
+com.maciejwalkowiak.*
+com.maciejwalkowiak.just.*
+com.maciejwalkowiak.paseq.*
+com.maciejwalkowiak.spring.*
+com.macrodatalab.*
+com.madamiak.*
+com.madavan.*
+com.madconch.running.*
+com.madden-abbott.*
+com.madebyatomicrobot.*
+com.madebydev.kraft.*
+com.madeorsk.*
+com.madewithtea.*
+com.madgag.*
+com.madgag.play-git-hub.*
+com.madgag.scala-git.*
+com.madgag.spongycastle.*
+com.madhukaraphatak.*
+com.madisp.pretty.*
+com.madisp.stupid.*
+com.madrobot.*
+com.mads.adview.*
+com.madsync.*
+com.madyoda.*
+com.madzera.happytree.*
+com.maestrano.*
+com.mafgwo.common.distributed-lock.*
+com.mageddo.*
+com.mageddo.aptools.*
+com.mageddo.commons-jdbc.*
+com.mageddo.commons.*
+com.mageddo.csv2jdbc.*
+com.mageddo.javaee-jdbi.*
+com.mageddo.jvmattach.*
+com.mageddo.kafka-client.*
+com.mageddo.kafka.*
+com.mageddo.lombok.*
+com.mageddo.micronaut-kafka.*
+com.mageddo.nativeimage.*
+com.mageddo.portainer.*
+com.mageddo.ramspider.*
+com.mageddo.rapids-kafka-client.*
+com.mageddo.tinyserver.*
+com.mageddo.tobby-transactional-outbox.*
+com.mageddo.togglefirst.*
+com.magenic.jmaqs.*
+com.magenic.jmaqs.appium.*
+com.magenic.jmaqs.archetypes.*
+com.magenic.jmaqs.base.*
+com.magenic.jmaqs.cucumber.*
+com.magenic.jmaqs.database.*
+com.magenic.jmaqs.selenium.*
+com.magenic.jmaqs.utilities.*
+com.magenic.jmaqs.webservices.*
+com.magic80.*
+com.magicbell.*
+com.magicmicky.freemiumlibrary.*
+com.magicmicky.habitrpgwrapper.*
+com.magicodex.*
+com.magicsoftbay.*
+com.magicsoho.*
+com.maginatics.*
+com.magmaguy.*
+com.magora-systems.android.*
+com.magusdevops.avro4k.*
+com.mahanaroad.*
+com.mahdix.*
+com.mahoujas.smsowl.*
+com.maicard.*
+com.maihaoche.*
+com.mailboxvalidator.*
+com.maileon.apiclient.*
+com.mailersend.*
+com.mailgun.*
+com.mailjet.*
+com.mailosaur.*
+com.mailslurp.*
+com.mainstreethub.*
+com.mainstreethub.build.*
+com.majiaxueyuan.*
+com.makeandbuild.*
+com.makeramen.*
+com.makitoo.*
+com.malagasys.*
+com.malinatran.java-http-server.*
+com.malinkang.*
+com.malinskiy.*
+com.malinskiy.adam.*
+com.malinskiy.marathon.*
+com.malinskiy.sheldon.*
+com.malinskiy.sheldon2.*
+com.malliina.*
+com.maltaisn.*
+com.mambaart.*
+com.mammb.*
+com.manamind.jgitflow.*
+com.manaschaudhari.*
+com.mandalarsoft.*
+com.mandrillapp.wrapper.lutung.*
+com.manganit.*
+com.manganit.half.*
+com.mangofactory.*
+com.mangofactory.swagger.*
+com.mangopay.*
+com.mangopay.android.*
+com.mani.*
+com.mannanlive.*
+com.manoelcampos.*
+com.manolodominguez.*
+com.manolovn.*
+com.manorrock.calico.*
+com.manorrock.catus.*
+com.manorrock.common.*
+com.manorrock.common.filesystem.*
+com.manorrock.common.kvs.*
+com.manorrock.eagle.*
+com.manorrock.eagle.azure.*
+com.manorrock.faces.*
+com.manorrock.faces.converter.*
+com.manorrock.faces.lifecycle.*
+com.manorrock.flounder.*
+com.manorrock.flounder.test.*
+com.manorrock.guppy.*
+com.manorrock.herring.*
+com.manorrock.hummingbird.*
+com.manorrock.ocelot.*
+com.manorrock.ocelot.azure.*
+com.manorrock.oyena.*
+com.manorrock.oyena.converter.*
+com.manorrock.oyena.lifecycle.*
+com.manorrock.parakeet.*
+com.manorrock.parrot.*
+com.manorrock.piranha.*
+com.manorrock.sardine.*
+com.manorrock.yaml.*
+com.manticore-projects.jdbc.*
+com.manticore-projects.jsqlformatter.*
+com.manticore-projects.tools.*
+com.manticoresearch.*
+com.mantledillusion.cache.*
+com.mantledillusion.data.*
+com.mantledillusion.essentials.*
+com.mantledillusion.injection.*
+com.mantledillusion.metrics.*
+com.mantledillusion.vaadin.*
+com.mantulife.*
+com.mantulife.common.*
+com.manusunny.*
+com.manyangled.*
+com.manybrain.*
+com.manydesigns.*
+com.manymo.*
+com.manymobi.*
+com.manywho.*
+com.manywho.sdk.*
+com.manywho.services.*
+com.maojianwei.*
+com.maojianwei.maocloud.*
+com.maojianwei.maoqos.*
+com.maojianwei.nat.traversal.*
+com.maojianwei.onos.app.*
+com.maojianwei.onos.network.troubleshoot.*
+com.maojianwei.pi.*
+com.maojianwei.talking.rabbit.*
+com.maojianwei.wechat.*
+com.mapbox.base.*
+com.mapbox.common.*
+com.mapbox.mapboxgl.*
+com.mapbox.mapboxsdk.*
+com.mapbox.navigation.*
+com.mapcat.mapcatsdk.*
+com.mapcode.*
+com.mapfinal.*
+com.maple86.*
+com.maplecloudy.osrc.*
+com.maplecloudy.osrt.*
+com.mapp.intelligence.tracking.*
+com.mapp.sdk.*
+com.mappedin.sdk.*
+com.mapvine.*
+com.mapxus.map.*
+com.mapxus.positioning.*
+com.mapxus.sdk.*
+com.mapxus.sensing.*
+com.mapxus.visual.*
+com.mapzen.*
+com.mapzen.android.*
+com.mapzen.tangram.*
+com.maqiangcgq.*
+com.marcarndt.morse.*
+com.marcelkliemannel.*
+com.marcelotomazini.*
+com.marcgrue.*
+com.marcinmoskala.*
+com.marcinziolo.*
+com.marciocadev.*
+com.marcnuri.*
+com.marcnuri.plugins.*
+com.marcnuri.yakc.*
+com.marcnuri.yakc.apis.*
+com.marcoeckstein.*
+com.marcosbarbero.boot.*
+com.marcosbarbero.cloud.*
+com.marcosbarbero.core.*
+com.marcosgarciacasado.*
+com.marcospassos.*
+com.marcusdo.*
+com.marekkadek.*
+com.marighetto.*
+com.marimon-clos.*
+com.mariocairone.*
+com.mariocairone.cucumbersome.*
+com.mariocairone.mule.*
+com.mariosangiorgio.*
+com.mariten.*
+com.mariusgreve.*
+com.mark59.*
+com.markatta.*
+com.markblokpoel.*
+com.markelliot.barista.*
+com.markelliot.barista.tracing.*
+com.markelliot.result.*
+com.markelytics.*
+com.market.*
+com.marketo.*
+com.markfeeney.*
+com.markgrand.*
+com.markgrand.smileyVars.*
+com.markklim.libs.*
+com.marklogic.*
+com.markodevcic.*
+com.markomilos.jsonapi.*
+com.markosindustries.distroboy.*
+com.marksandspencer.*
+com.markstickel.keycloak.*
+com.markstickel.openapi.*
+com.markusjura.*
+com.markvink.*
+com.marmoush.*
+com.marmoush.jutils.*
+com.marosseleng.android.*
+com.marshalchen.*
+com.marshalchen.ultimateandroid.*
+com.marshalchen.ultimaterecyclerview.*
+com.martensigwart.*
+com.martialdev.game.hanoitower.*
+com.martiansoftware.*
+com.martincuervo.*
+com.martinkl.warc.*
+com.marvelution.*
+com.marvelution.atlassian.suite.plugins.*
+com.marvelution.bamboo.plugins.*
+com.marvelution.confluence.plugins.*
+com.marvelution.crowd.plugins.*
+com.marvelution.gadgets.*
+com.marvelution.gitflow.*
+com.marvelution.jira.plugins.*
+com.marvelution.maven.*
+com.marvelution.maven.components.*
+com.marvelution.maven.plugins.*
+com.marvelution.security.*
+com.marvelution.skins.*
+com.marvelution.sonar.*
+com.marvinformatics.*
+com.marvinformatics.apgdiff.*
+com.marvinformatics.avro.*
+com.marvinformatics.feign.*
+com.marvinformatics.flex.*
+com.marvinformatics.formatter.*
+com.marvinformatics.hibernate.*
+com.marvinformatics.maven.*
+com.marvinlabs.*
+com.masabi.kotlin.kotlinbuilder.*
+com.masabi.kotlinbuilder.*
+com.masabi.swagwire.*
+com.masasdani.*
+com.maschel.*
+com.masesgroup.*
+com.masetta.spann.*
+com.mashape.analytics.agent.*
+com.mashape.apianalytics.agent.*
+com.mashape.galileo.agent.*
+com.mashape.unirest.*
+com.masselis.rxbluetoothkotlin.*
+com.massfords.*
+com.massisframework.*
+com.massisframework.j3d.*
+com.massisframework.jme3.*
+com.massisframework.massis.*
+com.massisframework.massis.archetypes.*
+com.massisframework.sunflow.*
+com.massisframework.sweethome3d.*
+com.massrelevance.*
+com.mastercard.api.*
+com.mastercard.commerce.*
+com.mastercard.developer.*
+com.mastercard.gateway.*
+com.mastercard.masterpass.merchant.*
+com.mastercard.merchant.checkout.*
+com.mastercard.merchant.onboarding.*
+com.mastercard.openbanking.connect.*
+com.mastercard.pbba.*
+com.mastercard.psp.payment.*
+com.mastercard.sdk.core.*
+com.mastercard.sdk.token.*
+com.mastercard.test.flow.*
+com.mastfrog.*
+com.mastfrog.atomicstate.*
+com.mastfrog.builder.*
+com.mastfrog.builder.test.*
+com.matbadev.dabirva.*
+com.materialkolor.*
+com.mateuszkoslacz.moviper.*
+com.mathworks.prodserver.*
+com.matpag.*
+com.matrixshell.*
+com.matsawa.*
+com.mattbertolini.*
+com.matteobattilana.*
+com.matteomortari.*
+com.mattgawarecki.play.*
+com.matthewcasperson.*
+com.matthewjosephtaylor.archetypes.*
+com.mattjhoffman.*
+com.mattlangsenkamp.svgBounds.*
+com.mattprecious.swirl.*
+com.mattprecious.telescope.*
+com.mattprovis.*
+com.matttproud.accepts.*
+com.matttproud.quantile.*
+com.mattunderscore.*
+com.mattunderscore.code.generation.specky.*
+com.mattunderscore.tree.root.*
+com.mattunderscore.trees.*
+com.mattwhipple.logman.*
+com.mattwhipple.sproogle.*
+com.mattworzala.*
+com.mattworzala.org.spongepowered.*
+com.matyrobbrt.*
+com.matyrobbrt.mc.sectionprotection.*
+com.maukaim.opensource.*
+com.mauriciogiordano.*
+com.mauter.*
+com.maxdota.maxhelper.*
+com.maxdota.maxrncryptor.*
+com.maxiaofa.captcha.*
+com.maxiaofa.captcha.spring.boot.starter.*
+com.maxifier.mxcache.*
+com.maximaconsulting.*
+com.maximbircu.*
+com.maximeroussy.*
+com.maximeroussy.invitrode.*
+com.maxkeppeler.sheets-compose-dialogs.*
+com.maxkeppeler.sheets.*
+com.maxleap.*
+com.maxmind.db.*
+com.maxmind.geoip.*
+com.maxmind.geoip2.*
+com.maxmind.maxminddb.*
+com.maxmind.minfraud.*
+com.maxmind.ws.*
+com.maxondev.jsif.*
+com.maxonrow.*
+com.maxpay.android.*
+com.maxplus1.*
+com.maxtropy.arch.open-platform.*
+com.maxxton.*
+com.mayabot.*
+com.mayabot.mynlp.*
+com.mayabot.mynlp.resource.*
+com.mayakapps.compose.*
+com.mayakapps.kache.*
+com.mayakapps.lrucache.*
+com.mayhoo.*
+com.mayhoo.parent.*
+com.mayreh.*
+com.mayreh.jktls.*
+com.mayreh.lowtable.*
+com.mazatech.amanithsvg.*
+com.mazekine.*
+com.mazhangjing.*
+com.mbiamont.*
+com.mboatek.mKsms.*
+com.mcafee.dxl.streaming.operations.client.*
+com.mcconnellsoftware.dynamodb-lock.*
+com.mchange.*
+com.mckoi.*
+com.mclarkdev.tools.*
+com.mcneilio.*
+com.mcsherrylabs.*
+com.mcxiaoke.actionbarpulltorefresh.*
+com.mcxiaoke.commons.*
+com.mcxiaoke.gradle.*
+com.mcxiaoke.ijk.media.*
+com.mcxiaoke.koi.*
+com.mcxiaoke.licensesdialog.*
+com.mcxiaoke.next.*
+com.mcxiaoke.oauthsimple.*
+com.mcxiaoke.packer-ng.*
+com.mcxiaoke.photoview.*
+com.mcxiaoke.popupmenu.*
+com.mcxiaoke.pulltorefresh.*
+com.mcxiaoke.viewpagerindicator.*
+com.mcxiaoke.volley.*
+com.mcxiaoke.xbus.*
+com.mdaniline.*
+com.mdataset.*
+com.mdialog.*
+com.mdsol.*
+com.mealticket.*
+com.meancat.*
+com.meancat.usefully.*
+com.meaningcloud.*
+com.measurence.*
+com.mebigfatguy.*
+com.mebigfatguy.asm-delegate.*
+com.mebigfatguy.blocklist.*
+com.mebigfatguy.caveman.*
+com.mebigfatguy.central4j.*
+com.mebigfatguy.deadmethods.*
+com.mebigfatguy.fb-contrib.*
+com.mebigfatguy.fb-delta.*
+com.mebigfatguy.fbp-maven-plugin.*
+com.mebigfatguy.gnomeminesplaya.*
+com.mebigfatguy.hashshmash.*
+com.mebigfatguy.oahash.*
+com.mebigfatguy.quiescence.*
+com.mebigfatguy.sb-contrib.*
+com.mebigfatguy.stringliterals.*
+com.mebigfatguy.vcsversion.*
+com.mebigfatguy.yank.*
+com.mechalikh.*
+com.mechdome.*
+com.medallia.*
+com.medallia.merci.*
+com.medallia.word2vec.*
+com.medallia.word4vec.*
+com.mediamath.*
+com.mediamiser.*
+com.mediarithmics.*
+com.mediayoucanfeel.*
+com.medly.*
+com.medly.norm.*
+com.medplum.*
+com.meedoc.*
+com.meehnia.*
+com.meembusoft.recyclerview.*
+com.meeshkan.*
+com.meeterp.*
+com.meetme.android.*
+com.meetup.*
+com.meetup.sbt.*
+com.mefitihe.*
+com.megafarad.*
+com.megaport.api.*
+com.megatome.javadoc2dash.*
+com.megatome.knowndefects.*
+com.megginson.sax.*
+com.mehmetyucel.*
+com.meilisearch.sdk.*
+com.meiqia.*
+com.meistermeier.neo4j.toolbelt.*
+com.meitu.*
+com.meituan.*
+com.meituan.cat.*
+com.meituan.lyrebird.sdk.*
+com.meizu.flyme.*
+com.meizu.flyme.internet.*
+com.melahn.*
+com.meleclass.*
+com.melessoftware.hamcrest.*
+com.melessoftware.testing.*
+com.meliorbis.economics.*
+com.meliorbis.numerics.*
+com.melloware.*
+com.melnykov.*
+com.melodysmaps.*
+com.melon-project.*
+com.meltmedia.*
+com.meltmedia.cadmium.*
+com.meltmedia.dropwizard.*
+com.meltmedia.jackson.*
+com.meltmedia.jgroups.*
+com.meltwater.*
+com.meltwater.docker.*
+com.meltwater.fawn.*
+com.melvinlow.*
+com.memetix.*
+com.memfault.bort.*
+com.memfault.cloud.*
+com.memnets.*
+com.memsql.*
+com.memtrip.cucumber.smoothie.*
+com.memtrip.mxandroid.*
+com.memtrip.sqlking.*
+com.mendhak.gradlecrowdin.*
+com.mendmix.*
+com.menecats.*
+com.mengweifeng.*
+com.mengweifeng.tool.*
+com.mengyunzhi.*
+com.meniga.sdk.*
+com.meowool.gradle.*
+com.meowool.gradle.toolkit-core.*
+com.meowool.gradle.toolkit-dependency-mapper.*
+com.meowool.gradle.toolkit-publisher.*
+com.meowool.gradle.toolkit.*
+com.meowool.toolkit.*
+com.meowool.toolkit.gradle-dsl-x-core.*
+com.meowool.toolkit.gradle-dsl-x.*
+com.merakianalytics.datapipelines.*
+com.merakianalytics.orianna.*
+com.merakianalytics.orianna.datastores.*
+com.merapar.*
+com.merative.acd.*
+com.mercadopago.*
+com.mercateo.*
+com.mercateo.eventstore.*
+com.mercateo.oss.*
+com.mercateo.oss.parent.*
+com.mercateo.rest.*
+com.mercateo.spring.*
+com.mercateo.sqs.*
+com.merchantsafeunipay.*
+com.mercurialminds.sdk.*
+com.mergere.mvnbook.proficio.*
+com.meschbach.cise.*
+com.meschbach.psi.*
+com.mesibo.api.*
+com.mesonomics.*
+com.mesosphere.*
+com.mesosphere.cosmos.*
+com.mesosphere.mesos.rx.java.*
+com.mesosphere.mesos.rx.java.example.*
+com.mesour.intellij.*
+com.messagebird.*
+com.messagegears.*
+com.messagemedia.messages.sdk.*
+com.messagemedia.sdk.*
+com.messagex.*
+com.messangi.sdk.*
+com.messapix.ftatr.jfxmobile.*
+com.messente.*
+com.messente.api.*
+com.messners.*
+com.metaco.api.*
+com.metaeffekt.artifact.analysis.*
+com.metaeffekt.universe.*
+com.metalitix.analytics.*
+com.metamap.*
+com.metamug.*
+com.metamx.*
+com.metamx.cache.*
+com.metaparadigm.*
+com.metapossum.*
+com.metaring.*
+com.metaring.framework.*
+com.metaring.generator.*
+com.metaversant.*
+com.metaweb.*
+com.meterware.*
+com.meterware.simpleserver.*
+com.meterware.simplestub.*
+com.meterware.xml.*
+com.metlo.*
+com.metova.*
+com.metreeca.*
+com.metrekare.*
+com.metricstream.*
+com.metricstream.jdbc.*
+com.metrink.croquet.*
+com.metroipo.*
+com.metronom.*
+com.metsci.ext.com.kitfox.svg.*
+com.metsci.ext.org.jogamp.gluegen.*
+com.metsci.ext.org.jogamp.jogl.*
+com.metsci.ext.swingx.*
+com.metsci.glimpse.*
+com.mewebstudio.*
+com.mfizz.*
+com.mgage.*
+com.mgage.testrailsdk.*
+com.mgmtp.gcviewer.*
+com.mgmtp.jfunk.*
+com.mgmtp.license.*
+com.mgmtp.maven.poms.*
+com.mgmtp.maven.resources.*
+com.mgmtp.perfload.*
+com.mgmtp.perfload.agent.*
+com.mgmtp.perfload.core.*
+com.mgmtp.perfload.demo.*
+com.mgmtp.perfload.loadprofiles.*
+com.mgmtp.perfload.logging.*
+com.mgmtp.perfload.perfalyzer.*
+com.mgmtp.perfload.perfmon.*
+com.mgmtp.perfload.refapp.*
+com.mgmtp.perfload.supervisor.*
+com.mgustran.*
+com.mi.dev.mint.*
+com.miaosila.*
+com.miaosila.android.*
+com.micahw.*
+com.michael-bull.kotlin-coroutines-jdbc.*
+com.michael-bull.kotlin-inline-logger.*
+com.michael-bull.kotlin-result.*
+com.michael-bull.kotlin-retry.*
+com.michael-bull.spring-boot-starter-recaptcha.*
+com.michaelalynmiller.*
+com.michaelhradek.*
+com.michaelpardo.*
+com.michaelpollmeier.*
+com.michaelstrasser.*
+com.michaeltroger.*
+com.michaelwflaherty.*
+com.michalklempa.*
+com.michalklempa.flink.*
+com.michelboudreau.*
+com.micheldalal.*
+com.michellemay.*
+com.mickaelb.*
+com.microfocus.*
+com.microfocus.adm.almoctane.bdd.*
+com.microfocus.adm.almoctane.ciplugins.*
+com.microfocus.adm.almoctane.jbehave.*
+com.microfocus.adm.almoctane.sdk.*
+com.microfocus.adm.almoctane.sdk.extension.*
+com.microfocus.adm.dimensionscm.*
+com.microfocus.adm.leanft.*
+com.microfocus.adm.performancecenter.*
+com.microfocus.octane.ciplugins.*
+com.microfocus.sv.*
+com.microfocus.webjars.*
+com.microkubes.*
+com.microsoft.*
+com.microsoft.aad.*
+com.microsoft.alm.*
+com.microsoft.appcenter.*
+com.microsoft.appcenter.reactnative.*
+com.microsoft.aspnet.*
+com.microsoft.aspnet.publishing-test.*
+com.microsoft.aspnet.publishing-test.messagepack.*
+com.microsoft.azure.*
+com.microsoft.azure.advisor.v2017_04_19.*
+com.microsoft.azure.advisor.v2020_01_01.*
+com.microsoft.azure.android.*
+com.microsoft.azure.apimanagement.v2018_06_01_preview.*
+com.microsoft.azure.apimanagement.v2019_01_01.*
+com.microsoft.azure.apimanagement.v2019_12_01.*
+com.microsoft.azure.appconfiguration.v2019_02_01_preview.*
+com.microsoft.azure.appconfiguration.v2019_10_01.*
+com.microsoft.azure.appconfiguration.v2019_11_01_preview.*
+com.microsoft.azure.appconfiguration.v2020_06_01.*
+com.microsoft.azure.applicationinsights.v2015_05_01.*
+com.microsoft.azure.appplatform.v2019_05_01_preview.*
+com.microsoft.azure.appplatform.v2020_07_01.*
+com.microsoft.azure.appplatform.v2020_11_01_preview.*
+com.microsoft.azure.appservice.v2016_03_01.*
+com.microsoft.azure.appservice.v2016_08_01.*
+com.microsoft.azure.appservice.v2016_09_01.*
+com.microsoft.azure.appservice.v2018_02_01.*
+com.microsoft.azure.appservice.v2019_08_01.*
+com.microsoft.azure.appservice.v2020_09_01.*
+com.microsoft.azure.attestation.v2020_10_01.*
+com.microsoft.azure.authorization.v2015_06_01.*
+com.microsoft.azure.authorization.v2015_07_01.*
+com.microsoft.azure.authorization.v2018_07_01_preview.*
+com.microsoft.azure.authorization.v2018_09_01_preview.*
+com.microsoft.azure.automation.v2015_10_31.*
+com.microsoft.azure.automation.v2018_06_30.*
+com.microsoft.azure.avs.v2019_08_09_preview.*
+com.microsoft.azure.avs.v2020_03_20.*
+com.microsoft.azure.azuredatabasemigrationservice.v2018_07_15_preview.*
+com.microsoft.azure.azurestack.v2017_06_01.*
+com.microsoft.azure.azurestackhci.v2020_10_01.*
+com.microsoft.azure.batchai-2018-05-01.*
+com.microsoft.azure.batchai.v2017_09_01_preview.*
+com.microsoft.azure.batchai.v2018_03_01.*
+com.microsoft.azure.batchai.v2018_05_01.*
+com.microsoft.azure.cache-2018-03-01.*
+com.microsoft.azure.cdn.v2020_04_15.*
+com.microsoft.azure.cdn.v2020_09_01.*
+com.microsoft.azure.cognitiveservices-2017-04-18.*
+com.microsoft.azure.cognitiveservices.*
+com.microsoft.azure.cognitiveservices.v2017_04_18.*
+com.microsoft.azure.commerce.v2015_06_01_preview.*
+com.microsoft.azure.communication.v2020_08_20_preview.*
+com.microsoft.azure.compute.v2017_03_30.*
+com.microsoft.azure.compute.v2017_12_01.*
+com.microsoft.azure.compute.v2018_09_30.*
+com.microsoft.azure.compute.v2019_03_01.*
+com.microsoft.azure.compute.v2019_07_01.*
+com.microsoft.azure.compute.v2019_11_01.*
+com.microsoft.azure.compute.v2020_06_01.*
+com.microsoft.azure.compute.v2020_10_01_preview.*
+com.microsoft.azure.compute.v2020_12_01.*
+com.microsoft.azure.containerinstance.v2018_10_01.*
+com.microsoft.azure.containerinstance.v2019_12_01.*
+com.microsoft.azure.containerinstance.v2020_11_01.*
+com.microsoft.azure.containerregistry.v2016_06_27_preview.*
+com.microsoft.azure.containerregistry.v2017_03_01.*
+com.microsoft.azure.containerregistry.v2017_06_01_preview.*
+com.microsoft.azure.containerregistry.v2017_10_01.*
+com.microsoft.azure.containerregistry.v2018_02_01_preview.*
+com.microsoft.azure.containerregistry.v2018_09_01.*
+com.microsoft.azure.containerregistry.v2019_04_01.*
+com.microsoft.azure.containerregistry.v2019_06_01_preview.*
+com.microsoft.azure.containerservice.v2018_09_30_preview.*
+com.microsoft.azure.containerservice.v2019_02_01.*
+com.microsoft.azure.containerservice.v2019_04_01.*
+com.microsoft.azure.containerservice.v2019_06_01.*
+com.microsoft.azure.containerservice.v2019_08_01.*
+com.microsoft.azure.containerservice.v2020_02_01.*
+com.microsoft.azure.containerservice.v2020_06_01.*
+com.microsoft.azure.containerservice.v2020_07_01.*
+com.microsoft.azure.containerservice.v2020_09_01.*
+com.microsoft.azure.containerservice.v2020_12_01.*
+com.microsoft.azure.cosmosdb.*
+com.microsoft.azure.cosmosdb.v2015_04_08.*
+com.microsoft.azure.cosmosdb.v2019_08_01.*
+com.microsoft.azure.cosmosdb.v2019_08_01_preview.*
+com.microsoft.azure.cosmosdb.v2019_12_12.*
+com.microsoft.azure.cosmosdb.v2020_03_01.*
+com.microsoft.azure.cosmosdb.v2020_04_01.*
+com.microsoft.azure.cosmosdb.v2020_06_01_preview.*
+com.microsoft.azure.cosmosdb.v2020_09_01.*
+com.microsoft.azure.costmanagement.v2018_05_31.*
+com.microsoft.azure.costmanagement.v2019_11_01.*
+com.microsoft.azure.databox.v2019_09_01.*
+com.microsoft.azure.databoxedge.v2019_08_01.*
+com.microsoft.azure.databoxedge.v2020_05_01_preview.*
+com.microsoft.azure.datafactory.v2018_06_01.*
+com.microsoft.azure.datamigration.v2018_07_15_preview.*
+com.microsoft.azure.dbformysql-2017-12-01.*
+com.microsoft.azure.dbforpostgresql-2017-12-01.*
+com.microsoft.azure.deploymentmanager.v2019_11_01_preview.*
+com.microsoft.azure.devices-2018-04-01.*
+com.microsoft.azure.devspaces.v2018_06_01_preview.*
+com.microsoft.azure.devtestlabs.v2018_09_15.*
+com.microsoft.azure.digitaltwins.v2020_03_01_preview.*
+com.microsoft.azure.digitaltwins.v2020_10_31.*
+com.microsoft.azure.digitaltwins.v2020_12_01.*
+com.microsoft.azure.dns.v2016_04_01.*
+com.microsoft.azure.edgegateway.v2019_03_01.*
+com.microsoft.azure.eventgrid-2018-01-01.*
+com.microsoft.azure.eventgrid.v2018_01_01.*
+com.microsoft.azure.eventgrid.v2018_05_01_preview.*
+com.microsoft.azure.eventgrid.v2018_09_15_preview.*
+com.microsoft.azure.eventgrid.v2019_01_01.*
+com.microsoft.azure.eventgrid.v2019_02_01_preview.*
+com.microsoft.azure.eventgrid.v2019_06_01.*
+com.microsoft.azure.eventgrid.v2020_01_01_preview.*
+com.microsoft.azure.eventgrid.v2020_04_01_preview.*
+com.microsoft.azure.eventgrid.v2020_06_01.*
+com.microsoft.azure.eventhub.v2017_04_01.*
+com.microsoft.azure.eventhubs.v2015_08_01.*
+com.microsoft.azure.eventhubs.v2017_04_01.*
+com.microsoft.azure.eventhubs.v2018_01_01_preview.*
+com.microsoft.azure.features.v2015_12_01.*
+com.microsoft.azure.frontdoor.v2020_05_01.*
+com.microsoft.azure.functions.*
+com.microsoft.azure.gateway.*
+com.microsoft.azure.gateway.archetypes.*
+com.microsoft.azure.hanaonazure.v2017_11_03_preview.*
+com.microsoft.azure.hdinsight.v2018_06_01_preview.*
+com.microsoft.azure.healthcareapis.v2020_03_15.*
+com.microsoft.azure.healthcareapis.v2020_03_30.*
+com.microsoft.azure.hybridcompute.v2019_12_12.*
+com.microsoft.azure.hybridcompute.v2020_08_02.*
+com.microsoft.azure.iot.*
+com.microsoft.azure.iotcentral.v2018_09_01.*
+com.microsoft.azure.iothub-java-client.*
+com.microsoft.azure.iothub.v2018_04_01.*
+com.microsoft.azure.iothub.v2018_12_01_preview.*
+com.microsoft.azure.iothub.v2019_03_22_preview.*
+com.microsoft.azure.iothub.v2019_07_01_preview.*
+com.microsoft.azure.keyvault.v2016_10_01.*
+com.microsoft.azure.keyvault.v2019_09_01.*
+com.microsoft.azure.kubernetesconfiguration.v2019_11_01_preview.*
+com.microsoft.azure.kubernetesconfiguration.v2021_03_01.*
+com.microsoft.azure.kusto.*
+com.microsoft.azure.kusto.v2018_09_07_preview.*
+com.microsoft.azure.kusto.v2019_01_21.*
+com.microsoft.azure.kusto.v2019_05_15.*
+com.microsoft.azure.kusto.v2019_09_07.*
+com.microsoft.azure.kusto.v2019_11_09.*
+com.microsoft.azure.kusto.v2020_02_15.*
+com.microsoft.azure.kusto.v2020_06_14.*
+com.microsoft.azure.kusto.v2020_09_18.*
+com.microsoft.azure.labservices.v2018_10_15.*
+com.microsoft.azure.locks.v2016_09_01.*
+com.microsoft.azure.loganalytics.v2015_03_20.*
+com.microsoft.azure.loganalytics.v2019_08_01_preview.*
+com.microsoft.azure.loganalytics.v2020_03_01_preview.*
+com.microsoft.azure.loganalytics.v2020_08_01.*
+com.microsoft.azure.logic-2016-06-01.*
+com.microsoft.azure.logic.v2018_07_01_preview.*
+com.microsoft.azure.machinelearningservices.v2019_05_01.*
+com.microsoft.azure.maintenance.v2018_06_01_preview.*
+com.microsoft.azure.managedapplications.v2019_07_01.*
+com.microsoft.azure.mariadb.v2018_06_01.*
+com.microsoft.azure.mariadb.v2020_01_01.*
+com.microsoft.azure.marketplaceordering.v2015_06_01.*
+com.microsoft.azure.media-2018-03-30-preview.*
+com.microsoft.azure.mediaservices.v2015_10_01.*
+com.microsoft.azure.mediaservices.v2018_03_30_preview.*
+com.microsoft.azure.mediaservices.v2018_06_01_preview.*
+com.microsoft.azure.mediaservices.v2018_07_01.*
+com.microsoft.azure.mediaservices.v2019_05_01_preview.*
+com.microsoft.azure.mediaservices.v2020_05_01.*
+com.microsoft.azure.mixedreality.v2019_02_28_preview.*
+com.microsoft.azure.mixedreality.v2020_05_01.*
+com.microsoft.azure.mixedreality.v2021_01_01.*
+com.microsoft.azure.monitor.v2015_04_01.*
+com.microsoft.azure.monitor.v2015_07_01.*
+com.microsoft.azure.monitor.v2016_03_01.*
+com.microsoft.azure.monitor.v2017_03_01_preview.*
+com.microsoft.azure.monitor.v2017_04_01.*
+com.microsoft.azure.monitor.v2017_05_01_preview.*
+com.microsoft.azure.monitor.v2018_01_01.*
+com.microsoft.azure.monitor.v2018_03_01.*
+com.microsoft.azure.monitor.v2018_04_16.*
+com.microsoft.azure.monitor.v2018_09_01.*
+com.microsoft.azure.monitor.v2019_11_01.*
+com.microsoft.azure.msi_auth_token_provider.*
+com.microsoft.azure.mysql.v2017_12_01.*
+com.microsoft.azure.mysql.v2017_12_01_preview.*
+com.microsoft.azure.mysql.v2020_01_01.*
+com.microsoft.azure.netapp.v2017_08_15.*
+com.microsoft.azure.netapp.v2019_05_01.*
+com.microsoft.azure.netapp.v2019_06_01.*
+com.microsoft.azure.netapp.v2019_07_01.*
+com.microsoft.azure.netapp.v2019_08_01.*
+com.microsoft.azure.netapp.v2019_10_01.*
+com.microsoft.azure.netapp.v2019_11_01.*
+com.microsoft.azure.netapp.v2020_02_01.*
+com.microsoft.azure.netapp.v2020_06_01.*
+com.microsoft.azure.netapp.v2020_07_01.*
+com.microsoft.azure.netapp.v2020_09_01.*
+com.microsoft.azure.network.v2017_10_01.*
+com.microsoft.azure.network.v2018_04_01.*
+com.microsoft.azure.network.v2018_06_01.*
+com.microsoft.azure.network.v2018_07_01.*
+com.microsoft.azure.network.v2018_08_01.*
+com.microsoft.azure.network.v2018_11_01.*
+com.microsoft.azure.network.v2018_12_01.*
+com.microsoft.azure.network.v2019_02_01.*
+com.microsoft.azure.network.v2019_04_01.*
+com.microsoft.azure.network.v2019_06_01.*
+com.microsoft.azure.network.v2019_07_01.*
+com.microsoft.azure.network.v2019_08_01.*
+com.microsoft.azure.network.v2019_09_01.*
+com.microsoft.azure.network.v2019_11_01.*
+com.microsoft.azure.network.v2019_12_01.*
+com.microsoft.azure.network.v2020_03_01.*
+com.microsoft.azure.network.v2020_04_01.*
+com.microsoft.azure.network.v2020_05_01.*
+com.microsoft.azure.network.v2020_06_01.*
+com.microsoft.azure.network.v2020_07_01.*
+com.microsoft.azure.network.v2020_08_01.*
+com.microsoft.azure.notificationhubs.v2016_03_01.*
+com.microsoft.azure.notificationhubs.v2017_04_01.*
+com.microsoft.azure.operationsmanagement.v2015_11_01_preview.*
+com.microsoft.azure.peering.v2019_08_01_preview.*
+com.microsoft.azure.policy.v2016_12_01.*
+com.microsoft.azure.policy.v2018_05_01.*
+com.microsoft.azure.policy.v2019_06_01.*
+com.microsoft.azure.policy.v2019_09_01.*
+com.microsoft.azure.policyinsights.v2018_04_04.*
+com.microsoft.azure.policyinsights.v2018_07_01_preview.*
+com.microsoft.azure.policyinsights.v2019_10_01.*
+com.microsoft.azure.postgresql.v2017_12_01.*
+com.microsoft.azure.postgresql.v2017_12_01_preview.*
+com.microsoft.azure.powerbidedicated.v2017_10_01.*
+com.microsoft.azure.privatedns.v2018_09_01.*
+com.microsoft.azure.profile_2018_03_01_hybrid.*
+com.microsoft.azure.profile_2019_03_01_hybrid.*
+com.microsoft.azure.recoveryservices.backup.v2016_06_01.*
+com.microsoft.azure.recoveryservices.backup.v2016_08_10.*
+com.microsoft.azure.recoveryservices.backup.v2016_12_01.*
+com.microsoft.azure.recoveryservices.backup.v2017_07_01.*
+com.microsoft.azure.recoveryservices.backup.v2020_02_02.*
+com.microsoft.azure.recoveryservices.siterecovery.v2018_01_10.*
+com.microsoft.azure.recoveryservices.v2016_06_01.*
+com.microsoft.azure.redis.v2018_03_01.*
+com.microsoft.azure.relay.v2017_04_01.*
+com.microsoft.azure.resourcegraph.v2019_04_01.*
+com.microsoft.azure.resourcehealth.v2015_01_01.*
+com.microsoft.azure.resourcehealth.v2017_07_01.*
+com.microsoft.azure.resourcemover.v2021_01_01.*
+com.microsoft.azure.resources.v2016_06_01.*
+com.microsoft.azure.resources.v2016_09_01.*
+com.microsoft.azure.resources.v2018_02_01.*
+com.microsoft.azure.resources.v2018_05_01.*
+com.microsoft.azure.resources.v2019_05_01.*
+com.microsoft.azure.resources.v2019_06_01.*
+com.microsoft.azure.resources.v2019_07_01.*
+com.microsoft.azure.resources.v2019_10_01.*
+com.microsoft.azure.resources.v2019_11_01.*
+com.microsoft.azure.resources.v2020_06_01.*
+com.microsoft.azure.sdk.iot.*
+com.microsoft.azure.sdk.iot.deps.*
+com.microsoft.azure.sdk.iot.provisioning.*
+com.microsoft.azure.sdk.iot.provisioning.security.*
+com.microsoft.azure.search.v2015_02_28.*
+com.microsoft.azure.servicebus.v2015_08_01.*
+com.microsoft.azure.servicebus.v2017_04_01.*
+com.microsoft.azure.servicebus.v2018_01_01_preview.*
+com.microsoft.azure.servicefabric.*
+com.microsoft.azure.servicefabric.v2018_02_01.*
+com.microsoft.azure.sessionmanager.*
+com.microsoft.azure.signalr.v2018_10_01.*
+com.microsoft.azure.signalr.v2020_05_01.*
+com.microsoft.azure.signalrservice-2018-03-01-preview.*
+com.microsoft.azure.sql.v2014_04_01.*
+com.microsoft.azure.sql.v2015_05_01_preview.*
+com.microsoft.azure.sql.v2017_03_01_preview.*
+com.microsoft.azure.sql.v2017_10_01_preview.*
+com.microsoft.azure.sql.v2018_06_01_preview.*
+com.microsoft.azure.sqlvirtualmachine.v2017_03_01_preview.*
+com.microsoft.azure.storage-2017-10-01.*
+com.microsoft.azure.storage.v2016_01_01.*
+com.microsoft.azure.storage.v2017_10_01.*
+com.microsoft.azure.storage.v2018_03_01_preview.*
+com.microsoft.azure.storage.v2018_11_01.*
+com.microsoft.azure.storage.v2019_04_01.*
+com.microsoft.azure.storage.v2019_06_01.*
+com.microsoft.azure.storagecache.v2019_08_01.*
+com.microsoft.azure.storagecache.v2019_11_01.*
+com.microsoft.azure.storagecache.v2020_03_01.*
+com.microsoft.azure.storagecache.v2020_10_01.*
+com.microsoft.azure.storageimportexport.v2016_11_01.*
+com.microsoft.azure.streamanalytics-2016-03-01.*
+com.microsoft.azure.streamanalytics.v2020_03_01_preview.*
+com.microsoft.azure.subscription.v2019_10_01_preview.*
+com.microsoft.azure.subscription.v2020_09_01.*
+com.microsoft.azure.support.v2020_04_01.*
+com.microsoft.azure.synapse.*
+com.microsoft.azure.synapse.v2019_06_01_preview.*
+com.microsoft.azure.synapse.v2020_12_01.*
+com.microsoft.azure.timeseriesinsights.v2017_11_15.*
+com.microsoft.azure.v2.*
+com.microsoft.azure.vmwarecloudsimple.v2019_04_01.*
+com.microsoft.bing.*
+com.microsoft.bingads.*
+com.microsoft.bot.*
+com.microsoft.bot.builder.*
+com.microsoft.bot.connector.*
+com.microsoft.bot.schema.*
+com.microsoft.clarity.*
+com.microsoft.cntk.*
+com.microsoft.cognitive.*
+com.microsoft.cognitiveservices.speech.*
+com.microsoft.cognitiveservices.speech.remotemeeting.*
+com.microsoft.commondatamodel.*
+com.microsoft.deployr.*
+com.microsoft.design.*
+com.microsoft.device.*
+com.microsoft.device.dualscreen.*
+com.microsoft.device.dualscreen.testing.*
+com.microsoft.dhalion.*
+com.microsoft.edge.*
+com.microsoft.entra.verifiedid.*
+com.microsoft.eventhubs.*
+com.microsoft.eventhubs.client.*
+com.microsoft.ews-java-api.*
+com.microsoft.ewsjavaapi.*
+com.microsoft.fluentui.*
+com.microsoft.gctoolkit.*
+com.microsoft.genomics.*
+com.microsoft.graph.*
+com.microsoft.hydralab.*
+com.microsoft.hyperspace.*
+com.microsoft.identity.*
+com.microsoft.identity.client.*
+com.microsoft.java.*
+com.microsoft.jfr.*
+com.microsoft.kiota.*
+com.microsoft.masc.*
+com.microsoft.maven.*
+com.microsoft.ml.lightgbm.*
+com.microsoft.ml.spark.*
+com.microsoft.msr.*
+com.microsoft.msr.malmo.*
+com.microsoft.office.*
+com.microsoft.onnxruntime.*
+com.microsoft.playwright.*
+com.microsoft.projectoxford.*
+com.microsoft.reef.*
+com.microsoft.rest.*
+com.microsoft.rest.v2.*
+com.microsoft.sandbox.microprofile.config.keyvault.*
+com.microsoft.sarplus.*
+com.microsoft.semantic-kernel.*
+com.microsoft.semantic-kernel.connectors.*
+com.microsoft.semantic-kernel.extensions.*
+com.microsoft.servicefabric.*
+com.microsoft.signalr.*
+com.microsoft.signalr.messagepack.*
+com.microsoft.spark.*
+com.microsoft.sparkclr.*
+com.microsoft.spring.data.gremlin.*
+com.microsoft.sqlserver.*
+com.microsoft.sqlserver.msi.*
+com.microsoft.store.*
+com.microsoft.tang.*
+com.microsoft.terraform.*
+com.microsoft.testing.*
+com.microsoft.testing.prss.*
+com.microsoft.thrifty.*
+com.microsoft.wake.*
+com.microsoft.windowsazure.*
+com.microsoft.windowsazure.storage.*
+com.microsoftopentechnologies.*
+com.microstrat.activiti.*
+com.midcu.*
+com.midoujia.*
+com.midoujia.dingbot.*
+com.midoujia.pay.*
+com.midtrans.*
+com.midu.*
+com.mifiel.*
+com.mig35.*
+com.migamake.api.cloudflare.*
+com.migesok.*
+com.miglayout.*
+com.migratorydata.*
+com.miguelangeljulvez.easyredsys.*
+com.miguelfonseca.completely.*
+com.miguno.akka.*
+com.mihaibojin.props.*
+com.mihirpaldhikar.*
+com.mihnita.*
+com.mihrguitars.commlite.*
+com.miilnvo.sqlbard.*
+com.miitang.*
+com.miitang.runtime.*
+com.mijecu25.*
+com.mijibox.openfin.*
+com.mikaa404.*
+com.mikafecito.*
+com.mikebull94.svg-stockpile.*
+com.mikecouturier.*
+com.mikelduke.*
+com.mikeleith.mockery.*
+com.mikemybytes.*
+com.mikenimer.*
+com.mikepenz.*
+com.mikepenz.aboutlibraries.*
+com.mikepenz.actionitembadge.*
+com.mikepenz.iconics.*
+com.mikepenz.materialdrawer.*
+com.mikerusoft.*
+com.mikesamuel.*
+com.mikewinkelmann.*
+com.mikhaellopez.*
+com.mikuac.*
+com.milaboratory.*
+com.milchstrabe.fastdfs.client.*
+com.milessabin.*
+com.mimacom.liferay.*
+com.mimepost.*
+com.mimer.jdbc.*
+com.mind.api.*
+com.mindee.sdk.*
+com.mindoo.domino.*
+com.mindorks.*
+com.mindprogeny.common.*
+com.mindprogeny.simpel.*
+com.mindprogeny.wiremock.*
+com.mindprogeny.wiremock.extension.*
+com.mindscapehq.*
+com.mindscapehq.android.*
+com.mindscapehq.raygun4java.*
+com.mindsnacks.*
+com.mindsnacks.javazinc.*
+com.mindstix.web.api.management.*
+com.mindstix.web.rest.*
+com.mineteria.ignite.*
+com.mingweisamuel.*
+com.mingweisamuel.zyra.*
+com.mingzuozhibi.*
+com.minijoy.android.*
+com.minijoy.particle.*
+com.minijoy.particle.network.*
+com.minimob.*
+com.minimocms.*
+com.miniorange.*
+com.minipayhq.*
+com.minkasu.*
+com.minlessika.*
+com.minlessika.core.*
+com.minlessika.erp.*
+com.minlessika.incubator.*
+com.minlessika.sdk.*
+com.minlia.cloud.*
+com.minlia.cloud.modules.*
+com.minlia.cloud.starter.*
+com.minlia.cloud.thirdparty.*
+com.minlia.cross.*
+com.minlia.iot.*
+com.minlia.iot.sample.*
+com.minlia.maven.*
+com.minlia.rocket.*
+com.minosiants.*
+com.minsx.*
+com.mintminter.*
+com.miouyouyou.libraries.*
+com.miqdigital.automation.*
+com.miquido.*
+com.miquido.android.navigation.*
+com.miragesql.*
+com.mirasmithy.airy.*
+com.mirnint.tools.*
+com.miron4dev.*
+com.mirzaakhena.*
+com.mirzahssn.hassanmirza444.*
+com.misberner.clitools.*
+com.miserablemind.*
+com.misolab.*
+com.missz.support.*
+com.mist.*
+com.mistark.*
+com.mistplay.*
+com.mistraltech.smog.*
+com.mitchellbosecke.*
+com.mitchseymour.*
+com.mitchtalmadge.*
+com.mitobit.camel.*
+com.mitteloupe.prever.*
+com.mitteloupe.randomgenkt.*
+com.mitteloupe.solid.*
+com.miui.referrer.*
+com.mixnode.utils.*
+com.mixpanel.*
+com.mixpanel.android.*
+com.mizhousoft.*
+com.mizhousoft.apple.*
+com.mizhousoft.bmc.*
+com.mizhousoft.boot.*
+com.mizhousoft.commons.*
+com.mizhousoft.sdk.*
+com.mjamsek.auth.*
+com.mjamsek.rest.*
+com.mkdika.*
+com.mkl-software.*
+com.mkobos.*
+com.mks.api.*
+com.mktiti.*
+com.ml4ai.*
+com.mlegy.*
+com.mlegy.linkester.*
+com.mlegy.redscreenofdeath.*
+com.mmakowski.*
+com.mmnaseri.utils.*
+com.mmorrell.*
+com.mncdigital.analytics.*
+com.mntviews.*
+com.mnubo.*
+com.moandjiezana.jamon.*
+com.moandjiezana.jsonfeed.*
+com.moandjiezana.toml.*
+com.moaview.*
+com.mob.push.sdk.*
+com.mob.sdk.push.*
+com.mob1st.*
+com.mobaijun.*
+com.mobecker.*
+com.mobenga.ngen.xml.*
+com.mobgen.android.*
+com.mobgen.halo.android.*
+com.mobidevelop.robovm.*
+com.mobidevelop.spl.*
+com.mobigosoft.*
+com.mobigrowing.*
+com.mobilefuse.sdk.*
+com.mobileia.*
+com.mobilejazz.*
+com.mobilepetroleum.*
+com.mobilepetroleum.radialencapsulation.*
+com.mobilesolutionworks.*
+com.mobilvox.ossi.mojo.*
+com.mobimeo.*
+com.mobius-software.*
+com.mobius-software.amqp.*
+com.mobius-software.cluster.*
+com.mobius-software.coap.*
+com.mobius-software.fsm.*
+com.mobius-software.iot.*
+com.mobius-software.mqtt.*
+com.mobius-software.mqttsn.*
+com.mobius-software.pcap.*
+com.mobius-software.protocols.*
+com.mobius-software.protocols.sctp.*
+com.mobius-software.protocols.ss7.*
+com.mobius-software.protocols.ss7.cap.*
+com.mobius-software.protocols.ss7.common.*
+com.mobius-software.protocols.ss7.commonapp.*
+com.mobius-software.protocols.ss7.inap.*
+com.mobius-software.protocols.ss7.isup.*
+com.mobius-software.protocols.ss7.m3ua.*
+com.mobius-software.protocols.ss7.map.*
+com.mobius-software.protocols.ss7.mtp.*
+com.mobius-software.protocols.ss7.sccp.*
+com.mobius-software.protocols.ss7.tcap.*
+com.mobius-software.protocols.ss7.tcapAnsi.*
+com.mobius-software.telco.protocols.gtp.*
+com.mobntic.*
+com.mobodid.notifylib.*
+com.mobprofs.*
+com.mobsandgeeks.*
+com.mobvoi.*
+com.mochi-cell.tools.*
+com.mocircle.*
+com.mocklets.*
+com.mockrunner.*
+com.modaoperandi.*
+com.modernmt.*
+com.modernmt.text.*
+com.moderntreasury.*
+com.moderntreasury.api.*
+com.modestoma.*
+com.modmountain.play.aws.*
+com.moduyun.sdk.mos.*
+com.moebiusgames.*
+com.moelholm.*
+com.moelholm.tools.*
+com.moengage.*
+com.moensun.common.*
+com.moensun.spring.*
+com.moesif.*
+com.moesif.api.*
+com.moesif.filter.*
+com.moesif.servlet.*
+com.moesif.springrequest.*
+com.moesif.test.*
+com.moesif.unirest.*
+com.mofiler.*
+com.mofiler.android.*
+com.mofum.msdom.*
+com.mofum.scope.*
+com.mogudiandian.*
+com.mogwee.*
+com.mohaine.*
+com.mohamedrejeb.calf.*
+com.mohamedrejeb.ksoup.*
+com.mohamedrejeb.richeditor.*
+com.mohammadaltaleb.netstreamer.*
+com.mohamnag.*
+com.mohistmc.*
+com.mohiva.*
+com.mohsenoid.android-utils.*
+com.mohsenoid.app-settings.*
+com.mohsenoid.close-to-me.*
+com.mohsenoid.load-toast.*
+com.mohsenoid.navigation-view.*
+com.moilioncircle.*
+com.moizhassan.debuglogger.*
+com.moizhassan.modularsdk.*
+com.mojoauth.android.*
+com.mojoauth.sdk.*
+com.mojolly.http.*
+com.mojolly.inflector.*
+com.mojolly.logback.*
+com.mojolly.scalate.*
+com.mojro.partner.*
+com.moksamedia.*
+com.mokung.*
+com.molgames.*
+com.moloco.sdk.*
+com.moloco.sdk.adapters.*
+com.moloco.sdk.xenoss.sdkdevkit.android.*
+com.momagic.*
+com.momomo.*
+com.monadiccloud.bindingz.*
+com.monarchapis.*
+com.monator.*
+com.monchstudio.image.*
+com.monchstudio.utils.*
+com.monday-consulting.maven.plugins.*
+com.monederobingo.*
+com.moneycollect.*
+com.mongodb.*
+com.mongodb.async.*
+com.mongodb.casbah.*
+com.monitorjbl.*
+com.monits.*
+com.monkat.*
+com.monkeylearn.*
+com.monkopedia.*
+com.monkopedia.klinker.*
+com.monkopedia.klinker.plugin.*
+com.monkopedia.kplusplus.*
+com.monkopedia.kplusplus.plugin.*
+com.monkopedia.ksrpc.*
+com.monkopedia.ksrpc.plugin.*
+com.monnify.android-sdk.*
+com.monochromeroad.gradle-plugins.*
+com.monovore.*
+com.monri.*
+com.monsanto.arch.*
+com.montecarlodata.*
+com.montesinnos.*
+com.montrosesoftware.*
+com.moodysalem.*
+com.moodysalem.java.*
+com.moodysalem.js.*
+com.moolbuy.*
+com.mooltiverse.oss.nyx.*
+com.moomanow.*
+com.moomanow.api.pay.*
+com.moomanow.archetypes.*
+com.moomanow.web.*
+com.moomanow.web.struts.*
+com.moomoo.openapi.*
+com.moonciki.strongfeign.*
+com.moonpay.sdk.*
+com.moonsinfo.*
+com.moonstoneid.*
+com.mooreb.*
+com.moovel.proto.*
+com.moozvine.*
+com.mopano.*
+com.moparisthebest.*
+com.moparisthebest.aptIn16.*
+com.moparisthebest.beehive.*
+com.moparisthebest.jbgjob.*
+com.moparisthebest.poi.*
+com.moparisthebest.sxf4j.*
+com.moparisthebest.text.*
+com.mopub.*
+com.mopub.mediation.*
+com.mopub.volley.*
+com.morethanheroic.*
+com.moriatsushi.insetsx.*
+com.moriatsushi.katalog.*
+com.moriatsushi.koject.*
+com.moriatsushi.launcher.*
+com.mornya.lib.*
+com.mornya.lib.spring.social.naver.*
+com.morpheusdata.*
+com.morpheusdata.grails.plugins.*
+com.morscs.*
+com.mortardata.api.*
+com.mortennobel.*
+com.moscona.common.*
+com.mosesn.*
+com.moshx.*
+com.mostafagazar.*
+com.mostlycertain.*
+com.motorro.appupdatewrapper.*
+com.motorro.commonstatemachine.*
+com.motorro.keeplink.*
+com.motorro.rxlcemodel.*
+com.mottimotti.android.*
+com.mouday.*
+com.mounacheikhna.*
+com.mounacheikhna.capture.*
+com.mounacheikhna.jsongenerator.*
+com.mounacheikhna.screenshots.*
+com.mountainminds.*
+com.movableink.sdk.*
+com.moviejukebox.*
+com.movielabs.*
+com.movile.*
+com.movile.botland.*
+com.moxproxy.*
+com.moxtra.*
+com.moyasar.*
+com.moz.fiji.annotations.*
+com.moz.fiji.checkin.*
+com.moz.fiji.common.*
+com.moz.fiji.commons.*
+com.moz.fiji.delegation.*
+com.moz.fiji.deps.*
+com.moz.fiji.examples.music.*
+com.moz.fiji.examples.phonebook.*
+com.moz.fiji.express.*
+com.moz.fiji.hadoop.*
+com.moz.fiji.hive.*
+com.moz.fiji.mapreduce.*
+com.moz.fiji.mapreduce.lib.*
+com.moz.fiji.modeling.*
+com.moz.fiji.platforms.*
+com.moz.fiji.rest.*
+com.moz.fiji.schema.*
+com.moz.fiji.spark.*
+com.moz.fiji.testing.*
+com.moz.kiji.annotations.*
+com.moz.kiji.checkin.*
+com.moz.kiji.common.*
+com.moz.kiji.commons.*
+com.moz.kiji.delegation.*
+com.moz.kiji.delegation.kiji-delegation.3.0.0-SNAPSHOT.com.moz.kiji.annotations.*
+com.moz.kiji.delegation.kiji-delegation.3.0.0.com.moz.kiji.annotations.*
+com.moz.kiji.delegation.kiji-delegation.3.0.0.com.moz.kiji.checkin.*
+com.moz.kiji.delegation.kiji-delegation.3.0.0.com.moz.kiji.common.*
+com.moz.kiji.delegation.kiji-delegation.3.0.0.com.moz.kiji.commons.*
+com.moz.kiji.delegation.kiji-delegation.3.0.0.com.moz.kiji.delegation.*
+com.moz.kiji.delegation.kiji-delegation.3.0.0.com.moz.kiji.deps.*
+com.moz.kiji.delegation.kiji-delegation.3.0.0.com.moz.kiji.examples.music.*
+com.moz.kiji.delegation.kiji-delegation.3.0.0.com.moz.kiji.examples.phonebook.*
+com.moz.kiji.delegation.kiji-delegation.3.0.0.com.moz.kiji.express.*
+com.moz.kiji.delegation.kiji-delegation.3.0.0.com.moz.kiji.hadoop.*
+com.moz.kiji.delegation.kiji-delegation.3.0.0.com.moz.kiji.hive.*
+com.moz.kiji.delegation.kiji-delegation.3.0.0.com.moz.kiji.mapreduce.*
+com.moz.kiji.delegation.kiji-delegation.3.0.0.com.moz.kiji.mapreduce.lib.*
+com.moz.kiji.delegation.kiji-delegation.3.0.0.com.moz.kiji.modeling.*
+com.moz.kiji.delegation.kiji-delegation.3.0.0.com.moz.kiji.platforms.*
+com.moz.kiji.delegation.kiji-delegation.3.0.0.com.moz.kiji.rest.*
+com.moz.kiji.delegation.kiji-delegation.3.0.0.com.moz.kiji.schema.*
+com.moz.kiji.delegation.kiji-delegation.3.0.0.com.moz.kiji.solr.*
+com.moz.kiji.delegation.kiji-delegation.3.0.0.com.moz.kiji.spark.*
+com.moz.kiji.delegation.kiji-delegation.3.0.0.com.moz.kiji.testing.*
+com.moz.kiji.express.*
+com.moz.kiji.hive.*
+com.moz.kiji.mapreduce.*
+com.moz.kiji.modeling.*
+com.moz.kiji.rest.*
+com.moz.kiji.schema.*
+com.moz.kiji.solr.*
+com.moz.kiji.spark.*
+com.moz.qless.*
+com.mozafaq.*
+com.mozu.*
+com.mparticle.*
+com.mparticle.internal.*
+com.mpatric.*
+com.mpay24.payment.*
+com.mpobjects.*
+com.mpobjects.jasperreports.font.*
+com.mpobjects.maven.*
+com.mpobjects.wicket.*
+com.mrdziuban.*
+com.mricefox.androidhorizontalcalendar.*
+com.mrkaspa.*
+com.mrsalwater.*
+com.ms-square.*
+com.ms3-inc.*
+com.ms3-inc.camel.*
+com.ms3-inc.mule.*
+com.ms3-inc.tavros.*
+com.msabhi.*
+com.mscharhag.*
+com.mscharhag.oleaster.*
+com.mscharley.*
+com.mservicetech.*
+com.msignoretto.*
+com.msignoretto.sekurity.*
+com.msilb.*
+com.msiops.footing.*
+com.msiops.garage.*
+com.msiops.ground.*
+com.msiops.jaxrs.*
+com.msopentech.odatajclient.*
+com.mt-ag.tools.maven.*
+com.mtfelisb.*
+com.mthaler.*
+com.mthwate.datlib.*
+com.mtnfog.*
+com.mtnfog.cloudnlp.*
+com.mtnfog.idyl.ami.sdk.*
+com.mtnfog.idyl.cloud.sdk.*
+com.mtnfog.idyl.e3.sdk.*
+com.mtons.*
+com.mtvi.*
+com.mtvi.plateng.*
+com.mtvi.plateng.hudson.*
+com.mtvi.plateng.maven.*
+com.mtvi.plateng.subversion.*
+com.mtvnet.boxspring.*
+com.mtvnet.boxspring.modules.*
+com.mtvnet.boxspring.osgi.*
+com.muhuk.lesscss.*
+com.mulgish.*
+com.multiversx.*
+com.mumayuan.*
+com.muneebkhawaja.*
+com.munich-airport.freemarker.*
+com.mupceet.dragmultiselect.*
+com.muquit.libsodiumjna.*
+com.muscula.*
+com.musenbrock.*
+com.mustamara.android.*
+com.musurveys.*
+com.mutualmobile.*
+com.muunet.*
+com.mux.*
+com.muziyuchen.*
+com.mvffg.btwolib.*
+com.mx.*
+com.mx.path-core.*
+com.mx.path-facilities.*
+com.mx.path-mdx-model.*
+com.mxalbert.compose.*
+com.mxalbert.compose.nestedscrollfix.*
+com.mxalbert.gradle.*
+com.mxalbert.gradle.jacoco-android.*
+com.mxalbert.zoomable.*
+com.mxixm.*
+com.mxpio.*
+com.my.target.*
+com.my.target.mediation.*
+com.my.tracker.*
+com.myadsget.*
+com.mybatis-easy.*
+com.mybatis-flex.*
+com.mybatis-helper.*
+com.mycatwalk.*
+com.mycila.*
+com.mycila.com.google.inject.*
+com.mycila.com.google.inject.extensions.*
+com.mycila.guice.*
+com.mycila.guice.extensions.*
+com.mycila.maven-license-plugin.*
+com.mycila.maven.*
+com.mycila.testing.*
+com.mycila.testing.plugins.*
+com.mycila.xmltool.*
+com.mycoachsport.*
+com.mycodefu.*
+com.mydaco.*
+com.mydataharbor.*
+com.myerp.api.*
+com.myfatoorah.*
+com.mygraphql.graphub.*
+com.myjavadoc.*
+com.myjeeva.*
+com.myjeeva.digitalocean.*
+com.myjeeva.poi.*
+com.mykate-soft.*
+com.mylaesoftware.*
+com.mylitboy.lssd.*
+com.mylomen.*
+com.myodov.unicherrygarden.*
+com.myopenpass.sdk.*
+com.myperfit.sdk.transactional.*
+com.mypleaks.util.*
+com.mypoolin.*
+com.mypos.*
+com.mypos.smartsdk.*
+com.mypurecloud.*
+com.myriadmobile.*
+com.myriadmobile.library.*
+com.mysaasa.*
+com.myscript.*
+com.mysema.codegen.*
+com.mysema.commons.*
+com.mysema.contracts.*
+com.mysema.converters.*
+com.mysema.home.*
+com.mysema.l10n.*
+com.mysema.luja.*
+com.mysema.maven.*
+com.mysema.querydsl.*
+com.mysema.querydsl.contrib.*
+com.mysema.rdf.*
+com.mysema.rdfbean.*
+com.mysema.scalagen.*
+com.mysema.spring.*
+com.mysema.stat.*
+com.mysema.web.*
+com.myseotoolbox.quota4j.*
+com.mysimpatico.*
+com.mysplitter.*
+com.mysql.*
+com.mytaxi.apis.*
+com.mytaxi.core.*
+com.mytaxi.maven.plugins.*
+com.mytaxi.spring.multirabbit.*
+com.mytdev.*
+com.mytdev.flatjarszip.*
+com.mytechia.*
+com.mythosil.*
+com.mytiki.*
+com.myunidays.*
+com.mywristcoin.*
+com.myzlab.*
+com.myzlab.k-spring.*
+com.myzlab.ksearch.springboot.jbdc.*
+com.myzlab.ksearch.springboot.jdbc.*
+com.myzlab.ksearch.springboot.jpa.*
+com.mzaalo.*
+com.mzlion.*
+com.n-auth.api.*
+com.n0ize.*
+com.n1analytics.*
+com.n3twork.*
+com.n3twork.druid.*
+com.n3twork.dynamap.*
+com.n3twork.storm.*
+com.naah69.*
+com.nabenik.*
+com.nabilhachicha.*
+com.nablarch.*
+com.nablarch.archetype.*
+com.nablarch.configuration.*
+com.nablarch.dev.*
+com.nablarch.etl.*
+com.nablarch.framework.*
+com.nablarch.integration.*
+com.nablarch.profile.*
+com.nablarch.report.*
+com.nablarch.tool.*
+com.nablarch.workflow.*
+com.nabto.edge.client.*
+com.nachinius.*
+com.nagternal.*
+com.naharoo.commons.*
+com.nahuellofeudo.*
+com.najva.*
+com.nambimobile.widgets.*
+com.namehillsoftware.*
+com.namics.oss.*
+com.namics.oss.aem.*
+com.namics.oss.java.binarystore.*
+com.namics.oss.java.tools.*
+com.namics.oss.magnolia.*
+com.namics.oss.spring.convert.*
+com.namics.oss.spring.profiling.*
+com.namics.oss.spring.support.batch.*
+com.namics.oss.spring.support.configuration.*
+com.namics.oss.spring.support.i18n.*
+com.namics.oss.spring.support.jpa.*
+com.namics.oss.spring.support.logging.*
+com.namics.oss.spring.support.terrific.*
+com.namomedia.android.*
+com.namshi.cardinput.*
+com.namshi.swipemenu.*
+com.namsor.*
+com.nandbox.bots.api.*
+com.nannoq.*
+com.nanohttpd.*
+com.nanosai.*
+com.nanoxic.*
+com.nappin.*
+com.nappingcoder.*
+com.narbase.*
+com.narbase.kunafa.*
+com.narbase.narpc.*
+com.narmnevis.range.*
+com.narupley.*
+com.naspat.*
+com.nasuyun.*
+com.nathanaelrota.cmmi.maven.requirements.*
+com.nathanmyles.*
+com.natigbabayev.checkpoint.*
+com.nativelibs4java.*
+com.natpryce.*
+com.natpryce.hamcrest.*
+com.naturalprogrammer.*
+com.naturalprogrammer.cleanflow.*
+com.naturalprogrammer.spring-lemon.*
+com.naukri.*
+com.naurt.sdk.*
+com.navegg.android.*
+com.navelplace.*
+com.naver.ads.*
+com.naver.android.*
+com.naver.android.helloyako.*
+com.naver.android.svc.*
+com.naver.gfpsdk.*
+com.naver.spring.batch.*
+com.navercorp.*
+com.navercorp.arcus.*
+com.navercorp.eventeria.*
+com.navercorp.eventeria.snapshot.*
+com.navercorp.fixturemonkey.*
+com.navercorp.fixturemonkey.snapshot.*
+com.navercorp.lucy.*
+com.navercorp.nid.*
+com.navercorp.ntracker.*
+com.navercorp.pinpoint.*
+com.navercorp.pulltorefresh.*
+com.navercorp.scavenger.*
+com.navercorp.spring.*
+com.navercorp.volleyextensions.*
+com.navigamez.*
+com.navisens.*
+com.navnorth.learningregistry.*
+com.naytev.*
+com.nb6868.onex.*
+com.nbcio.*
+com.nbottarini.*
+com.nbsaas.*
+com.nbsaas.boot.*
+com.nbsaas.codegen.*
+com.nbsaas.discovery.*
+com.nbsaas.lbsyun.*
+com.nbsp.*
+com.ncona.*
+com.ncorti.*
+com.ncredinburgh.*
+com.ncryptify.*
+com.ndabooking.*
+com.nealk.*
+com.nealk.concurrent.*
+com.neaos.*
+com.nearbuy.interceptor.*
+com.nearform.*
+com.nearsoft.*
+com.nebhale.bindings.*
+com.nebhale.jsonpath.*
+com.nebula.gradle.*
+com.nebula2d.*
+com.nec.baas.*
+com.nec.baas.cloudfn.sdk.*
+com.nec.baas.sdk.*
+com.nec.baas.ssepush.*
+com.nec.webotx.*
+com.nectia.*
+com.nectify.*
+com.nedap.healthcare.*
+com.nedap.healthcare.archie.*
+com.nedap.retail.services.*
+com.needhamsoftware.*
+com.needhamsoftware.unojar.*
+com.neenbedankt.bundles.*
+com.neenbedankt.gradle.plugins.*
+com.nefariouszhen.alert.*
+com.nefariouszhen.dropwizard.*
+com.nefariouszhen.trie.*
+com.negusoft.holoaccent.*
+com.neighbwang.gradle.*
+com.neko233.*
+com.nekomatic.*
+com.nelkinda.japi.*
+com.nemrod-software.*
+com.neoniou.*
+com.neotys.*
+com.neotys.ascode.*
+com.neotys.neoload.*
+com.neovisionaries.*
+com.nepaliapps.*
+com.nepxion.*
+com.nequi.*
+com.nequissimus.*
+com.nerderg.ajaxanywhere.*
+com.nerdforge.*
+com.nerdvision.*
+com.nerdvision.test.*
+com.nerdynick.*
+com.nervepoint.*
+com.nervousync.*
+com.nesscomputing.*
+com.nesscomputing.components.*
+com.nesscomputing.instagram.*
+com.nesscomputing.migratory.*
+com.nesscomputing.mojo.*
+com.nesscomputing.service.activemq.*
+com.nesscomputing.service.discovery.*
+com.nesscomputing.testing.*
+com.net128.oss.web.*
+com.net128.oss.web.app.*
+com.net128.oss.web.application.*
+com.net128.oss.web.lib.*
+com.netaporter.*
+com.netaporter.gatling.*
+com.netaporter.salad.*
+com.netapp.santricity.*
+com.netbase.*
+com.netbout.*
+com.netbout.helpers.*
+com.netbout.spi.*
+com.netcetera.girders.*
+com.netcetera.girders.demos.*
+com.netcetera.trema.*
+com.netcrest.pado.*
+com.netease.*
+com.netease.arctic.*
+com.netease.cloud.*
+com.netease.cloudmusic.gamesdk.*
+com.netease.cloudmusic.iotsdk.*
+com.netease.cloudmusic.iotsdk.sdkbase.*
+com.netease.cloudmusic.mediacontrollersdk.*
+com.netease.cloudmusic.opensdk.*
+com.netease.marvel.*
+com.netease.meeting.*
+com.netease.mobsec.grow.*
+com.netease.nim.*
+com.netease.nimlib.*
+com.netease.nimlib.flutter.*
+com.netease.nimlib.yach.*
+com.netease.stream.*
+com.netease.yidun.*
+com.netease.yunxin.*
+com.netease.yunxin.artemis.*
+com.netease.yunxin.kit.*
+com.netease.yunxin.kit.audioeffect.*
+com.netease.yunxin.kit.auth.*
+com.netease.yunxin.kit.call.*
+com.netease.yunxin.kit.chat.*
+com.netease.yunxin.kit.common.*
+com.netease.yunxin.kit.contact.*
+com.netease.yunxin.kit.conversation.*
+com.netease.yunxin.kit.copyrightedmedia.*
+com.netease.yunxin.kit.core.*
+com.netease.yunxin.kit.hawk.*
+com.netease.yunxin.kit.integrationtest.*
+com.netease.yunxin.kit.karaoke.*
+com.netease.yunxin.kit.listentogether.*
+com.netease.yunxin.kit.live.*
+com.netease.yunxin.kit.locationkit.*
+com.netease.yunxin.kit.lyric.*
+com.netease.yunxin.kit.meeting.*
+com.netease.yunxin.kit.qchat.*
+com.netease.yunxin.kit.room.*
+com.netease.yunxin.kit.roomkit.*
+com.netease.yunxin.kit.search.*
+com.netease.yunxin.kit.smslogin.*
+com.netease.yunxin.kit.team.*
+com.netease.yunxin.kit.voiceroom.*
+com.netemera.*
+com.netflix.*
+com.netflix.Nicobar.*
+com.netflix.amazoncomponents.*
+com.netflix.archaius.*
+com.netflix.astyanax.*
+com.netflix.atlas.*
+com.netflix.atlas_v1.*
+com.netflix.awsobjectmapper.*
+com.netflix.blitz4j.*
+com.netflix.buildinfrastructure.*
+com.netflix.concurrency-limits.*
+com.netflix.conductor.*
+com.netflix.curator.*
+com.netflix.denominator.*
+com.netflix.devinsight.*
+com.netflix.devinsight.rewrite.*
+com.netflix.dyno-queues.*
+com.netflix.dyno.*
+com.netflix.dynomite-manager.*
+com.netflix.dynomitemanager.*
+com.netflix.edda-client.*
+com.netflix.eureka.*
+com.netflix.eureka2.*
+com.netflix.evcache.*
+com.netflix.exhibitor.*
+com.netflix.fabricator.*
+com.netflix.falcor.*
+com.netflix.feign.*
+com.netflix.fenzo.*
+com.netflix.frigga.*
+com.netflix.genie.*
+com.netflix.glisten.*
+com.netflix.governator.*
+com.netflix.graphql.dgs.*
+com.netflix.graphql.dgs.codegen.*
+com.netflix.hollow.*
+com.netflix.hystrix.*
+com.netflix.iep-apps.*
+com.netflix.iep-shadow.*
+com.netflix.iep.*
+com.netflix.karyon.*
+com.netflix.karyon2.*
+com.netflix.lipstick.*
+com.netflix.metacat.*
+com.netflix.msl.*
+com.netflix.ndbench.*
+com.netflix.nebula.*
+com.netflix.nebula.core.*
+com.netflix.netflix-commons.*
+com.netflix.netflixoss.derand.*
+com.netflix.netflixoss.test.*
+com.netflix.netflixoss.test.travisci.*
+com.netflix.nfgraph.*
+com.netflix.numerus.*
+com.netflix.ocelli.*
+com.netflix.oss.tools.*
+com.netflix.photon.*
+com.netflix.pigpen.*
+com.netflix.priam-cass-extensions.*
+com.netflix.priam-web.*
+com.netflix.priam.*
+com.netflix.pytheas.*
+com.netflix.raigad.*
+com.netflix.ribbon.*
+com.netflix.runtime.*
+com.netflix.rx-aws-java-sdk.*
+com.netflix.rxjava.*
+com.netflix.rxnetty.*
+com.netflix.schlep.*
+com.netflix.search.*
+com.netflix.servo.*
+com.netflix.spectator.*
+com.netflix.suro.*
+com.netflix.temporary.*
+com.netflix.temporary.tests.*
+com.netflix.titus.*
+com.netflix.turbine.*
+com.netflix.zeno.*
+com.netflix.zuul.*
+com.netgrif.*
+com.netguru.multiplatform-charts.*
+com.netifi.*
+com.netiq.*
+com.netistrar.*
+com.netki.*
+com.netmera.mobile.*
+com.netopyr.caj.*
+com.netopyr.coffee4java.*
+com.netopyr.reduxfx.*
+com.netopyr.wurmloch.*
+com.netradius.*
+com.netsensia.rivalchess.*
+com.netshoes.*
+com.nettoolkit.*
+com.netuitive.*
+com.networkbench.*
+com.networkbench.newlens.agent.android.*
+com.networkedassets.*
+com.networknt.*
+com.netzarchitekten.*
+com.neumob.*
+com.neuronrobotics.*
+com.neuvector.*
+com.neverbounce.*
+com.nevermindsoft.*
+com.neverpile.*
+com.newbuck.*
+com.newcircle.*
+com.newcubator.*
+com.newegg.marketplace.*
+com.newmainsoftech.*
+com.newmainsoftech.eatestutil.*
+com.newmainsoftech.eatestutil.containerconfig.*
+com.newmainsoftech.spray.*
+com.newmediaworks.*
+com.newmotion.*
+com.newpathfly.*
+com.newpixelcoffee.odin.*
+com.newrelic.*
+com.newrelic.agent.android.*
+com.newrelic.agent.extension.*
+com.newrelic.agent.java.*
+com.newrelic.agent.java.security.*
+com.newrelic.experts.*
+com.newrelic.gradle-compatibility-doc-plugin.*
+com.newrelic.gradle-verify-instrumentation-plugin.*
+com.newrelic.graphql.*
+com.newrelic.logging.*
+com.newrelic.opentracing.*
+com.newrelic.telemetry.*
+com.newscores.*
+com.newtranx.*
+com.newzly.*
+com.nex3z.*
+com.nexirius.*
+com.nexitia.emaginplatform.*
+com.nexl-js.spring.*
+com.nexmo.*
+com.nexmo.android.*
+com.nexocode.*
+com.nexosis.*
+com.nextapp.*
+com.nextbreakpoint.*
+com.nextcaller.integration-java.*
+com.nextdoor.rollbar.*
+com.nexteraanalytics.r.*
+com.nextfaze.*
+com.nextfaze.poweradapters.*
+com.nextfaze.powerdata.*
+com.nextgearcapital.*
+com.nexthink.*
+com.nextpls.*
+com.nextspace.*
+com.nexusy.*
+com.nfbsoftware.*
+com.nfeld.jsonpathkt.*
+com.nfeld.jsonpathlite.*
+com.nfl.glitr.*
+com.nfl.graphql.*
+com.nflabs.*
+com.nflabs.zeppelin.*
+com.nfsdb.*
+com.nftco.*
+com.ngarihealth.*
+com.nginflow.*
+com.ngrok.*
+com.nhaarman.*
+com.nhaarman.acorn.*
+com.nhaarman.acorn.ext.*
+com.nhaarman.daggerutils.*
+com.nhaarman.dothi.*
+com.nhaarman.ellie.*
+com.nhaarman.ergo.*
+com.nhaarman.failfast.*
+com.nhaarman.listviewanimations.*
+com.nhaarman.mockitokotlin2.*
+com.nhaarman.supertooltips.*
+com.nhl.bootique.*
+com.nhl.bootique.bom.*
+com.nhl.bootique.cayenne.*
+com.nhl.bootique.curator.*
+com.nhl.bootique.jdbc.*
+com.nhl.bootique.jersey.*
+com.nhl.bootique.jersey.client.*
+com.nhl.bootique.jetty.*
+com.nhl.bootique.job.*
+com.nhl.bootique.linkmove.*
+com.nhl.bootique.linkrest.*
+com.nhl.bootique.liquibase.*
+com.nhl.bootique.logback.*
+com.nhl.bootique.metrics.*
+com.nhl.bootique.mvc.*
+com.nhl.bootique.parent.*
+com.nhl.bootique.tapestry.*
+com.nhl.bootique.zookeeper.*
+com.nhl.dflib.*
+com.nhl.link.move.*
+com.nhl.link.rest.*
+com.nhn.gameanvil.*
+com.nhncloud.android.*
+com.nhncorp.jumble.*
+com.nhncorp.ntaf.*
+com.nhnextsoft.*
+com.nia-medtech.oss.*
+com.nianqing.bus.*
+com.nicepeopleatwork.*
+com.nicewuerfel.*
+com.nicholasding.*
+com.nicholasnassar.dslbuilder.*
+com.nicholaspaulsmith.*
+com.nickdsantos.*
+com.nickhudkins.*
+com.nicknackdevelopment.*
+com.nickrobison.*
+com.nickwongdev.*
+com.nickww.*
+com.nicolaswinsten.*
+com.nicopaez.collections.*
+com.nicopaez.javaobjects.*
+com.nicopolyptic.*
+com.nicostratus.*
+com.nicta.*
+com.nierjia.*
+com.nierjia.flowable.*
+com.niezhiliang.*
+com.niezhiliang.common.utils.*
+com.niezhiliang.easy.pay.*
+com.niezhiliang.signature.utils.*
+com.nifcloud.mbaas.*
+com.nightlynexus.demomode.*
+com.nightlynexus.diskcrashreporter.*
+com.nightlynexus.handlercalladapterfactory.*
+com.nightlynexus.logging-retrofit.*
+com.nightlynexus.retryable-retrofit.*
+com.nightlynexus.viewstatepageradapter.*
+com.nightonke.*
+com.nike.backstopper.*
+com.nike.fastbreak.*
+com.nike.fawcett.*
+com.nike.fleam.*
+com.nike.internal.*
+com.nike.moirai.*
+com.nike.riposte.*
+com.nike.wingtips.*
+com.nikedlab.*
+com.nikhaldimann.*
+com.nikhilpanju.*
+com.nikialeksey.*
+com.niklasarndt.*
+com.nikodoko.javapackagetest.*
+com.nikoer.*
+com.nikoyuwono.*
+com.nikpappas.utils.*
+com.nikvanderhoof.*
+com.nilcaream.atto.*
+com.nilcaream.utilargs.*
+com.niloen.spring.data.*
+com.nimbits.*
+com.nimblygames.gradle.*
+com.nimblygames.packr.*
+com.nimblygames.steam.*
+com.nimbusds.*
+com.nimbusframework.*
+com.nimroddayan.buildmetrics.*
+com.nimworks.*
+com.nineoldandroids.*
+com.nineya.cspeed.*
+com.nineya.slog.*
+com.nineya.tool.*
+com.ning.*
+com.ning.arecibo.*
+com.ning.billing.*
+com.ning.billing.commons.*
+com.ning.billing.plugin.*
+com.ning.jaxrs.*
+com.ning.jdbi.*
+com.ning.jetty.*
+com.ning.killbill.*
+com.ning.killbill.ruby.*
+com.ning.maven.plugins.*
+com.ninja-beans.crawler.*
+com.ninja-squad.*
+com.ninjamodding.*
+com.nirima.*
+com.nirima.jdocker.*
+com.nirima.jlibvirt.*
+com.nirima.ribbons.*
+com.nirmata.workflow.*
+com.nispok.*
+com.nitayjoffe.thirdparty.com.jointhegrid.*
+com.nitayjoffe.thirdparty.com.snowplowanalytics.*
+com.nitayjoffe.thirdparty.me.lessis.*
+com.nitayjoffe.thirdparty.net.robowiki.knn.*
+com.nitayjoffe.thirdparty.org.ggp.*
+com.nitayjoffe.thirdparty.org.j3d.*
+com.nitayjoffe.thirdparty.yourkit-api.*
+com.nitayjoffe.util.*
+com.nithind.automium.*
+com.nitindhar.*
+com.nitorcreations.*
+com.nitorcreations.testing.*
+com.nivekaa.*
+com.nixend.*
+com.nixsolutions.*
+com.nixxcode.jvmbrotli.*
+com.njdys.*
+com.nkutsche.*
+com.nl2go.*
+com.nlgtuankiet.elject.*
+com.nllsdfx.*
+com.nlocketz.*
+com.nlocketz.parent.*
+com.nlocketz.plugins.*
+com.nmgolden.*
+com.nmgolden.appbox.*
+com.nmote.epp.*
+com.nmote.iim4j.*
+com.nmote.jetty.*
+com.nmote.oembed.*
+com.nmote.smpp.*
+com.nmote.xr.*
+com.noahsloan.atg.*
+com.nobigsoftware.*
+com.nobrain.gradle.*
+com.nocandysw.*
+com.noctarius.borabora.*
+com.noctarius.bz2java.*
+com.noctarius.castmapr.*
+com.noctarius.discovery.*
+com.noctarius.snowcast.*
+com.nodemessage.*
+com.nodemessage.jooby.*
+com.noelherrick.*
+com.noelherrick.jell.*
+com.noenv.*
+com.nofacepress.*
+com.noheltcj.*
+com.noheltcj.zinc.*
+com.noheltcj.zinc.gradle-plugin.*
+com.nohrd.bike.*
+com.noke.nokemobilelibrary.*
+com.nokia.*
+com.nolanlawson.*
+com.noleme.*
+com.nomad5.*
+com.nomad5.log.*
+com.nomalab.*
+com.nomendi6.*
+com.nominanuda.*
+com.nomorepass.*
+com.nononsenseapps.*
+com.nononsenseapps.wanikani.*
+com.nonzeroapps.whatisnewdialog.*
+com.noodlesandwich.*
+com.noorq.casser.*
+com.norbitltd.*
+com.norbsoft.typefacehelper.*
+com.norconex.collectors.*
+com.norconex.commons.*
+com.norconex.jef.*
+com.norconex.language.*
+com.nordea.oss.*
+com.nordija.tapestry.bayeux.*
+com.nordstrom.tools.*
+com.nordstrom.ui-tools.*
+com.nordstrom.xrpc.*
+com.norswap.*
+com.nortal.banklink.*
+com.nortal.jroad.*
+com.nortal.jroad.starter.*
+com.nortal.test.*
+com.northdata.*
+com.northdata.api.*
+com.northdata.client.*
+com.northdata.jhyphenator.*
+com.northdata.jung.*
+com.northdata.schema.*
+com.northernwall.*
+com.northstrat.*
+com.nosixtools.*
+com.nosolojava.fsm.*
+com.nostra13.universalimageloader.*
+com.nosuchfield.*
+com.nothome.*
+com.notifiermobile.*
+com.notifyvisitors.notifyvisitors.*
+com.notifyvisitors.twa.*
+com.notikumi.*
+com.notkamui.libs.*
+com.notmu.*
+com.notnoop.apns.*
+com.notronix.*
+com.notuvy.*
+com.nouveauxterritoires.maven.*
+com.nouveauxterritoires.services.*
+com.novaquark.*
+com.novartis.opensource.*
+com.novell.ldap.*
+com.noveogroup.*
+com.noveogroup.android.*
+com.noveria.assertion.*
+com.novetta.*
+com.novocode.*
+com.novoda.*
+com.novoda.imageloader.*
+com.novus.*
+com.nowellpoint.*
+com.noxwizard.*
+com.npsvip.*
+com.nqadmin.rowset.*
+com.nqadmin.swingset.*
+com.nqzero.*
+com.nrinaudo.*
+com.nrmitchi.plugin.*
+com.nryanov.consul4s.*
+com.nryanov.feature4s.*
+com.nryanov.genkai.*
+com.nryanov.neo4s.*
+com.nryanov.schemakeeper.*
+com.nryanov.tarantool.*
+com.nryanov.zio-tarantool.*
+com.ns-developer.*
+com.nsoft.chiwava.*
+com.nsxwing.common.*
+com.ntechniks.nstudios.*
+com.ntgeg.plugins.*
+com.nthdimenzion.*
+com.nthportal.*
+com.ntrack.audioroute.*
+com.nu-art-software.*
+com.nu-art-software.cyborg.*
+com.nuecho.*
+com.nugraviton.chao.*
+com.nulab-inc.*
+com.nullables.*
+com.nullprogram.*
+com.numdata.*
+com.nummulus.*
+com.nummulus.amqp.driver.*
+com.numsg.*
+com.nuodb.hibernate.*
+com.nuodb.jdbc.*
+com.nuonuo.*
+com.nurego.*
+com.nurkiewicz.asyncretry.*
+com.nurkiewicz.jdbcrepository.*
+com.nurkiewicz.lazyseq.*
+com.nurkiewicz.typeof.*
+com.nutanix.api.*
+com.nutanix.example.*
+com.nvanbenschoten.motion.*
+com.nventify.*
+com.nventify.imagizerandroid.*
+com.nvidia.*
+com.nwagu.chess.*
+com.nwagu.forms.*
+com.nwalsh.*
+com.nwklz.*
+com.nxcloud.*
+com.nxcloud.nxphone.*
+com.nxest.grapes.*
+com.nxest.grpc.*
+com.nycjv321.*
+com.nylas.sdk.*
+com.nytimes.android.*
+com.o19s.*
+com.oakfusion.*
+com.oaleft.snow.*
+com.oanda.v20.*
+com.oasisfeng.condom.*
+com.oasisworkflowdemo.*
+com.oath.cyclops.*
+com.oath.microservices.*
+com.obatis.*
+com.obdobion.*
+com.oberasoftware.*
+com.obigo.viscuit.*
+com.obiscr.*
+com.object-refinery.*
+com.object0r.*
+com.object0r.TorRange.*
+com.object0r.monitor.tools.*
+com.object0r.scanners.*
+com.object0r.toortools.*
+com.object0r.toortools.http.*
+com.objectia.*
+com.objectsql.*
+com.oblac.*
+com.oblac.mapstruct.*
+com.obsez.android.lib.filechooser.*
+com.obsidiandynamics.blackstrom.*
+com.obsidiandynamics.fulcrum.*
+com.obsidiandynamics.indigo.*
+com.obsidiandynamics.jackdaw.*
+com.obsidiandynamics.meteor.*
+com.obsidiandynamics.pojotester.*
+com.obsidiandynamics.transram.*
+com.obsidiandynamics.yconf.*
+com.obsidiandynamics.zerolog.*
+com.ocadotechnology.*
+com.ocadotechnology.gembus.*
+com.ocadotechnology.newrelicalertsconfigurator.*
+com.ocarlsen.logging.*
+com.ocarlsen.logging.http.*
+com.ocarlsen.test.*
+com.oceanbase.*
+com.oceanbase.logclient.*
+com.oceanbase.logproxy.client.*
+com.oceanprotocol.*
+com.ochumak.*
+com.ocient.*
+com.ociweb.*
+com.ociweb.jpgRaster.*
+com.ocpsoft.*
+com.ocpsoft.common.*
+com.ocpsoft.forge.*
+com.ocpsoft.logging.*
+com.ocpsoft.rewrite.*
+com.ocrsdk.abbyy.*
+com.octagonsoftware.*
+com.octo.android.robodemo.*
+com.octo.android.robospice.*
+com.octo.avro.*
+com.octo.captcha.*
+com.octo.java-sql-dsl.*
+com.octo.mtg.*
+com.octo.reactive.audit.*
+com.octomix.josson.*
+com.octopepper.*
+com.octopepper.promiser.*
+com.octopus.*
+com.oculow.*
+com.odinliu.util.*
+com.ofcoder.klein.*
+com.ofcoder.klein.common.*
+com.ofcoder.klein.consensus.*
+com.ofcoder.klein.consensus.facade.*
+com.ofcoder.klein.consensus.paxos.*
+com.ofcoder.klein.core.*
+com.ofcoder.klein.example.*
+com.ofcoder.klein.jepsen.*
+com.ofcoder.klein.jepsen.server.*
+com.ofcoder.klein.rpc.*
+com.ofcoder.klein.rpc.facade.*
+com.ofcoder.klein.rpc.grpc.*
+com.ofcoder.klein.spi.*
+com.ofcoder.klein.storage.*
+com.ofcoder.klein.storage.api.*
+com.ofcoder.klein.storage.file.*
+com.ofcoder.klein.storage.h2.*
+com.offbynull.coroutines.*
+com.offbynull.portmapper.*
+com.offbytwo.*
+com.offbytwo.class-finder.*
+com.offbytwo.datatables.*
+com.offbytwo.iclojure.*
+com.offbytwo.jenkins.*
+com.offbytwo.jooq.*
+com.offbytwo.jsp.*
+com.offbytwo.keyczar.*
+com.offbytwo.maven.plugins.*
+com.offbytwo.ulid.*
+com.offerready.*
+com.ofpay.*
+com.ofwiki.*
+com.ogaclejapan.*
+com.ogaclejapan.arclayout.*
+com.ogaclejapan.smarttablayout.*
+com.ogaclejapan.textprogressbar.*
+com.oginotihiro.*
+com.oglowo.*
+com.oguzbabaoglu.*
+com.oguzdev.*
+com.ohadr.*
+com.ohadr.oauth2.*
+com.ohgnarly.*
+com.ohmdb.*
+com.oiwhale.*
+com.ojhdt.*
+com.okdetect.okd.*
+com.okhoxi.common.*
+com.okracode.qconfig.*
+com.okracode.wx.*
+com.okta.*
+com.okta.android.*
+com.okta.authn.sdk.*
+com.okta.cli.*
+com.okta.commons.*
+com.okta.devices.*
+com.okta.hooks.sdk.*
+com.okta.idx.sdk.*
+com.okta.jwt.*
+com.okta.jwt.examples.*
+com.okta.kotlin.*
+com.okta.oidc.tck.*
+com.okta.sdk.*
+com.okta.shiro.*
+com.okta.spring.*
+com.okta.spring.examples.*
+com.okumin.*
+com.okworx.ilcd.*
+com.okworx.ilcd.validation.*
+com.okworx.ilcd.validation.profiles.*
+com.olapdb.*
+com.oldnoop.*
+com.olegpy.*
+com.olekdia.*
+com.olekdia.material-dialog.*
+com.oliphantllc.*
+com.oliverspryn.android.*
+com.oliverspryn.library.*
+com.oliveryasuna.*
+com.oliveryasuna.beanbag.*
+com.oliveryasuna.commons.*
+com.oliveryasuna.fluent-flow-2.*
+com.oliveryasuna.vaadin.*
+com.olo.olopay.*
+com.olvind.*
+com.olvind.st-material-ui.*
+com.olvind.tui.*
+com.olvind.typo.*
+com.omahaprogrammer.crypto.*
+com.omarassadi.*
+com.omarsmak.kafka.*
+com.omegaup.*
+com.omertron.*
+com.ometria.*
+com.omg-m.speedy.eps.*
+com.omnibaker.*
+com.omnibaker.libgroup.*
+com.omnipasteapp.droidbugfreak.*
+com.omnisci.*
+com.omniwyse.*
+com.omrispector.*
+com.omvoid.*
+com.ondeck.datapipes.*
+com.ondevio.*
+com.one4pay.*
+com.oneall.*
+com.oneandone.*
+com.oneapm.*
+com.oneapm.agent.android.*
+com.onecampus.*
+com.onedsol.tools.*
+com.oneeyedmen.*
+com.onegevity.*
+com.onegini.*
+com.oneidentity.safeguard.*
+com.onelogin.*
+com.onemillionworlds.*
+com.oneops.*
+com.oneops.boo.*
+com.oneops.client.*
+com.oneops.maven.plugins.*
+com.onepointsixtwo.*
+com.onesignal.*
+com.oneskyapp.*
+com.onespan.integration.*
+com.onetimesecret.*
+com.onetrust.cmp.*
+com.onetrust.mobile.*
+com.onevizion.*
+com.onfido.*
+com.onfido.api.client.*
+com.onfido.sdk.*
+com.onfido.sdk.capture.*
+com.onfleet.*
+com.ongres.*
+com.ongres.pgconfig.*
+com.ongres.scram.*
+com.ongres.stringprep.*
+com.onkiup.*
+com.onliquid.*
+com.onloupe.*
+com.onlyxiahui.app.*
+com.onlyxiahui.common.*
+com.onlyxiahui.extend.*
+com.onlyxiahui.framework.*
+com.onlyxiahui.general.*
+com.onnuridmc.*
+com.onnuridmc.exelbid.*
+com.onnuridmc.motivi.*
+com.onpositive.aml.*
+com.onslip.*
+com.onsmsc.*
+com.onthegomap.planetiler.*
+com.ontimize.*
+com.ontimize.boot.*
+com.ontimize.jee.*
+com.ontimize.jee.dms.*
+com.ontimize.jee.report.*
+com.ontimize.jee.sdms.*
+com.ontology2.*
+com.ontotext.graphdb.*
+com.ontotext.s4.*
+com.onyxdevtools.*
+com.oohlalog.*
+com.ooimi.*
+com.ooimi.library.*
+com.oopsguy.kaptcha.*
+com.oozol.*
+com.opayweb.*
+com.opcooc.*
+com.opdar.gulosity.*
+com.opdar.mote.*
+com.opdar.platform.*
+com.opdar.plugins.*
+com.open-lab.*
+com.openaddr.*
+com.opencagedata.*
+com.opencastsoftware.*
+com.opencastsoftware.gradle.*
+com.opencastsoftware.gradle.buildinfo.*
+com.opencastsoftware.gradle.java-conventions.*
+com.opencloud.*
+com.opencredo.*
+com.opencsv.*
+com.opendatagroup.*
+com.opendxl.*
+com.openfaas.*
+com.opengamma.*
+com.opengamma.sdk.*
+com.opengamma.strata.*
+com.openhtmltopdf.*
+com.openjad.*
+com.openjad.common.*
+com.openjad.devtools.*
+com.openjad.logger.*
+com.openjad.orm.*
+com.openjad.test.*
+com.openlinksw.*
+com.openmindlab.*
+com.openmobilehub.android.*
+com.openmoka.*
+com.openmoka.android.*
+com.opennewway.*
+com.openpojo.*
+com.opensearchserver.*
+com.openshift.*
+com.openshift.express.*
+com.opensudoku.bible.*
+com.opensudoku.go.*
+com.opensudoku.puzzle.*
+com.opensudoku.setgame.*
+com.opensudoku.sudoku.*
+com.opensymphony.*
+com.opentable.*
+com.opentable.components.*
+com.opentable.fork.segmentio.*
+com.opentable.hobknob.*
+com.opentable.testing.*
+com.opentangerine.*
+com.opentext.ia.*
+com.opentext.otag.sdk.*
+com.opentext.otag.sdk.bus.*
+com.opentext.otag.service.context.*
+com.opentext.otag.tomcat.*
+com.openthinks.*
+com.openthinks.libs.*
+com.openthinks.others.*
+com.opentok.android.*
+com.opentok.api.*
+com.openturo.nibel.*
+com.openvehicletracking.*
+com.openvehicletracking.device.*
+com.openviewtech.evidence.*
+com.openwjk.*
+com.openxcplatform.*
+com.openyelp.*
+com.opera.*
+com.opitzconsulting.orcas.*
+com.opkloud.*
+com.opkloud.kloudprints.*
+com.oplus.*
+com.oplus.card.widget.*
+com.oplus.instant.*
+com.oplus.ocs.*
+com.oplus.smartengine.*
+com.opnitech.rules.*
+com.opnworks.maven.*
+com.opnx.api.*
+com.opower.*
+com.opower.hadoop.elephant-plug.*
+com.opsbears.webcomponents.*
+com.opsbears.webcomponents.application.*
+com.opsbears.webcomponents.application.dic.*
+com.opsbears.webcomponents.application.net.http.*
+com.opsbears.webcomponents.application.net.http.dispatcher.*
+com.opsbears.webcomponents.application.net.http.rest.*
+com.opsbears.webcomponents.application.net.http.routing.*
+com.opsbears.webcomponents.application.slf4j.*
+com.opsbears.webcomponents.application.webserver.*
+com.opsbears.webcomponents.dic.*
+com.opsbears.webcomponents.net.*
+com.opsbears.webcomponents.net.http.*
+com.opsbears.webcomponents.net.http.dispatcher.*
+com.opsbears.webcomponents.net.http.rest.*
+com.opsbears.webcomponents.net.http.routing.*
+com.opsbears.webcomponents.stack.*
+com.opsbears.webcomponents.typeconverter.*
+com.opsbears.webcomponents.webserver.*
+com.opsbears.webcomponents.webserver.x509.*
+com.opsdatastore.*
+com.opsgenie.*
+com.opsgenie.client.*
+com.opsgenie.integration.*
+com.opsgenie.oas.*
+com.opsgenie.sirocco.*
+com.opsgenie.thundra.*
+com.opsgenie.tools.*
+com.opsmatters.*
+com.opswat.*
+com.optersoft.*
+com.optimaize.anythingworks.*
+com.optimaize.anythingworks.client.*
+com.optimaize.anythingworks.client.common.*
+com.optimaize.anythingworks.client.rest.*
+com.optimaize.anythingworks.client.soap.*
+com.optimaize.anythingworks.common.*
+com.optimaize.anythingworks.exampleproject.*
+com.optimaize.anythingworks.exampleproject.clientapp.*
+com.optimaize.anythingworks.exampleproject.clientlib.*
+com.optimaize.anythingworks.exampleproject.ontology.*
+com.optimaize.anythingworks.exampleproject.server.*
+com.optimaize.anythingworks.server.*
+com.optimaize.anythingworks.server.api.*
+com.optimaize.anythingworks.server.implcommon.*
+com.optimaize.anythingworks.server.implgrizzly.*
+com.optimaize.anythingworks.server.impljdk.*
+com.optimaize.command4j.*
+com.optimaize.hostrules4j.*
+com.optimaize.languagedetector.*
+com.optimaize.soapworks.*
+com.optimaize.soapworks.client.*
+com.optimaize.soapworks.common.*
+com.optimaize.soapworks.exampleproject.*
+com.optimaize.soapworks.exampleproject.clientapp.*
+com.optimaize.soapworks.exampleproject.clientlib.*
+com.optimaize.soapworks.exampleproject.server.*
+com.optimaize.soapworks.server.*
+com.optimaize.soapworks.server.api.*
+com.optimaize.soapworks.server.implcommon.*
+com.optimaize.soapworks.server.implgrizzly.*
+com.optimaize.soapworks.server.impljdk.*
+com.optimaize.webcrawlerverifier.*
+com.optimalbi.*
+com.optimetriks.unio.compose.*
+com.optimizely.ab.*
+com.optimove.android.*
+com.optimove.sdk.*
+com.optoutadvertising.*
+com.optum.sourcehawk.*
+com.optum.sourcehawk.maven.*
+com.opuscapita.peppol.*
+com.oracle.*
+com.oracle.apm.agent.java.*
+com.oracle.bedrock.*
+com.oracle.bedrock.coherence.*
+com.oracle.cdi-enabler.*
+com.oracle.cloud.caching.*
+com.oracle.cloud.spring.*
+com.oracle.coherence.*
+com.oracle.coherence.ce.*
+com.oracle.coherence.hibernate.*
+com.oracle.coherence.incubator.*
+com.oracle.coherence.kafka.*
+com.oracle.coherence.kafka.connect.*
+com.oracle.coherence.moditect.*
+com.oracle.coherence.spring.*
+com.oracle.database.graph.*
+com.oracle.database.ha.*
+com.oracle.database.jdbc.*
+com.oracle.database.jdbc.debug.*
+com.oracle.database.messaging.*
+com.oracle.database.nls.*
+com.oracle.database.observability.*
+com.oracle.database.r2dbc.*
+com.oracle.database.security.*
+com.oracle.database.soda.*
+com.oracle.database.spring.*
+com.oracle.database.xml.*
+com.oracle.graal-js.*
+com.oracle.ips.*
+com.oracle.kv.*
+com.oracle.labs.olcut.*
+com.oracle.leveldbjni.*
+com.oracle.nosql.sdk.*
+com.oracle.oci.sdk.*
+com.oracle.ojdbc.*
+com.oracle.ozark.*
+com.oracle.ozark.ext.*
+com.oracle.ozark.test.*
+com.oracle.substratevm.*
+com.oracle.tools.*
+com.oracle.toplink.*
+com.oracle.truffle.*
+com.oradian.infra.*
+com.oradian.util.*
+com.oraen.oxygen.*
+com.orange.android.activitylifecycle.*
+com.orange.ccmd.*
+com.orange.cepheus.*
+com.orange.dgil.trail.*
+com.orange.fiware.*
+com.orange.labs.quickpass.*
+com.orange.labs.quickpass.tm.*
+com.orange.ods.android.*
+com.orange.redis-embedded.*
+com.orange.redis-protocol.*
+com.orange.webcom.*
+com.orange.wro4j.*
+com.orangeandbronze.*
+com.orangereading.*
+com.orangesignal.*
+com.orangevolt.*
+com.oratakashi.*
+com.orbaone.*
+com.orbitalhq.*
+com.orbitasolutions.*
+com.orbitasolutions.geleia.*
+com.orbitz.consul.*
+com.orbitz.erma.*
+com.orctom.*
+com.orctom.laputa.*
+com.orctom.mojo.*
+com.orctom.was.*
+com.oregor.*
+com.oregor.ddd4j.*
+com.oregor.ddd4j.ddd4j-api-clients.*
+com.oregor.ddd4j.ddd4j-aux-details.*
+com.oregor.ddd4j.ddd4j-domain-details.*
+com.oregor.staticfy.*
+com.oregor.staticfy.redirects.*
+com.oregor.trinity.scaffolder.java.*
+com.oregor.trinity4j.*
+com.oregor.trinity4j.trinity4j-api-clients.*
+com.oregor.trinity4j.trinity4j-aux-details.*
+com.oregor.trinity4j.trinity4j-domain-details.*
+com.oregor.trinity4j.trinity4j-shared.*
+com.orendainx.hortonworks.trucking.*
+com.orendainx.trucking.*
+com.oresoftware.*
+com.orgecc.klib.*
+com.orgzly.*
+com.orhanobut.*
+com.orhanobut.tracklytics.*
+com.oriente.android.*
+com.orientechnologies.*
+com.orientechnologies.samples.*
+com.originalflipster.*
+com.originate.*
+com.oripwk.*
+com.oroarmor.*
+com.orrsella.*
+com.orshachar.*
+com.orsonpdf.*
+com.ortto.*
+com.osacky.doctor.*
+com.osacky.fladle.*
+com.osacky.flank.gradle.*
+com.osacky.fulladle.*
+com.osacky.tagger.*
+com.oscarg798.shipbotplugin.*
+com.oscarsalguero.*
+com.oscroll.*
+com.oscroll.archetypes.*
+com.osgifx.*
+com.osinka.*
+com.osinka.camel.*
+com.osinka.httpbl.*
+com.osinka.i18n.*
+com.osinka.play.*
+com.osinka.slugify.*
+com.osinka.subset.*
+com.osmerion.gradle.lwjgl3.*
+com.osmerion.lwjgl3.*
+com.osmerion.onetrickpony.*
+com.osmerion.quitte.*
+com.osohq.*
+com.ossez.*
+com.ossez.usreio.*
+com.ost.*
+com.otakusaikou.fgcn.*
+com.otaliastudios.*
+com.otaliastudios.opengl.*
+com.othelle.jtuples.*
+com.otonishi.*
+com.otsdc.*
+com.ouattararomuald.*
+com.ouestware.*
+com.ouguiyuan.*
+com.ouralabs.*
+com.ouralabs.timber.*
+com.ourtechnobytes.*
+com.oustme.*
+com.outab.common.*
+com.outbrain.aletheia.*
+com.outbrain.swinfra.*
+com.outegret.*
+com.outlivethesun.*
+com.outln.*
+com.outlook.omagnifier.*
+com.outofmemo.plugins.*
+com.outr.*
+com.outr.hw.*
+com.outr.javasysmon.*
+com.outr.net.*
+com.outr.query.*
+com.outr.scalajs.*
+com.outr.scribe.*
+com.outr.webcommunicator.*
+com.outtherelabs.*
+com.outworkers.*
+com.ouyanglol.*
+com.ovea.*
+com.ovea.tajin.*
+com.ovea.tajin.framework.*
+com.ovea.tajin.samples.*
+com.ovea.tajin.server.*
+com.ovea.tajin.servers.*
+com.ovenfo.*
+com.overstock.findbugs.*
+com.ovh.*
+com.ovh.ws.*
+com.ovhcloud.*
+com.ovoenergy.*
+com.owellox.android.assist.*
+com.owellox.android.charts.*
+com.owenfeehan.pathpatternfinder.*
+com.owlike.*
+com.owlplatform.*
+com.ownid.android-sdk.*
+com.owteam.engUtils.*
+com.owtelse.codec.*
+com.owtelse.util.*
+com.oxos.*
+com.oyesk.starter.*
+com.oym.indoor.*
+com.oyorooms.buggers.*
+com.oyper.*
+com.ozangunalp.*
+com.ozwillo.*
+com.p4square.*
+com.paas-word.middleware.*
+com.pacificwebconsulting.assertion.*
+com.pacificwebconsulting.core.*
+com.pacificwebconsulting.logging.*
+com.pacificwebconsulting.runner.*
+com.pacificwebconsulting.runtime.*
+com.packenius.*
+com.packetzoom.*
+com.pad-local.*
+com.paddypowerbetfair.*
+com.paddypowerbetfair.springframework.*
+com.paf.maven.*
+com.pagatech.*
+com.pagecall.*
+com.pagerduty.*
+com.pahakia.lib.*
+com.pairwiseltd.*
+com.pajato.argus.*
+com.pajato.edgar.*
+com.pajato.io.*
+com.pajato.isaac.*
+com.pakulov.elasticsearch.*
+com.pakulov.jersey.media.*
+com.pakulov.kafka.*
+com.pakybytes.*
+com.palantir.*
+com.palantir.aip.processing.*
+com.palantir.aip.processors.api.*
+com.palantir.antipatterns.*
+com.palantir.assertj-automation.*
+com.palantir.atlasdb.*
+com.palantir.atlasdb.examples.*
+com.palantir.baseline.*
+com.palantir.cassandra.*
+com.palantir.common.*
+com.palantir.config.crypto.*
+com.palantir.configurationresolver.*
+com.palantir.conjure.*
+com.palantir.conjure.java.*
+com.palantir.conjure.java.api.*
+com.palantir.conjure.java.runtime.*
+com.palantir.conjure.postman.*
+com.palantir.conjure.python.*
+com.palantir.conjure.rust.*
+com.palantir.conjure.typescript.*
+com.palantir.conjure.verification.*
+com.palantir.delegate.processors.*
+com.palantir.dialogue.*
+com.palantir.docker.compose.*
+com.palantir.docker.proxy.*
+com.palantir.fork.com.github.johnrengelman.*
+com.palantir.foundry-athena.*
+com.palantir.giraffe.*
+com.palantir.goethe.*
+com.palantir.graal.*
+com.palantir.gradle.auto-parallelizable.*
+com.palantir.gradle.conjure.*
+com.palantir.gradle.consistentversions.*
+com.palantir.gradle.docker.*
+com.palantir.gradle.gitversion.*
+com.palantir.gradle.jdks.*
+com.palantir.gradle.jdkslatest.*
+com.palantir.gradle.revapi.*
+com.palantir.gradle.shadow-jar.*
+com.palantir.gradle.utils.*
+com.palantir.guava-compatibility-agent.*
+com.palantir.hadoop-crypto.*
+com.palantir.hadoop-crypto2.*
+com.palantir.human-readable-types.*
+com.palantir.indexpage.*
+com.palantir.jakartapackagealignment.*
+com.palantir.javaformat.*
+com.palantir.junit.*
+com.palantir.jvm.diagnostics.*
+com.palantir.launchconfig.*
+com.palantir.launching.*
+com.palantir.ls.*
+com.palantir.metricschema.*
+com.palantir.nylon.*
+com.palantir.opensource.*
+com.palantir.patches.sourceforge.*
+com.palantir.pivot.*
+com.palantir.proxy.processor.*
+com.palantir.refreshable.*
+com.palantir.remoting-api.*
+com.palantir.remoting1.*
+com.palantir.remoting2.*
+com.palantir.remoting3.*
+com.palantir.ri.*
+com.palantir.safe-logging.*
+com.palantir.safethreadlocalrandom.*
+com.palantir.seek-io.*
+com.palantir.slice.*
+com.palantir.sls-packaging.*
+com.palantir.sls.versions.*
+com.palantir.spark.influx.*
+com.palantir.srx.prometheus.*
+com.palantir.syntactic-paths.*
+com.palantir.tokens.*
+com.palantir.tracing.*
+com.palantir.tritium.*
+com.palantir.ts.*
+com.palantir.versioninfo.*
+com.palantir.weblogger.*
+com.palantir.websecurity.*
+com.palantir.witchcraft.api.*
+com.palantir.witchcraft.java.logging.*
+com.palcyon.*
+com.paligot.*
+com.palindromicstudios.*
+com.pallycon.*
+com.palomamobile.*
+com.palomamobile.android.sdk.*
+com.palominolabs.config.*
+com.palominolabs.gradle.task.*
+com.palominolabs.heroku.*
+com.palominolabs.http.*
+com.palominolabs.jersey.*
+com.palominolabs.metrics.*
+com.palominolabs.salesforce.*
+com.palominolabs.xpath.*
+com.paltabrain.*
+com.paltabrain.analytics.*
+com.paltabrain.billing.*
+com.pampanet.*
+com.panacoding.gridtimeline.*
+com.panavis.open-source.*
+com.panayotis.*
+com.panayotis.javaplot.*
+com.panayotis.jupidator.*
+com.panayotis.lalein.*
+com.pancakedb.*
+com.pancast.*
+com.pandadoc.*
+com.pandora.bottomnavigator.*
+com.pandora.hydra.*
+com.pandora.vanity.*
+com.panemu.*
+com.panforge.*
+com.panforge.demeter.*
+com.panosen.*
+com.panosen.plugins.*
+com.papertrail.*
+com.papertrailapp.*
+com.papiocloud.*
+com.paraches.*
+com.paralleldots.*
+com.parasoft.*
+com.parasoft.jtest.*
+com.paremus.build.*
+com.paremus.cluster.*
+com.paremus.core.*
+com.paremus.dosgi.*
+com.paremus.gossip.*
+com.paremus.ui.*
+com.parisesoftware.*
+com.paritytrading.foundation.*
+com.paritytrading.juncture.*
+com.paritytrading.nassau.*
+com.paritytrading.parity.*
+com.paritytrading.philadelphia.*
+com.parmet.*
+com.parmet.buf.*
+com.parmet.mysql2h2-converter.*
+com.parolisoft.*
+com.parousya.saas.*
+com.parrer.*
+com.parrot.drone.groundsdk.*
+com.parse.*
+com.parse.bolts.*
+com.parsely.*
+com.parship.*
+com.partnerize.android.*
+com.partnet.*
+com.partnet.sample.*
+com.parzivail.*
+com.parzivail.internal.*
+com.parzivail.internal.pswg-submodule-dependencies.*
+com.passkit.grpc.*
+com.password4j.*
+com.passwordping.*
+com.pastdev.*
+com.pastdev.httpcomponents.*
+com.pastdev.liferay.*
+com.path-variable.*
+com.path.*
+com.pathdb.*
+com.pathomation.*
+com.patloew.colocation.*
+com.patloew.rxlocation.*
+com.patreon.*
+com.patrykandpatrick.vico.*
+com.patrykandpatryk.vico.*
+com.patrykkosieradzki.*
+com.patrykmichalik.opto.*
+com.patterninc.patternspace.*
+com.paulbutcher.*
+com.pauldijou.*
+com.paulgoldbaum.*
+com.paulhammant.*
+com.paulhammant.servirtium.*
+com.paulhammant.sitemeshpageparser.*
+com.pauljabernathy.*
+com.paulmandal.atak.*
+com.paulrademacher.*
+com.paulrybitskyi.*
+com.paulrybitskyi.commons.*
+com.paulrybitskyi.persistentsearchview.*
+com.paulrybitskyi.valuepicker.*
+com.pavelvlasov.*
+com.pavlosgi.*
+com.pavlovmedia.oss.jaxrs.*
+com.pavlovmedia.oss.osgi.gelf.*
+com.pavlovmedia.oss.osgi.http.*
+com.pawelgorny.*
+com.paxleones.*
+com.paxovision.*
+com.payabbhi.*
+com.payalabs.*
+com.payclip.*
+com.payclip.sdk.*
+com.payco.android.*
+com.paycoiner.*
+com.paycomet.androidRestSDK.*
+com.payermax.*
+com.payfurl.*
+com.payintech.*
+com.paykun.sdk.*
+com.payline.*
+com.paymaya.*
+com.paymennt.*
+com.paymentplugins.*
+com.paymentwall.*
+com.paymill.*
+com.paymill.android.*
+com.payneteasy.*
+com.payneteasy.grpc-long-polling.*
+com.payneteasy.http-server.*
+com.payneteasy.logging-extensions.*
+com.payneteasy.socket-nio.*
+com.payneteasy.superfly.*
+com.paynicorn.*
+com.paynova.api.client.*
+com.paypal.*
+com.paypal.android.*
+com.paypal.android.platform.*
+com.paypal.android.sdk.*
+com.paypal.butterfly.*
+com.paypal.butterfly.extensions.*
+com.paypal.cascade.*
+com.paypal.checkout.*
+com.paypal.checkout.sdk.*
+com.paypal.digraph.*
+com.paypal.dione.*
+com.paypal.hera.*
+com.paypal.juno.*
+com.paypal.lighthouse.*
+com.paypal.mocca.*
+com.paypal.pyplcheckout.*
+com.paypal.retail.*
+com.paypal.sdk.*
+com.paypal.selion.*
+com.paypal.springboot.*
+com.paypal.tools.*
+com.payrails.android.*
+com.paysera.lib.*
+com.paytabs.*
+com.paytheory.*
+com.paytm.pg.*
+com.payu.*
+com.payu.ratel.*
+com.payulatam.android.*
+com.payulatam.fcontrol.*
+com.payulatam.fraudvault.*
+com.paywholesail.*
+com.paywholesail.mojo.*
+com.payxpert.*
+com.pcarneiro.utilities.*
+com.pcarrier.graphed.*
+com.pcchin.auto-app-updater.*
+com.pcchin.customdialog.*
+com.pcchin.dtpreference.*
+com.pcchin.licenseview.*
+com.pchudzik.*
+com.pchudzik.springmock.*
+com.pcl-solutions.maven.reports.*
+com.pcl-solutions.maven.wagons.*
+com.pcloud.pcloud-networking-java.*
+com.pcloud.sdk.*
+com.pddstudio.*
+com.pdf4me.*
+com.pdfcrowd.*
+com.pdlpdl.*
+com.peachapisecurity.*
+com.peachfuzzer.web.*
+com.peasenet.*
+com.peasenet.util.*
+com.peersafe.*
+com.peertopark.java.*
+com.peertopark.spring.*
+com.peertopark.spring.social.*
+com.peggir.*
+com.peircean.glusterfs.*
+com.peircean.libgfapi-jni.*
+com.pekinsoft.*
+com.pelock.*
+com.pelzer.util.*
+com.penalara.ghc.*
+com.pengsw.*
+com.pengwz.*
+com.pengyifan.bioc.*
+com.pengyifan.brat.*
+com.pengyifan.pubtator.*
+com.pennassurancesoftware.cloudns.*
+com.pennassurancesoftware.dropwizard.*
+com.pennassurancesoftware.jgroups.*
+com.pennassurancesoftware.tutum.*
+com.pentahohub.*
+com.pentahohub.nexus.*
+com.pep1.*
+com.pep1.jira.*
+com.pepegar.*
+com.pepperize.*
+com.peppermintchain.*
+com.peppermintchain.archetypes.*
+com.percolate.*
+com.peregrinejs.*
+com.perficient.aem.*
+com.perfma.wrapped.*
+com.perfma.xlab.*
+com.perforce.*
+com.perforce.halm.*
+com.perforce.halm.rest.*
+com.perforce.p4maven.*
+com.perihelios.aws.*
+com.perihelios.math.*
+com.perimeterx.*
+com.permeagility.*
+com.permutive.*
+com.permutive.android.*
+com.persado.oss.quality.stevia.*
+com.persist.*
+com.persistentbit.*
+com.personaclick.*
+com.personio.*
+com.personthecat.*
+com.perthcpe23.dev.*
+com.peruncs.*
+com.peruncs.gwt.*
+com.peruncs.odbjca.*
+com.pervasivecode.*
+com.pesepay.*
+com.pessetto.origamismtp.*
+com.petalmd.*
+com.peterabeles.*
+com.peterbucko.*
+com.petercipov.*
+com.peterfranza.*
+com.peterlavalle.*
+com.peterlavalle.libgdx.*
+com.peterphi.aws.snapshotd.*
+com.peterphi.std.*
+com.peterphi.std.config.*
+com.peterphi.std.guice.*
+com.peterphi.std.index.*
+com.peterphi.std.util.carbon.*
+com.peterphi.thymeleaf.*
+com.peterphi.user-manager.*
+com.peterpotts.*
+com.petersamokhin.*
+com.petersamokhin.notionsdk.*
+com.petersamokhin.vksdk.*
+com.petersamokhin.vksdk.android.*
+com.petrivirkkula.toolbox.*
+com.pettyfox.*
+com.pettyfox.base.*
+com.pettyfox.timeline.*
+com.pexip.sdk.*
+com.pexip.webrtc.*
+com.pff.*
+com.pgs-soft.*
+com.pguardiola.*
+com.pgvector.*
+com.phaller.*
+com.phasebash.jackson.*
+com.phasebash.jsdoc.*
+com.phasmidsoftware.*
+com.phaxio.*
+com.phenixidentity.*
+com.phenixrts.edgeauth.*
+com.philihp.*
+com.philips.ai.*
+com.phloc.*
+com.phloc.maven.*
+com.phodal.chapi.*
+com.phoenixnap.oss.*
+com.pholser.*
+com.phonedeck.*
+com.phrase.*
+com.phylage.*
+com.pi4j.*
+com.piaoniu.*
+com.pias-education.*
+com.piasy.*
+com.picellus.*
+com.pickytweaks.*
+com.picoff.*
+com.picoscott.*
+com.picsart.*
+com.picscout.depend.*
+com.pidanic.*
+com.pieceof8.gradle.*
+com.pierfrancescosoffritti.androidyoutubeplayer.*
+com.piesocket.*
+com.piesocket.channels.*
+com.piesocket.java-sdk.*
+com.piesocket.sdk.*
+com.piesoftsol.common.*
+com.piesoftsol.oneservice.*
+com.piesoftsol.oneservice.common.*
+com.piesoftsol.oneservice.oneservice.eurekaservice.*
+com.piesoftsol.oneservice.zuulservice.*
+com.pietvandongen.*
+com.pifutan.common.*
+com.pig4cloud.*
+com.pig4cloud.archetype.*
+com.pig4cloud.beanstalk.*
+com.pig4cloud.excel.*
+com.pig4cloud.fastdfs.*
+com.pig4cloud.nacos.*
+com.pig4cloud.plugin.*
+com.pig4cloud.redis.*
+com.pig4cloud.screw.*
+com.pig4cloud.shiro.*
+com.pig4cloud.spring.boot.*
+com.piggsoft.*
+com.pighand.*
+com.pigumer.tools.archetype.*
+com.piiano.vault.*
+com.piksel.sequoia.*
+com.pilosa.*
+com.pimblott.camel.metoffice.*
+com.pingcap.tidb.*
+com.pingcap.tikv.*
+com.pingcap.tispark.*
+com.pingidentity.oss.*
+com.pingidentity.oss.cassandra4j.*
+com.pingidentity.pingonefraud.*
+com.pingidentity.pingonemfa.*
+com.pingidentity.signals.*
+com.pingidentity.signalscollection.*
+com.pingunaut.*
+com.pingunaut.maven.plugin.*
+com.pingxx.*
+com.pinterest.*
+com.pinterest.ktlint.*
+com.pinterest.l10nmessages.*
+com.pinterest.memq.*
+com.pinterest.singer.*
+com.pipl.api.*
+com.pippsford.*
+com.piran-framework.*
+com.pirum.*
+com.pivotallabs.*
+com.pivotfreight.*
+com.pivotfreight.oss.*
+com.pivovarit.*
+com.pixalate.android.*
+com.pixelcarrot.base64image.*
+com.pixelduke.*
+com.pixiteapps.billingx.*
+com.pixonic.*
+com.pixop.*
+com.pixplicity.easyprefs.*
+com.pixplicity.generate.*
+com.pixplicity.letterpress.*
+com.pixplicity.multiviewpager.*
+com.pixplicity.sharp.*
+com.pjdroid.*
+com.pjhampton.*
+com.pklotcorp.*
+com.pkmmte.pkrss.*
+com.pkmmte.view.*
+com.pkrete.xrd4j.*
+com.pkslow.*
+com.pkulak.httpclient.*
+com.pkware.ahocorasick.*
+com.pkware.detekt.*
+com.pkware.filesystem.*
+com.pkware.generex.*
+com.pkware.truth-android.*
+com.placetopay.*
+com.plaid.*
+com.plaid.link.*
+com.plainflow.analytics.java.*
+com.plainid.libs.*
+com.planbase.*
+com.planbase.pdf.*
+com.planet57.buildsupport.*
+com.planet57.gossip.*
+com.platformlib.*
+com.platopen.*
+com.plausiblelabs.metrics.*
+com.plausiblelabs.warwizard.*
+com.playfab.*
+com.playidonesdk.zzyl-sdk.*
+com.playlyfe.*
+com.playpark.game-tofelive.*
+com.playtika.janusgraph.*
+com.playtika.maven.plugins.*
+com.playtika.nosql.*
+com.playtika.openapi.rapidoc.*
+com.playtika.reactivefeign.*
+com.playtika.reactivejson.*
+com.playtika.services.*
+com.playtika.sleuth.*
+com.playtika.testcontainers.*
+com.pleased.*
+com.plecting.*
+com.plenigo.*
+com.pleosoft.*
+com.pleosoft.pleodox.*
+com.plivo.*
+com.plivo.endpoint.*
+com.plooh.adssi.*
+com.plotsquared.*
+com.plugatar.*
+com.plugatar.xteps.*
+com.plugatar.xteps2.*
+com.plugback.*
+com.pluhin.api.*
+com.pluhin.util.*
+com.plumelog.*
+com.plusauth.*
+com.plusmobileapps.*
+com.plutolib.*
+com.plutolib.plugins.*
+com.plutonem.*
+com.plydot.*
+com.pmanaktala.*
+com.pngencoder.*
+com.pnikosis.*
+com.pnuema.android.*
+com.pnuema.java.*
+com.pnxtest.*
+com.pochemuto.*
+com.pochemuto.orvibo.*
+com.pockettheories.*
+com.podio.*
+com.pogofish.jadt.*
+com.pojosontheweb.*
+com.pokebattler.*
+com.pokebattler.wu.*
+com.pokitdok.*
+com.polarcoral.monica.*
+com.polarquant.data.*
+com.polidea.androidthings.driver.*
+com.polidea.cockpit.*
+com.polidea.rxandroidble.*
+com.polidea.rxandroidble2.*
+com.polidea.rxandroidble3.*
+com.pollfish.*
+com.pollfish.mediation.*
+com.pollsplatform.android.sdk.*
+com.polonium-framework.*
+com.polymathiccoder.*
+com.polysfactory.headgesturedetector.*
+com.polysfactory.lib.glass.bluetooth.*
+com.polysfactory.lib.guitarparty.*
+com.pomeisl.*
+com.pongr.*
+com.pongsky.kit.*
+com.pongsky.springcloud.*
+com.ponkotuy.*
+com.pontusvision.*
+com.pontusvision.salesforce.*
+com.poolik.*
+com.poortoys.*
+com.popdeem.sdk.*
+com.popokis.*
+com.porch.*
+com.porscheinformatik.tapestry.jaxws.*
+com.portableehr.*
+com.portingle.*
+com.portlandwebworks.*
+com.portletguru.*
+com.portto.*
+com.portto.blocto.*
+com.portto.ethereum.*
+com.portto.fcl.*
+com.portto.sdk.*
+com.portto.solana.*
+com.portto.ui.*
+com.posadskiy.*
+com.positiondev.epublib.*
+com.positiverobot.*
+com.posoup.*
+com.posthog.android.*
+com.posthog.java.*
+com.postmarkapp.*
+com.postmen.*
+com.potenciasoftware.*
+com.power4j.*
+com.power4j.fist.*
+com.power4j.fist3.*
+com.power4j.kit.*
+com.powerspace.*
+com.powerspace.openrtb.*
+com.powsybl.*
+com.ppiech.auto.value.*
+com.ppolivka.solr.extensions.*
+com.ppublica.shopify.*
+com.pr-ing.*
+com.practicaldime.works.*
+com.practicingtechie.*
+com.pragmaticautomation.*
+com.pragmatickm.*
+com.pragmaticobjects.oo.atom.*
+com.pragmaticobjects.oo.base.*
+com.pragmaticobjects.oo.bom.*
+com.pragmaticobjects.oo.data.*
+com.pragmaticobjects.oo.equivalence.*
+com.pragmaticobjects.oo.equivalence.itests.*
+com.pragmaticobjects.oo.inference.*
+com.pragmaticobjects.oo.inference.itests.*
+com.pragmaticobjects.oo.memoized.*
+com.pragmaticobjects.oo.meta.*
+com.pragmaticobjects.oo.tests.*
+com.pramyness.*
+com.pranavpandey.android.*
+com.pranavpandey.dynamic.*
+com.prasannjeet.*
+com.prechatting.*
+com.precisely.apis.*
+com.predic8.*
+com.preflight.*
+com.premiumminds.*
+com.premiumminds.flowable.*
+com.premiumminds.oidc.*
+com.premnirmal.magnet.*
+com.preservly.*
+com.presidentio.*
+com.presidentio.but.*
+com.pressassociation.partial-response.*
+com.presseverykey.*
+com.prestongarno.*
+com.prestongarno.ktq.*
+com.pretius.*
+com.prezi.changelog.*
+com.prezi.gradle.pride.*
+com.prezi.gradle.superbranch.*
+com.prezi.grub.*
+com.prezi.haskell.*
+com.prezi.haxe.*
+com.prezi.pride.*
+com.prezi.spaghetti.*
+com.prezi.typescript.*
+com.pri-num.*
+com.priitlaht.*
+com.prime157.citrus.aws.*
+com.prime157.docker.*
+com.prime157.docker.load-to-docker.*
+com.primeframeworks.*
+com.primeton.eos.*
+com.primihub.*
+com.princexml.*
+com.prismacampaigns.sdk.*
+com.privakey.*
+com.privakey.cx.*
+com.pro-crafting.*
+com.pro-crafting.maven.*
+com.pro-crafting.mc.*
+com.pro-crafting.tools.*
+com.probelogr.*
+com.problemfighter.java.oc.*
+com.problemfighter.pfspring.common.*
+com.problemfighter.pfspring.multitenant.*
+com.problemfighter.pfspring.restapi.*
+com.processout.*
+com.processpuzzle.*
+com.processpuzzle.fitnesse.*
+com.processpuzzle.maven.*
+com.producement.*
+com.productlayer.*
+com.prof18.kmp-framework-bundler.*
+com.prof18.kmp.fatframework.cocoa.*
+com.prof18.rssparser.*
+com.prof18.youtubeparser.*
+com.profesorfalken.*
+com.profitbricks.*
+com.programmaticallyspeaking.*
+com.programmerare.crs-transformation.*
+com.programmerare.shortest-paths.*
+com.programmerare.sweden-crs-transformations-4jvm.*
+com.progress.hudson.*
+com.progressoft.brix.domino.*
+com.progressoft.brix.domino.api.*
+com.progressoft.brix.domino.apt.*
+com.progressoft.brix.domino.archetypes.*
+com.progressoft.brix.domino.impl.*
+com.progressoft.brix.domino.logger.*
+com.progressoft.brix.domino.logging.*
+com.progressoft.brix.domino.test.*
+com.progressoft.brix.domino.test.ui.*
+com.progsbase.libraries.*
+com.proinnovate.*
+com.projectdarkstar.*
+com.projectdarkstar.client.*
+com.projectdarkstar.example.projectsnowman.*
+com.projectdarkstar.ext.berkeleydb.*
+com.projectdarkstar.ext.com.jmonkeyengine.*
+com.projectdarkstar.ext.fenggui.*
+com.projectdarkstar.ext.jeffpk.*
+com.projectdarkstar.ext.jorbis.*
+com.projectdarkstar.ext.neakor.*
+com.projectdarkstar.ext.net.java.dev.gluegen.*
+com.projectdarkstar.ext.net.java.dev.jogl.*
+com.projectdarkstar.ext.org.lwjgl.*
+com.projectdarkstar.maven.plugin.*
+com.projectdarkstar.server.*
+com.projectdarkstar.services.*
+com.projectdarkstar.tools.build.*
+com.projectdarkstar.tools.test.*
+com.projectmadcow.*
+com.projecturanus.*
+com.projetloki.*
+com.prolificinteractive.*
+com.promcteam.*
+com.proofpoint.cloudmanagement.service.*
+com.proofpoint.discovery-announcer.*
+com.proofpoint.discovery.*
+com.proofpoint.event.*
+com.proofpoint.galaxy.*
+com.proofpoint.hive.*
+com.proofpoint.platform.*
+com.propellerads.*
+com.propensive.*
+com.proserus.ejap.*
+com.protenus.*
+com.protocol180.*
+com.protonail.bolt-jna.*
+com.protonail.leveldb-jna.*
+com.protosstechnology.*
+com.proudapes.*
+com.provectus.*
+com.provisionpay.*
+com.prowaveconsulting.*
+com.prowidesoftware.*
+com.proxy-seller.*
+com.pryv.*
+com.psclistens.*
+com.psclistens.gru.*
+com.pseudocode.*
+com.pseudocode.photolib.*
+com.psiwray.organization.*
+com.pslib.jtool.*
+com.pspdfkit-labs.*
+com.pszymczyk.consul.*
+com.pteyer.*
+com.ptsmods.*
+com.pubguard.*
+com.pubnub.*
+com.pubnub.components.*
+com.pubscale.sdkone.*
+com.puculek.pulltorefresh.*
+com.pugwoo.*
+com.pulsarix.micronaut.*
+com.pulsatehq.sdk.*
+com.pulseid.*
+com.pulsepoint.*
+com.pulumi.*
+com.punchthrough.bean.sdk.*
+com.puntoycomalab.*
+com.puntoycomalab.android.*
+com.pupilcc.common.*
+com.pupilcc.sdk.*
+com.puppycrawl.tools.*
+com.puravida-software.*
+com.puravida-software.asciidoctor.*
+com.puravida-software.groogle.*
+com.purbon.*
+com.purbon.kafka.*
+com.purbon.kafka.topology.*
+com.purej.*
+com.purej.pmd.*
+com.puresoltechnologies.commons.*
+com.puresoltechnologies.ductiledb.*
+com.puresoltechnologies.extended-objects.*
+com.puresoltechnologies.genesis.*
+com.puresoltechnologies.graphs.*
+com.puresoltechnologies.i18n4java.*
+com.puresoltechnologies.javafx.*
+com.puresoltechnologies.kickstart.*
+com.puresoltechnologies.maven.plugins.*
+com.puresoltechnologies.parsers.*
+com.puresoltechnologies.purifinity.*
+com.puresoltechnologies.purifinity.api.*
+com.puresoltechnologies.purifinity.manuals.*
+com.puresoltechnologies.purifinity.plugins.*
+com.puresoltechnologies.purifinity.server.*
+com.puresoltechnologies.purifinity.webui.*
+com.puresoltechnologies.streaming.*
+com.puresoltechnologies.versioning.*
+com.puresoltechnologies.xo.*
+com.puresrc.*
+com.purgeteam.*
+com.purgeteam.cloud.*
+com.purpblue.*
+com.purplehillsbooks.purple.*
+com.pusdn.*
+com.push-pole.android.*
+com.pushbullet.*
+com.pusher.*
+com.pushly.android.*
+com.pushpopsoft.*
+com.pushradar.*
+com.pushtorefresh.*
+com.pushtorefresh.java-private-constructor-checker.*
+com.pushtorefresh.storio.*
+com.pushtorefresh.storio2.*
+com.pushtorefresh.storio3.*
+com.pushwoosh.*
+com.pushwoosh.java7.*
+com.putao.ptx.*
+com.pvryan.easycrypt.*
+com.pvsstudio.*
+com.pwinckles.jdbcgen.*
+com.pwrdrvr.microapps.*
+com.px100systems.*
+com.px3j.*
+com.pygmalios.*
+com.pyjava.plugin.*
+com.pylon.*
+com.pyramidacceptors.*
+com.pyranid.*
+com.pyruby.*
+com.pyrus.*
+com.pythian.opentsdb.*
+com.pyx4j.*
+com.pyx4me.*
+com.q42.*
+com.qaiware.*
+com.qaneh.*
+com.qantium.*
+com.qaprosoft.*
+com.qasymphony.qtest.*
+com.qatrend.*
+com.qbcps.*
+com.qcefast.*
+com.qcfsoftware.*
+com.qcloud.*
+com.qcloud.cos.*
+com.qcloud.oceanus.*
+com.qcloud.qvb.*
+com.qdesrame.*
+com.qeagle.*
+com.qeedata.*
+com.qencode.java.api.client.*
+com.qianduner.*
+com.qianmi.*
+com.qiaobutang.*
+com.qifun.*
+com.qifun.sbt-haxe.*
+com.qindesign.*
+com.qingcloud.*
+com.qinglinyi.arg.*
+com.qingxun.*
+com.qingzhuge.framework.*
+com.qiniu.*
+com.qiniu.pili.*
+com.qinpiyi.common.*
+com.qitsoft.*
+com.qiukeke.*
+com.qiwenshare.*
+com.qiwi.*
+com.qiwi.featuretoggle.*
+com.qixiangyun.*
+com.qiyukf.unicorn.*
+com.qlangtech.maven.cloud.*
+com.qlangtech.tis.*
+com.qliro.*
+com.qlusters.jlmenu.*
+com.qmakesoft.*
+com.qmetric.*
+com.qmetric.document.*
+com.qmetry.*
+com.qmuiteam.*
+com.qolome.*
+com.qonceptual.*
+com.qoomon.*
+com.qoreid.*
+com.qovery.*
+com.qozix.*
+com.qq.e.*
+com.qq.e.union.*
+com.qqviaja.tools.*
+com.qrolik.*
+com.qrolik.utility.*
+com.qspin.qtaste.*
+com.qspin.qtaste.plugin.*
+com.qsyout.*
+com.qtagile.*
+com.qttaudio.*
+com.quadas.*
+com.quadible.*
+com.quadient.dataservices.*
+com.quadpay.*
+com.quali.cloudshell.*
+com.qualifast.*
+com.qualifiedcactus.*
+com.qualink.baas.*
+com.qualinsight.core.*
+com.qualinsight.libs.sonarqube.*
+com.qualinsight.mavencentral.*
+com.qualinsight.mojo.cobertura.*
+com.qualinsight.plugins.jetty.*
+com.qualinsight.plugins.sonarqube.*
+com.quality-ad.*
+com.qualizeal.*
+com.qualizeal.community.*
+com.quamto.*
+com.quamto.jira.*
+com.quandoo.lib.*
+com.quanminshangxian.*
+com.quanode.*
+com.quantarray.*
+com.quantasnet.management.*
+com.quantcast.android.measurement.*
+com.quantego.*
+com.quantifind.*
+com.quantimodo.android.*
+com.quantimodo.android.sdk.*
+com.quantxt.core.*
+com.quantxt.nlp.*
+com.quantxt.sdk.*
+com.quartercode.*
+com.quartzdesk.*
+com.quasiris.qsf.*
+com.quatico.magellan.*
+com.qubit.*
+com.qubole.*
+com.qubole.presto.*
+com.qubole.presto.hive.*
+com.qubole.qds-sdk-java.*
+com.qubole.rubix.*
+com.qubole.spark.*
+com.qubole.tempto.*
+com.qudini.*
+com.quebin31.*
+com.quectel.aiot.*
+com.quentindommerc.superlistview.*
+com.queomedia.*
+com.queomedia.commons.persistence.*
+com.querydsl.*
+com.querydsl.contrib.*
+com.querydsl.webhooks.*
+com.queryeer.*
+com.questetra.*
+com.queue-it.*
+com.queue-it.androidsdk.*
+com.queue-it.connector.*
+com.queue-it.sdk.*
+com.quhaodian.*
+com.quhaodian.adminstore.*
+com.quhaodian.discover.*
+com.quhaodian.jsonrpc.*
+com.quhaodian.plugs.*
+com.quhaodian.umall.*
+com.quickbirdstudios.*
+com.quicklib.*
+com.quicko.*
+com.quigley.*
+com.quinengine.*
+com.quinientoscuarenta.*
+com.quinovas.*
+com.quinsoft.zeidon.*
+com.quiph.ui.*
+com.qulice.*
+com.qunar.qmq.*
+com.quoininc.*
+com.qurami.android.link.*
+com.quuppa.*
+com.quvideo.qa.*
+com.qvantel.*
+com.qwasi.*
+com.qwazr.*
+com.qweather.leframework.*
+com.qwlabs.*
+com.qwlabs.dataflow.*
+com.qwlabs.doraemon.*
+com.qxwz.ps-sdk.*
+com.r0adkll.*
+com.r3.conclave.*
+com.r3.conclave.enclave.*
+com.r3.corda.ledger.utxo.*
+com.r3.corda.ledger.utxo.corda-ledger-extensions-base.*
+com.r3.corda.ledger.utxo.corda-ledger-extensions-chainable.*
+com.r3.corda.ledger.utxo.corda-ledger-extensions-fungible.*
+com.r3.corda.ledger.utxo.corda-ledger-extensions-identifiable.*
+com.r3.corda.ledger.utxo.corda-ledger-extensions-issuable.*
+com.r3.corda.ledger.utxo.corda-ledger-extensions-ownable.*
+com.r3.corda.lib.ci.*
+com.r3.corda.lib.ci.ci-workflows.*
+com.r3.corda.lib.tokens.*
+com.r3.corda.notary.plugin.common.*
+com.r3.corda.notary.plugin.common.notary-plugin-common.*
+com.r3.corda.notary.plugin.nonvalidating.*
+com.r3.corda.notary.plugin.nonvalidating.notary-plugin-non-validating-api.*
+com.r3.corda.notary.plugin.nonvalidating.notary-plugin-non-validating-client.*
+com.r3.corda.notary.plugin.nonvalidating.notary-plugin-non-validating-server.*
+com.r4tings.recommender.*
+com.r4v3zn.fofa.*
+com.r4v3zn.vulfocus.*
+com.rabbitmq.*
+com.rabbitmq.jms.*
+com.rabidgremlin.*
+com.rabobank.argos.*
+com.rabriel.*
+com.rachitskillisaurus.portreserve.*
+com.rackspace.apache.*
+com.rackspace.api.clients.*
+com.rackspace.cloud.api.*
+com.rackspace.eclipse.webtools.sourceediting.*
+com.rackspace.xmlcalabash.*
+com.rackspacecloud.*
+com.racodond.sonarqube.plugin.gherkin.*
+com.racquettrack.*
+com.radcortez.flyway.*
+com.raddatzk.*
+com.radekkozak.gradle.*
+com.radekkozak.gradle.convention.dokka.*
+com.radekkozak.gradle.convention.java-app.*
+com.radekkozak.gradle.convention.java-base.*
+com.radekkozak.gradle.convention.java-lib.*
+com.radekkozak.gradle.convention.kotlin-jvm.*
+com.radekkozak.gradle.convention.kotlin-kmp-lib-base.*
+com.radekkozak.gradle.convention.kotlin-kover.*
+com.radekkozak.gradle.convention.spotless.*
+com.radiusnetworks.*
+com.radiusnetworks.flybuy.*
+com.radusalagean.*
+com.raedapps.*
+com.raelity.*
+com.raelity.3rdparty.com.glazedlists.*
+com.raelity.3rdparty.com.l2fprod.common.*
+com.raelity.jfx.*
+com.raelity.jvi.*
+com.raelity.logman.*
+com.rafaeldakaj.*
+com.rafalzajfert.*
+com.rafasf.*
+com.rafaskoberg.gdx.*
+com.ragedunicorn.tools.maven.*
+com.ragnaroh.*
+com.rainbowpunch.*
+com.rainerhahnekamp.*
+com.rainingsince.*
+com.rainmatter.kiteconnect.*
+com.raisin.*
+com.raisondata.openai.*
+com.rajant.oss.*
+com.rajatthareja.*
+com.rajivprab.*
+com.rallydev.analytics.lookback.*
+com.rallydev.rest.*
+com.rallyhealth.*
+com.ralphcollett.*
+com.ramanbabich.dbljc.*
+com.rameshkp.*
+com.rameshkp.openapi-merger-gradle-plugin.*
+com.ramostear.*
+com.ramotion.cardslider.*
+com.ramotion.circlemenu.*
+com.ramotion.directselect.*
+com.ramotion.expandingcollection.*
+com.ramotion.fluidslider.*
+com.ramotion.foldingcell.*
+com.ramotion.garlandview.*
+com.ramotion.navigationtoolbar.*
+com.ramotion.paperonboarding.*
+com.rampatra.adsj.*
+com.ranceworks.*
+com.randallraboy.archaius.*
+com.randomnoun.bandcamp.*
+com.randomnoun.build.*
+com.randomnoun.common.*
+com.randomnoun.db.*
+com.randomnoun.log4j.*
+com.randomnoun.maven.doxia.*
+com.randomnoun.maven.plugins.*
+com.randomnoun.p7spy.*
+com.randomnoun.songkick.*
+com.randou-tech.*
+com.rangotec.utils.*
+com.raniejaderamiso.*
+com.raonirenosto.*
+com.rapatao.*
+com.rapatao.micronaut.*
+com.rapatao.ruleset.*
+com.rapatao.sparkjava.*
+com.rapatao.vertx.*
+com.raphtory.*
+com.rapid-table.sdk.*
+com.rapid7.*
+com.rapid7.client.*
+com.rapid7.communityid.*
+com.rapid7.conqueso.*
+com.rapid7.docker.*
+com.rapid7.pax.*
+com.rapid7.presto.*
+com.rapid7.recog.*
+com.rapid7.trools.*
+com.rapidclipse.*
+com.rapiddweller.*
+com.rapplogic.*
+com.raquo.*
+com.raquo.xstream.*
+com.raskasa.metrics.*
+com.rasklaad.*
+com.rastadrian.*
+com.rasterfoundry.*
+com.rathravane.*
+com.rationaleemotions.*
+com.rationaleemotions.jmeter.plugins.*
+com.rationaleemotions.maven.plugins.*
+com.raufferlobo.*
+com.raufferlobo.springboot.multitenant.mongodb.*
+com.raveer.*
+com.ravellosystems.plugins.*
+com.raven-computing.*
+com.ravidsrk.*
+com.ravishrajput.*
+com.ravram.*
+com.raw-labs.*
+com.raxdenstudios.*
+com.raxdenstudios.commons.*
+com.rayanova.community.*
+com.raycoarana.*
+com.raycoarana.awex.*
+com.raycoarana.codeinputview.*
+com.raycoarana.tesela.*
+com.raygun.*
+com.raylabz.*
+com.raynigon.raylevation.*
+com.raynigon.spring-boot.*
+com.raynigon.unit-api.*
+com.razie.*
+com.razorpay.*
+com.rbkmoney.*
+com.rbkmoney.adapter-client-lib.*
+com.rbkmoney.adapter-thrift-lib.*
+com.rbkmoney.geck.*
+com.rbkmoney.logback.*
+com.rbkmoney.maven.plugins.*
+com.rbkmoney.woody.*
+com.rbmhtechnology.vind.*
+com.rcastrucci.dev.*
+com.rd4j.*
+com.rdebokx.*
+com.rdxer.*
+com.reachlocal.mobile.liger.*
+com.reactific.*
+com.reactivemarkets.*
+com.readdle.android.swift.*
+com.readdle.swift.java.codegen.*
+com.readonlydev.*
+com.readystatesoftware.chuck.*
+com.readystatesoftware.ghostlog.*
+com.readystatesoftware.sqliteasset.*
+com.readystatesoftware.systembartint.*
+com.readytalk.*
+com.reagroup.*
+com.real-comp.*
+com.realexpayments.hpp.sdk.*
+com.realexpayments.remote.sdk.*
+com.reallifedeveloper.*
+com.realtention.*
+com.realtimetech.*
+com.rebasedata.*
+com.rebaze.*
+com.rebaze.maven.*
+com.rebiekong.coding.*
+com.recipegrace.*
+com.recombee.*
+com.recommender.*
+com.recoveryrecord.*
+com.recurly.*
+com.recurly.v3.*
+com.recursivity.*
+com.recvani.*
+com.red-dove.*
+com.redapplenet.*
+com.redbricklane.zapr.*
+com.redbricklane.zapr.admob.*
+com.redbricklane.zapr.banner.*
+com.redbricklane.zapr.base.*
+com.redbricklane.zapr.basedatasdk.*
+com.redbricklane.zapr.dfp.*
+com.redbricklane.zapr.video.*
+com.redconfig.*
+com.reddio.*
+com.redfin.*
+com.redfin.hudson.*
+com.redhat.ceylon.gradle.*
+com.redhat.cloud.*
+com.redhat.cloud.common.*
+com.redhat.cloud.event.*
+com.redhat.consulting.*
+com.redhat.darcy.*
+com.redhat.devtools.intellij.*
+com.redhat.engineering.*
+com.redhat.engineering.maven.extensions.*
+com.redhat.insights.*
+com.redhat.insights.kafka.*
+com.redhat.lightblue.*
+com.redhat.lightblue.applications.*
+com.redhat.lightblue.camel.*
+com.redhat.lightblue.client.*
+com.redhat.lightblue.config.*
+com.redhat.lightblue.core.*
+com.redhat.lightblue.generator.*
+com.redhat.lightblue.healthcheck.*
+com.redhat.lightblue.hook.*
+com.redhat.lightblue.ldap.*
+com.redhat.lightblue.migrator.*
+com.redhat.lightblue.mongo.*
+com.redhat.lightblue.plugin.maven.*
+com.redhat.lightblue.rest.*
+com.redhat.rcm.*
+com.redhat.rcm.maven.plugin.*
+com.redhat.rcm.offliner.*
+com.redhat.red.build.*
+com.redhat.red.offliner.*
+com.redhat.resilience.otel.*
+com.redhat.rhevm.api.*
+com.redhat.synq.*
+com.redhat.thermostat.*
+com.redhat.victims.*
+com.redhat.victims.maven.*
+com.redijedi.*
+com.redis.*
+com.redis.enterprise.*
+com.redis.om.*
+com.redis.testcontainers.*
+com.redislabs.*
+com.redislabs.testcontainers.*
+com.redissi.moshi-adapters-iso8601.*
+com.redissi.plugin.*
+com.redissi.swig.*
+com.redissi.swig.plugin.*
+com.redmadrobot.*
+com.redmadrobot.build.*
+com.redmadrobot.debug.*
+com.redmadrobot.extensions.*
+com.redmadrobot.itemsadapter.*
+com.redmadrobot.mapmemory.*
+com.redmadrobot.versions.*
+com.rednuo.*
+com.redowlanalytics.*
+com.redpill-linpro.*
+com.redpill-linpro.alfresco.*
+com.redshepherd.*
+com.redspr.redrobot.*
+com.redstoneblocks.java.*
+com.redv.bloggerapi.*
+com.reedoei.*
+com.reelyactive.*
+com.rees46.*
+com.reevoo.taglib.*
+com.refinery89.androidsdk.*
+com.refinitiv.ema.*
+com.refinitiv.eta.*
+com.refinitiv.eta.ansi.*
+com.refinitiv.eta.json.converter.*
+com.refinitiv.eta.valueadd.*
+com.refinitiv.eta.valueadd.cache.*
+com.refunctoring.*
+com.regblanc.*
+com.regiocom.bpo.*
+com.rei.aether.*
+com.rei.datadsl.*
+com.rei.ez-up.*
+com.rei.jenkins.systemdsl.*
+com.rei.oss.*
+com.rei.ropeteam.*
+com.reizes.shiva2.*
+com.relaximus.*
+com.relayrides.*
+com.releaseshub.*
+com.relevantcodes.*
+com.relewise.client.*
+com.relops.*
+com.reman8683.*
+com.remisiki.*
+com.remitly.*
+com.remondis.*
+com.remondis.cdc.*
+com.remondis.limbus.*
+com.remote4me.*
+com.remoteflags.*
+com.rempl.*
+com.rempl.plugins.*
+com.rempl.profiles.*
+com.rempl.readers.*
+com.rempl.readers.its.*
+com.rempl.readers.scm.*
+com.rempl.reporters.*
+com.renfrowtech.*
+com.rengwuxian.materialedittext.*
+com.renomad.*
+com.rentpath.*
+com.reorz.yapa.*
+com.replash.*
+com.replyyes.*
+com.reportyy.*
+com.reprezen.genflow.*
+com.reprezen.jsonoverlay.*
+com.reprezen.kaizen.*
+com.reprezen.rapidml.*
+com.republicate.*
+com.republicate.kddl.*
+com.republicate.kson.*
+com.republicate.modality.*
+com.reputation.spark.*
+com.resare.id3j.*
+com.resare.jresolver.*
+com.resare.repackage.*
+com.researchspace.*
+com.researchworx.cresco.*
+com.resend.*
+com.resend.api.*
+com.resonate.analytics-android.*
+com.rest4j.*
+com.restapijs.*
+com.restbusters.*
+com.restfb.*
+com.restfuse.*
+com.restphone.*
+com.retailmenot.*
+com.retailmenot.scaffold.*
+com.retargetly.android.relib.*
+com.retargetly.relib.*
+com.retarus.fax.*
+com.reteno.*
+com.rethinkdb.*
+com.reubenpeeris.*
+com.reubenpeeris.maven.*
+com.reuters.*
+com.reveldigital.*
+com.revelytix.*
+com.revengemission.commons.*
+com.revengemission.plugins.*
+com.revenuecat.purchases.*
+com.revinate.*
+com.revolsys.open.*
+com.revolut.*
+com.revolut.data.*
+com.revolut.flowdata.*
+com.revolut.kompot.*
+com.revolut.recyclerkit.*
+com.revolut.rxdata.*
+com.revolut.utils.*
+com.revolutionanalytics.deployr.*
+com.revtekk.*
+com.revtwo.*
+com.rewardsnetwork.*
+com.rexsl.*
+com.reyallan.*
+com.reyun.*
+com.rezzedup.util.*
+com.rfksystems.*
+com.rgi-corp.*
+com.rgi-corp.sqldroid.*
+com.rhcloud.*
+com.rhcloud.mongodb.*
+com.rheagroup.*
+com.rhemsolutions.*
+com.rhythm.louie.*
+com.rhythm.louie.swagr.*
+com.ribbonapp.*
+com.ribell.*
+com.ricardo-trindade.*
+com.ricardoespsanto.*
+com.richodemus.dropwizard-jwt.*
+com.richodemus.scanner.*
+com.rickbusarow.DispatcherProvider.*
+com.rickbusarow.autoreset.*
+com.rickbusarow.dispatch.*
+com.rickbusarow.dispatcherprovider.*
+com.rickbusarow.docusync.*
+com.rickbusarow.doks.*
+com.rickbusarow.hermit.*
+com.rickbusarow.kgx.*
+com.rickbusarow.ktlint.*
+com.rickbusarow.ktrules.*
+com.rickbusarow.module-check.*
+com.rickbusarow.modulecheck.*
+com.rickbusarow.tangle.*
+com.rickclephas.kmm.*
+com.rickclephas.kmp.*
+com.rickclephas.kmp.nativecoroutines.*
+com.ricoh360.thetaclient.*
+com.ridgid.*
+com.ridgid.oss.*
+com.ridgid.public.*
+com.ridkorfid.*
+com.riemersict.*
+com.rightbrainnetworks.*
+com.rightutils.*
+com.rimerosolutions.ant.*
+com.rimerosolutions.maven.plugins.*
+com.rimlook.framework.*
+com.rindap.*
+com.ringcentral.*
+com.ringcentral.platform.metrics.*
+com.ringcentral.video.*
+com.ripplargames.*
+com.ripple.cryptoconditions.*
+com.ripstech.api.*
+com.ripstech.maven.*
+com.ripzery.*
+com.riscure.*
+com.risingauto.gateway.*
+com.risingwave.*
+com.riskalyze.*
+com.riskfocusinc.*
+com.riskified.*
+com.riskiq.*
+com.riskiq.mapreduce.*
+com.riskrieg.*
+com.risksense.*
+com.ritense.valtimo.*
+com.rivdata.*
+com.river-kt.*
+com.rivescript.*
+com.rivieracode.*
+com.rivtower.*
+com.rjohnst.hudson.plugins.concordionpresenter.*
+com.rklaehn.*
+com.rm5248.*
+com.rmn.*
+com.rms.miu.*
+com.rmtheis.*
+com.rnkrsoft.*
+com.rnkrsoft.apidoc.*
+com.rnkrsoft.bopomofo4j.*
+com.rnkrsoft.config.*
+com.rnkrsoft.embedded.*
+com.rnkrsoft.framework.*
+com.rnkrsoft.groundwork.*
+com.rnkrsoft.io4j.*
+com.rnkrsoft.logger4j.*
+com.rnkrsoft.logtrace4j.*
+com.rnkrsoft.platform.*
+com.rnkrsoft.reflection4j.*
+com.rnkrsoft.skeleton4j.*
+com.roadmm.lu.*
+com.roaringcatgames.kitten2d.ashley.*
+com.robbypond.*
+com.robeja.mojo.*
+com.robertboothby.*
+com.robertboothby.djenni.*
+com.robertlevonyan.components.*
+com.robertlevonyan.compose.*
+com.robertlevonyan.view.*
+com.robertoestivill.intentbuilder.*
+com.robertoestivill.ytsclient.*
+com.robestone.hudson.*
+com.robinhood.spark.*
+com.robinhood.ticker.*
+com.robinhowlett.*
+com.robinpowered.*
+com.robinvandenhurk.gateway.library.*
+com.robo4j.*
+com.robotaccomplice.*
+com.robotemi.*
+com.roboxue.*
+com.robrua.*
+com.robrua.nlp.*
+com.robrua.nlp.models.*
+com.robypomper.*
+com.robypomper.josp.*
+com.rocana.*
+com.roche.*
+com.roche.spock.geb.*
+com.rockagen.*
+com.rockerhieu.*
+com.rockerhieu.emojicon.*
+com.rockerhieu.rvadapter.*
+com.rocket-labs.*
+com.rocketfuel.scylladb.*
+com.rocketfuel.sdbc.*
+com.rocketfuel.sdbc.cassandra.*
+com.rocketfuel.sdbc.h2.*
+com.rocketfuel.sdbc.jdbc.*
+com.rocketfuel.sdbc.postgresql.*
+com.rocketfuel.sdbc.scalaz.*
+com.rocketfuel.sdbc.sqlserver.*
+com.rocksdata.*
+com.rockset.*
+com.rockymadden.delimited.*
+com.rockymadden.jbrainhoney.*
+com.rockymadden.stringmetric.*
+com.rockyyu.*
+com.rodiontsev.maven.plugins.*
+com.rogiel.httpchannel.*
+com.rogiel.httpchannel.captcha.*
+com.rogiel.httpchannel.services.*
+com.rogoman.*
+com.rogueai.*
+com.roguedevs.*
+com.rojanthomas.*
+com.rojoma.*
+com.roku.*
+com.rokuality.*
+com.rolandopalermo.facturacion.ec.*
+com.rolfje.anonimatron.*
+com.rollbar.*
+com.romainpiel.shimmer.*
+com.romainpiel.svgtoandroid.*
+com.romanpierson.*
+com.romellfudi.permission.*
+com.romellfudi.store.*
+com.romellfudi.ussdlibrary.*
+com.rometools.*
+com.roncemer.spark.*
+com.roncoo.*
+com.rong360.*
+com.rongji.dfish.*
+com.rongjih.*
+com.rongyiapp.*
+com.rongzhiweilai.extension.*
+com.rookiefly.open.shardbatis.*
+com.rookmotion.android.*
+com.rookout.*
+com.roomorama.*
+com.rootroo.*
+com.rooxteam.uidm.clients.*
+com.rooxteam.uidm.sdk.*
+com.rosaloves.*
+com.rosberry.android.*
+com.rosberry.android.lint.*
+com.roscopeco.*
+com.roscopeco.jasm.*
+com.roscopeco.moxy.*
+com.rosegun.*
+com.rosette.elasticsearch.*
+com.roshka.sifen.*
+com.rossabaker.*
+com.rotilho.jnano.*
+com.roubsite.*
+com.roudikk.compose-navigator.*
+com.roudikk.guia.*
+com.rouesnel.*
+com.roundeights.*
+com.roundtriangles.games.*
+com.rounx.android.*
+com.routing4you.*
+com.rover12421.*
+com.rover12421.AndroidHideApi.*
+com.rover12421.android.*
+com.rover12421.android.godmodel.*
+com.rover12421.android.godmodel.hash.*
+com.rover12421.android.godmodel.namehash.*
+com.rover12421.android.godmodel.removeAnnotation.*
+com.rover12421.android.hide.*
+com.rover12421.opensource.*
+com.rover12421.phoenix.*
+com.rover12421.stringfog.*
+com.rovio.ingest.*
+com.rpamis.*
+com.rpiaggio.*
+com.rplees.*
+com.rpuch.micrometer.*
+com.rpuch.more-testcontainers.*
+com.rpuch.pulsar-reactive-client.*
+com.rqba.*
+com.rrs-apps.java.jirclib.*
+com.rsdx.*
+com.rsdx.shop.*
+com.rtbhouse.*
+com.rtbhouse.model.*
+com.rte-france.powsybl.*
+com.rtomchinsky.*
+com.rtstatistics.*
+com.rubanau.*
+com.rubenmathews.*
+com.rubensousa.*
+com.rubensousa.dpadrecyclerview.*
+com.rubensousa.lista.*
+com.rubiconproject.*
+com.rubiconproject.oss.*
+com.rudderstack.android.amplitude.*
+com.rudderstack.android.consentfilter.*
+com.rudderstack.android.integration.*
+com.rudderstack.android.integration.amplitude.*
+com.rudderstack.android.sdk.*
+com.rudderstack.android.snowplow.*
+com.rudderstack.kotlin.sdk.*
+com.rudderstack.sdk.java.*
+com.rudderstack.sdk.java.analytics.*
+com.rudikershaw.*
+com.rudikershaw.gitbuildhook.*
+com.rudolfschmidt.*
+com.rudolfschmidt.http.*
+com.ruesga.phoenix.*
+com.ruesga.timeline-chart-view.*
+com.ruiandrebatista.*
+com.ruibty.nsfw.*
+com.ruijc.*
+com.ruimo.*
+com.ruishanio.*
+com.ruizdev.*
+com.rulelearner.*
+com.ruleoftech.*
+com.rultor.*
+com.runetopic.cache.*
+com.runjf.mybatis.*
+com.runsidekick.*
+com.runthered.sdk.*
+com.runtimeverification.rvmonitor.*
+com.ruslankishai.*
+com.russhwolf.*
+com.rusticisoftware.cloud.v2.client.*
+com.rusticisoftware.hostedengine.client.*
+com.rustknife.jknife.*
+com.rusty-raven.*
+com.ruterfu.*
+com.rws.lt.lc.public-api.*
+com.ryaltech.utils.spring.encryption.*
+com.ryanbing.*
+com.ryanbrozo.*
+com.ryanchapin.util.*
+com.ryandens.*
+com.ryanharter.android-gesture-detectors.*
+com.ryanharter.android.gl.*
+com.ryanharter.android.tooltips.*
+com.ryanharter.auto.value.*
+com.ryanharter.gradle-git-repo.*
+com.ryanharter.ktor.*
+com.ryanharter.spinner-date-picker.*
+com.ryanjbaxter.spring.cloud.*
+com.ryanjeffreybrooks.*
+com.ryanseys.*
+com.ryanstull.*
+com.ryansusana.asyncfx.*
+com.ryantenney.log4j.*
+com.ryantenney.metrics.*
+com.ryantenney.passkit4j.*
+com.ryft.*
+com.ryftpay.*
+com.rymcu.*
+com.rythan.*
+com.ryuta46.*
+com.s24.*
+com.s24.ant.*
+com.s24.search.solr.*
+com.s24.tomcat.*
+com.s4nderdevelopment.*
+com.saaavsaaa.*
+com.saaavsaaa.tools.*
+com.saadahmedev.helper-widget.*
+com.saadahmedev.kotlin-helper.*
+com.saadahmedev.popup-dialog.*
+com.saadahmedev.short-intent.*
+com.saadahmedev.shortintent.*
+com.saadahmedev.tinydb.*
+com.saadahmedev.x-doc.*
+com.sababado.android.*
+com.sababado.circularview.*
+com.sabre.oss.conf4j.*
+com.sabre.oss.yare.*
+com.saburto.*
+com.sachinhandiekar.*
+com.sackcentury.*
+com.sada.cloudsearch.identity.*
+com.sadhen.binding.*
+com.safaribooks.*
+com.safeboda.*
+com.safecharge.*
+com.safelayer.*
+com.safelayer.test.*
+com.safelayer.test.rap.*
+com.safelayer.test.rap.pki.*
+com.safelayer.test.rap.pki.model.*
+com.safelayer.test.rap.rest.*
+com.safelayer.test.trustedx.rap.*
+com.safetorun.*
+com.safety-data.*
+com.sageserpent.*
+com.sagframe.*
+com.sagiantebi.*
+com.sagisu.*
+com.sailpoint.*
+com.sailthru.*
+com.sailthru.android.*
+com.sailthru.client.*
+com.sairaghava.*
+com.salaryrobot.*
+com.salecycle.*
+com.salesboxai.zoom.*
+com.salesfly.*
+com.salesforce.*
+com.salesforce.aptspring.*
+com.salesforce.argus.*
+com.salesforce.cantor.*
+com.salesforce.centrifuge.*
+com.salesforce.cqe.*
+com.salesforce.cte.*
+com.salesforce.dockerfile-image-update.*
+com.salesforce.einsteinbot.*
+com.salesforce.formula.*
+com.salesforce.functions.*
+com.salesforce.gorp.*
+com.salesforce.grammaticus.*
+com.salesforce.i18n.*
+com.salesforce.kafka.test.*
+com.salesforce.maven.*
+com.salesforce.mce.*
+com.salesforce.mirus.*
+com.salesforce.mobilesdk.*
+com.salesforce.perfeng.uiperf.*
+com.salesforce.servicelibs.*
+com.salesforce.sld4j.*
+com.salesforce.storm.*
+com.salesforce.transmogrifai.*
+com.salesforce.utam.*
+com.salesforce.vador.*
+com.salesforceiq.augmenteddriver.*
+com.saltedge.connector.sdk.*
+com.samajackun.arco.*
+com.samares-engineering.omf.2021x_R2.*
+com.samaxes.cachefilter.*
+com.samaxes.filter.*
+com.samaxes.maven.*
+com.samaxes.secure.tag.*
+com.samaxes.securetag.*
+com.samaxes.stripejb3.*
+com.samaxes.stripes.*
+com.samaxes.stripes.ejb3.*
+com.samaxes.taglib.*
+com.samboom.*
+com.samczsun.*
+com.samebug.notifier.*
+com.samjakob.*
+com.samlic.*
+com.samneirinck.*
+com.samruston.*
+com.samsaodev.*
+com.samsaodev.daterangecalendarview.*
+com.samsaodev.swipeable-list-item.*
+com.samsaodev.vertical-floating-menu.*
+com.samsix.*
+com.samskivert.*
+com.samskivert.scaled.*
+com.samstarling.*
+com.samsung.android.spay.*
+com.samsungknox.api.*
+com.samsungsds.analyst.*
+com.samsungxr.*
+com.samudroid.*
+com.samuelbirocchi.*
+com.samuraism.*
+com.sancromeu.*
+com.sanctionco.jmail.*
+com.sanctionco.opconnect.*
+com.sanctionco.thunder.*
+com.sandeepkaul.*
+com.sandflow.*
+com.sandinh.*
+com.sandjelkovic.kxjtime.*
+com.sandpolis.*
+com.sangupta.*
+com.sanhert.*
+com.sanjuthomas.*
+com.sap.activiti.common.*
+com.sap.apimgmt.*
+com.sap.apimgmt.client.sdk.*
+com.sap.cds.*
+com.sap.cds.repackaged.*
+com.sap.cloud.*
+com.sap.cloud.adk.*
+com.sap.cloud.ans.*
+com.sap.cloud.client.*
+com.sap.cloud.connectivity.*
+com.sap.cloud.connectivity.apiext.*
+com.sap.cloud.db.jdbc.*
+com.sap.cloud.environment.servicebinding.*
+com.sap.cloud.environment.servicebinding.api.*
+com.sap.cloud.gw.xsa.*
+com.sap.cloud.instancemanager.*
+com.sap.cloud.lm.sl.*
+com.sap.cloud.lm.sl.cf.*
+com.sap.cloud.mkt.*
+com.sap.cloud.mt.*
+com.sap.cloud.pdms.sdk.*
+com.sap.cloud.platform.mobile.services.*
+com.sap.cloud.s4hana.*
+com.sap.cloud.s4hana.archetypes.*
+com.sap.cloud.s4hana.cloudplatform.*
+com.sap.cloud.s4hana.datamodel.*
+com.sap.cloud.s4hana.frameworks.*
+com.sap.cloud.s4hana.plugins.*
+com.sap.cloud.s4hana.quality.*
+com.sap.cloud.s4hana.services.*
+com.sap.cloud.s4hana.starters.*
+com.sap.cloud.script.*
+com.sap.cloud.sdk.*
+com.sap.cloud.sdk.archetypes.*
+com.sap.cloud.sdk.cloudplatform.*
+com.sap.cloud.sdk.datamodel.*
+com.sap.cloud.sdk.frameworks.*
+com.sap.cloud.sdk.plugins.*
+com.sap.cloud.sdk.quality.*
+com.sap.cloud.sdk.s4hana.*
+com.sap.cloud.sdk.services.*
+com.sap.cloud.sdk.testutil.*
+com.sap.cloud.security.*
+com.sap.cloud.security.xsuaa.*
+com.sap.cloud.server-odata.*
+com.sap.cloud.servicesdk.*
+com.sap.cloud.servicesdk.archetypes.*
+com.sap.cloud.servicesdk.cds.tools.*
+com.sap.cloud.servicesdk.cloudplatform.*
+com.sap.cloud.servicesdk.csn2jpa.*
+com.sap.cloud.servicesdk.frameworks.*
+com.sap.cloud.servicesdk.prov.*
+com.sap.cloud.servicesdk.xbem.*
+com.sap.cloud.sjb.*
+com.sap.cloud.sjb.cf.*
+com.sap.cloud.sjb.xs.*
+com.sap.cloud.spring.boot.*
+com.sap.cloud.yaas.builder.*
+com.sap.cloud.yaas.patterns.*
+com.sap.cloud.yaas.raml-parser.*
+com.sap.cloud.yaas.rammler.*
+com.sap.cloud.yaas.service-generator.*
+com.sap.cloud.yaas.service-sdk.*
+com.sap.devops.cmclient.*
+com.sap.foss.hana.*
+com.sap.hana.cloud.*
+com.sap.hana.datalake.files.*
+com.sap.hana.di.*
+com.sap.hcp.cf.logging.*
+com.sap.lmsl.slp.*
+com.sap.odata.*
+com.sap.oss.phosphor.*
+com.sap.prd.mobile.ios.maven.plugins.*
+com.sap.prd.mobile.ios.mios.*
+com.sap.prd.mobile.ios.ota.*
+com.sap.research.security.vulas.*
+com.sap.scimono.*
+com.sap.scimono.examples.*
+com.sap.ui5.inspector.*
+com.sap.xs.*
+com.sap4j.*
+com.sapient.azure.*
+com.saplo.*
+com.sappenin.ms.activitystrea.*
+com.sappenin.objectify.*
+com.sappenin.utils.*
+com.sappenin.utils.appengine.*
+com.sappenin.utils.rest.*
+com.saptarshidebnath.utilities.*
+com.sarahlensing.*
+com.sarahlensing.staggeredgridview.*
+com.sarbacane.*
+com.sarehub.*
+com.sargeraswang.util.*
+com.sarhanm.*
+com.sarod.equinox.config.builder.*
+com.sarveshathawale.*
+com.sasak-ui.*
+com.satalia.solveengine.*
+com.satismeter.*
+com.satori.*
+com.satori.streambots.*
+com.satsuware.mdutils.*
+com.saucelabs.*
+com.saucelabs.bamboo.*
+com.saucelabs.maven.plugin.*
+com.saucelabs.selenium.*
+com.saucelabs.visual.*
+com.saucesubfresh.*
+com.sauldhernandez.*
+com.sauloaraujo.*
+com.saulpower.communication.*
+com.saulpower.fayeclient.*
+com.savage7.maven.plugins.*
+com.saveourtool.cosv4k.*
+com.saveourtool.kompiledb.*
+com.saveourtool.osv4k.*
+com.saveourtool.sarifutils.*
+com.saveourtool.save.*
+com.savillians.gradle.*
+com.savl.bitcoin.*
+com.savl.ripple.*
+com.savoirtech.*
+com.savoirtech.aetos.*
+com.savoirtech.eos.*
+com.savoirtech.hecate.*
+com.savoirtech.json.*
+com.savoirtech.karaf.commands.*
+com.savoirtech.karakka.*
+com.savoirtech.logging.*
+com.savvasdalkitsis.*
+com.saygoer.*
+com.saylorsolutions.*
+com.saynomoo.*
+com.sayrmb.guard.*
+com.sayrmb.log.*
+com.sayweee.*
+com.sberlabs.*
+com.sbuslab.*
+com.sbxcloud.java.spring.*
+com.scalableminds.*
+com.scalachan.*
+com.scalacraft.domain.*
+com.scalapenos.*
+com.scalar-labs.*
+com.scalarx.*
+com.scalasci.*
+com.scalatags.*
+com.scalatsi.*
+com.scalawilliam.*
+com.scalawilliam.esbeetee.*
+com.scalawilliam.especially.*
+com.scalefunction.lianluo.*
+com.scalepoint.*
+com.scaleset.*
+com.scaleton.dfinity.*
+com.scalified.*
+com.scality.*
+com.scalyr.*
+com.scandit.datacapture.*
+com.scandit.datacapture.frameworks.*
+com.scandit.shelf.*
+com.scanoss.*
+com.scanzy.*
+com.scapeak.*
+com.scarabresearch.*
+com.scarabsoft.*
+com.scarletentropy.*
+com.scayle.storefrontapi.*
+com.sceyt.*
+com.schemaapp.*
+com.schibsted.account.*
+com.schibsted.security.*
+com.schibsted.spt.data.*
+com.schmonz.*
+com.schmonz.whenalltestsweregreen.*
+com.schuerger.math.*
+com.schuwalow.*
+com.sciencesakura.*
+com.scientiamobile.wurflcloud.*
+com.scientiamobile.wurflmicroservice.*
+com.sciformation.oelib.*
+com.scireum.*
+com.scitotec.kotlinjpautils.*
+com.sclasen.*
+com.scleradb.*
+com.scloudic.*
+com.scmspain.*
+com.scmspain.karyon.*
+com.scompt.hidablepassword.*
+com.scopely.*
+com.scoperetail.*
+com.scoperetail.automata.*
+com.scoperetail.commons.*
+com.scoperetail.fusion.*
+com.scoperetail.pom.*
+com.scoperetail.simurai.*
+com.scorpiac.javarant.*
+com.scottescue.*
+com.scottyab.*
+com.scraperapi.*
+com.screenshotone.jsdk.*
+com.scriptbasic.*
+com.scrtwpns.*
+com.scryetek.*
+com.scudata.esproc.*
+com.scuilion.syntastic.*
+com.scurab.*
+com.scurrilous.*
+com.scvngr.*
+com.scylladb.*
+com.sdcalmes.*
+com.sdchang.*
+com.sdercolin.harmoloid.*
+com.sdercolin.utaformatix.*
+com.sdeting.utils.*
+com.sdibt.*
+com.sdicons.jsontools.*
+com.sdk4.*
+com.sdk4.cloud.*
+com.sdk4.common.*
+com.sdklite.*
+com.sdklite.firkit.*
+com.sdklite.jacoco.*
+com.sdklite.log.*
+com.sdklite.matrix.*
+com.sdklite.publishing.*
+com.sdklite.rpc.*
+com.sdklite.sphere.*
+com.sdklite.spi.*
+com.sdklite.trace.*
+com.sdklite.yql.*
+com.sdl.*
+com.sdl.audiencemanager.*
+com.sdl.delivery.*
+com.sdl.delivery.ish.*
+com.sdl.dxa.*
+com.sdl.dxa.modules.*
+com.sdl.lt.*
+com.sdl.lt.lc.json.streaming.*
+com.sdl.oss.*
+com.sdl.sdk.*
+com.sdl.tridion.connectorframework.*
+com.sdl.tridion.remoting.*
+com.sdl.tridion.xo.*
+com.sdl.web.*
+com.sdl.web.pca.*
+com.sdnlab.*
+com.sdoctech.*
+com.seagate.kinetic.*
+com.seaglasslookandfeel.*
+com.seaglasslookandfeel.siteskin.*
+com.sealwu.*
+com.sealwu.jsontokotlin.*
+com.seamlesspay.*
+com.seamlesspay.api.*
+com.seamlesspay.sdk.*
+com.seamlesspay.ui.*
+com.seancheatham.*
+com.seanchenxi.gwt.*
+com.seanjstory.workplace.search.*
+com.seanox.*
+com.seanproctor.*
+com.seanshubin.detangler.*
+com.seanshubin.devon.*
+com.seanshubin.http.values.*
+com.seansoper.*
+com.seantone.xsdk.*
+com.search3r.*
+com.searchunify.*
+com.seavus.*
+com.seavus.beanalias.*
+com.sebastian-daschner.*
+com.sebastianmarschall.*
+com.sebastianneubauer.*
+com.sebastianneubauer.jsontree.*
+com.sebchlan.javacensor.*
+com.sebchlan.picassocompat.*
+com.seceh.*
+com.secretbiology.helpers.*
+com.securenative.java.*
+com.secureops.*
+com.securevale.*
+com.securionpay.*
+com.seebo.*
+com.seejoke.*
+com.seelyn.*
+com.seepine.*
+com.seeq.*
+com.seeq.link.*
+com.seeq.shaded.*
+com.seeq.utilities.*
+com.seerbit.*
+com.seeuletter.*
+com.seezoon.*
+com.seezoon.framework.*
+com.seezoon.grpc.*
+com.seezoon.maven.plugins.*
+com.sefford.*
+com.segbaus.*
+com.segfly.graml.*
+com.segmeno.*
+com.segment.*
+com.segment.analytics.android.*
+com.segment.analytics.android.integrations.*
+com.segment.analytics.android.middlewares.*
+com.segment.analytics.java.*
+com.segment.analytics.kotlin.*
+com.segment.analytics.kotlin.destinations.*
+com.segment.backo.*
+com.segment.cartographer.*
+com.segment.publicapi.*
+com.segmentify.sdk.*
+com.segway.robot.*
+com.seifernet.*
+com.seismicgames.*
+com.seitenbau.testing.*
+com.selectdb.*
+com.selectpdf.*
+com.seleniti.ioccommons.*
+com.seleniumtests.*
+com.seleritycorp.common.base.*
+com.seleritycorp.context.*
+com.seleritycorp.pom.*
+com.seleritycorp.rds.downloader.*
+com.selesse.*
+com.selgp.moladek.*
+com.selgp.opensauce.*
+com.selligent.sdk.*
+com.sellware.quarkus-temporal.*
+com.semanticcms.*
+com.semanticmart.alphaid.*
+com.semantics3.*
+com.semaphr.*
+com.sematext.*
+com.sematext.ag.*
+com.sematext.android.*
+com.sematext.autocomplete.*
+com.sematext.elasticsearch.*
+com.sematext.hbasehut.*
+com.sematext.hbasewd.*
+com.sematext.nlp.*
+com.sematext.querysegmenter.*
+com.sematext.solr.*
+com.sematext.spm.*
+com.sematext.spring.*
+com.semperos.*
+com.senacor.elasticsearch.evolution.*
+com.sencha.gxt.*
+com.sencha.gxt.archetypes.*
+com.sendgrid.*
+com.sendgrid.labs.*
+com.sendinblue.*
+com.sendsafely.*
+com.sense2act.*
+com.senseidb.*
+com.senseidb.clue.*
+com.senseidb.zoie.*
+com.senseidb.zu.*
+com.sensifai.java.*
+com.sensorsdata.analytics.abtesting.*
+com.sensorsdata.analytics.android.*
+com.sensorsdata.analytics.harmony.*
+com.sensorsdata.analytics.javasdk.*
+com.sensorsdata.focus.*
+com.sensorsdata.provider.*
+com.senspark.ee.*
+com.sentenial.*
+com.senzhikong.*
+com.senzing.*
+com.seoduct.*
+com.seomse.api.*
+com.seomse.commons.*
+com.seomse.crawling.*
+com.seomse.cypto.*
+com.seomse.jdbc.*
+com.seomse.poi.*
+com.seomse.stock.*
+com.seomse.sync.*
+com.seomse.system.*
+com.seomse.trading.*
+com.seosh817.*
+com.seovic.coherence.*
+com.seovic.maven.plugins.*
+com.seq.*
+com.sequencing.*
+com.sequoiadb.*
+com.sequoiadb.flink.*
+com.sequsoft.maven.plugins.*
+com.serebit.strife.*
+com.sergiandreplace.*
+com.sergiomartinrubio.*
+com.serhatsurguvec.libraries.*
+com.seriouszyx.*
+com.serjltt.moshi.*
+com.serloman.imagecachedownloader.*
+com.serphacker.serposcope.*
+com.serphacker.webace.*
+com.serphacker.webaxe.*
+com.serviceenabled.*
+com.servicelibre.*
+com.serviceobjects.*
+com.servicerocket.*
+com.servicerocket.confluence.plugin.*
+com.servicerocket.confluence.randombits.*
+com.servicerocket.randombits.*
+com.servlets.*
+com.servprise.maven.plugins.*
+com.servprise.webreboot.*
+com.seuic.sdk.*
+com.sevenbridges.apiclient.*
+com.seventythree-apps.*
+com.severell.*
+com.sevidev.*
+com.sevlow.logback.*
+com.sevlow.rain.*
+com.sezinkarli.*
+com.sezzle.*
+com.sfappworks.*
+com.sfeir.gwt.*
+com.sfhuskie.plugins.*
+com.sflpro.identity.*
+com.sflpro.notifier.*
+com.sfxcode.music.*
+com.sfxcode.nosql.*
+com.sfxcode.paradox.*
+com.sfxcode.sapphire.*
+com.sfxcode.templating.*
+com.sgcharts.*
+com.sgcprojects.*
+com.sgota.commons.*
+com.sgota.springboot.*
+com.sgota.tools.*
+com.shadowoflies.*
+com.shadowvc.*
+com.shahabkondri.*
+com.shailahir.apps.*
+com.shaishavgandhi.*
+com.shaishavgandhi.navigator.*
+com.shaishavgandhi.partition.*
+com.shaishavgandhi.rxads.*
+com.shakebugs.*
+com.shakingearthdigital.*
+com.shalloui.*
+com.shamanland.*
+com.shangsw.*
+com.shankyank.*
+com.shankyank.jni.*
+com.shankyank.mojo.*
+com.shapcode.*
+com.shapesecurity.*
+com.shapesecurity.bandolier.*
+com.shapesecurity.shift.*
+com.shapesecurity.shift.es2016.*
+com.shapesecurity.shift.es2017.*
+com.shapestone.*
+com.sharesrc.*
+com.sharethis.*
+com.sharethrough.*
+com.sharetrace.*
+com.sharksharding.*
+com.sharneng.*
+com.sharpershape.*
+com.sharyuke.view.*
+com.shawnsavour.test-sdk.*
+com.shazam.*
+com.shazam.android.*
+com.shazam.chimprunner.*
+com.shazam.fork.*
+com.shazam.tocker.*
+com.shedhack.*
+com.shedhack.exception.*
+com.shedhack.filter.*
+com.shedhack.maven.*
+com.shedhack.requestbody.*
+com.shedhack.spring.*
+com.shedhack.thread.*
+com.shedhack.tool.*
+com.shedhack.trace.*
+com.sheepyang1993.dsbridge.*
+com.shehabic.*
+com.shehabic.droppy.*
+com.shekhargulati.*
+com.shekhargulati.deduplication.tweet.*
+com.shekhargulati.reactivex.*
+com.shekhargulati.urlcleaner.*
+com.shell-software.*
+com.shenchuangit.*
+com.shepeliev.*
+com.sherlocky.*
+com.shesse.h2ha.*
+com.shiehub.*
+com.shield-solutions.*
+com.shift4.*
+com.shiftconnects.android.auth.*
+com.shiftconnects.android.location.*
+com.shiftconnects.android.push.*
+com.shigengyu.*
+com.shikhir.*
+com.shimkiv.*
+com.shinesolutions.*
+com.shinitech.djammadev.*
+com.shinyhut.*
+com.shionfujie.rxstatemachine.*
+com.shipdream.*
+com.shipengine.*
+com.shirishkoirala.*
+com.shiroumi.*
+com.shivamkapoor.*
+com.shixinke.utils.*
+com.shocknode.*
+com.shogo82148.ribbonizer.*
+com.shopify.graphql.support.*
+com.shopify.mobilebuysdk.*
+com.shopify.promises.*
+com.shopify.syrup.*
+com.shopify.testify.*
+com.shopiroller.*
+com.shopiroller.uikit.*
+com.shopizer.*
+com.shoprunner.*
+com.shortcutmedia.shortcut.sdk.*
+com.shoutoutsoftware.*
+com.shoutpoint.*
+com.showapi.javasdk.*
+com.shr25.*
+com.shr25.common.*
+com.shr25.mirai.*
+com.shr25.robot.*
+com.shr25.robot.plugin.*
+com.shrevl.*
+com.shrikantkale.anuj.*
+com.shrralis.*
+com.shumeit.sdk.*
+com.shushanfx.*
+com.shyp.supertooltips.*
+com.shzcloud.*
+com.sianav.*
+com.siashan.*
+com.sibilantsolutions.grison.*
+com.sibilantsolutions.iptools.*
+com.sibilantsolutions.utils.*
+com.sibvisions.external.jvxfx.*
+com.sibvisions.help.*
+com.sibvisions.jvx.*
+com.sibvisions.vaadin.*
+com.sickmartian.calendarview.*
+com.siddroid.*
+com.sidemash.*
+com.sidewayscoding.*
+com.sideyf.*
+com.sidooo.*
+com.siemens.ct.exi.*
+com.siemens.oss.industrialbenchmark.*
+com.siemens.oss.omniproperties.*
+com.siemensqms.*
+com.siemensqms.qmsplus.*
+com.siemonster.*
+com.sifionsolution.*
+com.sifive.*
+com.siftscience.*
+com.sigmaflare.*
+com.signadot.*
+com.signal7.devtools.*
+com.signalcollect.*
+com.signalfuse.public.*
+com.signalfx.*
+com.signalfx.public.*
+com.signaturit.api.*
+com.signavio.workflow.*
+com.signicat.hystrix.*
+com.signnow.*
+com.sigopt.*
+com.sigpwned.*
+com.siirush.*
+com.sikejava.framework.maven.*
+com.sikejava.framework.parent.*
+com.sikulix.*
+com.silamoney.client.*
+com.silanis.esl.*
+com.silanis.integration.*
+com.silentgo.*
+com.silentier.*
+com.silicolife.textmining.*
+com.siliconmtn.*
+com.siloft.*
+com.silvercar.unleash-client-kotlin.*
+com.silvermindsoftware.stripes.*
+com.silverpine.uu.*
+com.silverpop.*
+com.simasteam.*
+com.simbachain.*
+com.simbacode.*
+com.simboss.sdk.*
+com.simiacryptus.*
+com.simiacryptus.skyenet.*
+com.simianquant.*
+com.simla.android.*
+com.simolecule.centres.*
+com.simonecangialosi.*
+com.simonmittag.*
+com.simonsickle.*
+com.simperium.*
+com.simperium.android.*
+com.simplaex.*
+com.simple-http.*
+com.simple-repository.*
+com.simple.*
+com.simplecityapps.*
+com.simplegeo.*
+com.simpleintelligence.*
+com.simplemobiletools.*
+com.simplermi.*
+com.simplestark.*
+com.simplicityapks.*
+com.simplify.*
+com.simpligility.maven.*
+com.simpligility.maven.plugins.*
+com.simpligility.org.apache.maven.plugin-testing.*
+com.simpligility.org.apache.maven.shared.*
+com.simpligility.sonatype.book.*
+com.simpligility.training.*
+com.simplj.di.*
+com.simplj.flows.*
+com.simplj.lambda.*
+com.simplrobot.*
+com.simplybusiness.*
+com.simplyti.cloud.*
+com.simprints.*
+com.simprokdigital.*
+com.simsilica.*
+com.simtechdata.*
+com.sinacloud.java.*
+com.sinaghaffari.*
+com.sinaukoding.*
+com.sinch.*
+com.sinch.android.sdk.verification.*
+com.sinch.jvm.sdk.verification.*
+com.sinch.sdk.*
+com.sindicetech.siren.*
+com.singhinderjeet.*
+com.singingbush.*
+com.singlestore.*
+com.sinkedship.cerberus.*
+com.sinnatec.*
+com.sinneduy.*
+com.sinnerschrader.aem.react.*
+com.sinnerschrader.aem.spa.*
+com.sinnerschrader.metrics.*
+com.sinnerschrader.vw.aem.react.*
+com.sinohope.*
+com.sinosoftgz.*
+com.sinsz.*
+com.sinsz.c.*
+com.sinszm.*
+com.sinszm.sofa.*
+com.sinvay.*
+com.sipfront.sdk.*
+com.sipgate.*
+com.sipios.*
+com.sippnex.*
+com.sippnex.landscape.*
+com.sirding.*
+com.sirika.hchelpers.*
+com.sirika.httpclienthelpers.*
+com.sirika.pymager.*
+com.sirolf2009.*
+com.sirolf2009.neo4j.*
+com.sirtrack.*
+com.sirv.*
+com.site-valley.*
+com.site24x7.apminsight.java.*
+com.site24x7.public.*
+com.sitepark.*
+com.sitewhere.*
+com.sittinglittleduck.*
+com.sitture.*
+com.sixdimensions.coe.util.*
+com.sixdimensions.commons.osgi.wrapper.*
+com.sixdimensions.wcm.cq.*
+com.sixestates.*
+com.sixsixsix516.*
+com.sixsq.slipstream.*
+com.sixt.android.*
+com.sixt.protobuf.*
+com.sixthmass.*
+com.sixthsenseapp.libs.*
+com.sixthsenseapp.superpom.*
+com.sizebay.kikaha.*
+com.skadistats.*
+com.skanders.commons.*
+com.skanders.jbel.*
+com.skanders.rms.*
+com.skanders.service.*
+com.skdragons.*
+com.skelterlabs.*
+com.skew.slsqp4j.*
+com.skillw.asahi.*
+com.skillw.attributesystem.*
+com.skillw.fightsystem.*
+com.skillw.pouvoir.*
+com.skkap.*
+com.skocken.*
+com.skoumal.grimoire.*
+com.skplanet.*
+com.skplanet.syruppay.*
+com.sksamuel.*
+com.sksamuel.aedile.*
+com.sksamuel.akka.*
+com.sksamuel.avro4k.*
+com.sksamuel.avro4s.*
+com.sksamuel.centurion.*
+com.sksamuel.cohort.*
+com.sksamuel.diff.*
+com.sksamuel.eel.*
+com.sksamuel.eels.*
+com.sksamuel.elastic4s.*
+com.sksamuel.elasticsearch.*
+com.sksamuel.exts.*
+com.sksamuel.gwt.*
+com.sksamuel.hadoop-streams.*
+com.sksamuel.healthcheck.*
+com.sksamuel.hoplite.*
+com.sksamuel.http4k.*
+com.sksamuel.jmxc.*
+com.sksamuel.jqm4gwt.*
+com.sksamuel.kafka.*
+com.sksamuel.kafka.embedded.*
+com.sksamuel.kexts.*
+com.sksamuel.koors.*
+com.sksamuel.kquants.*
+com.sksamuel.ktest.*
+com.sksamuel.mallet.*
+com.sksamuel.monkeytail.*
+com.sksamuel.nsq.*
+com.sksamuel.optio.*
+com.sksamuel.pagination.*
+com.sksamuel.princeps.*
+com.sksamuel.pulsar4s.*
+com.sksamuel.quaestor.*
+com.sksamuel.quiver.*
+com.sksamuel.rxhive.*
+com.sksamuel.scala.commons.*
+com.sksamuel.scalafunc.*
+com.sksamuel.scalax.*
+com.sksamuel.scalocity.*
+com.sksamuel.scalper.*
+com.sksamuel.scam.*
+com.sksamuel.scapegoat.*
+com.sksamuel.scoot.*
+com.sksamuel.scoverage.*
+com.sksamuel.scribble.*
+com.sksamuel.scrimage.*
+com.sksamuel.scruffy.*
+com.sksamuel.signum.*
+com.sksamuel.spank.*
+com.sksamuel.tabby.*
+com.sksamuel.tribune.*
+com.skyail.*
+com.skycong.*
+com.skydo.lib.*
+com.skyfishjy.ripplebackground.*
+com.skyflow.*
+com.skylarwatson.*
+com.skynav.*
+com.skynav.ttt.*
+com.skypyb.poet.*
+com.skysql.java.*
+com.slack.api.*
+com.slack.auto.value.*
+com.slack.circuit.*
+com.slack.cli.*
+com.slack.eithernet.*
+com.slack.gradle.*
+com.slack.gradle.apk-versioning.*
+com.slack.gradle.base.*
+com.slack.gradle.root.*
+com.slack.gradle.unit-test.*
+com.slack.keeper.*
+com.slack.lint.*
+com.slack.lint.compose.*
+com.slack.moshi.*
+com.slackworks.*
+com.slamdata.*
+com.sledsoft.android.*
+com.sleepcamel.bsoneer.*
+com.sleepcamel.bsoneer.compiler.*
+com.sleepcamel.bsoneer.compiler.dencoders.*
+com.sleepycat.*
+com.sletmoe.bucket4k.*
+com.slicklog.*
+com.slickqa.*
+com.slickqa.client.*
+com.slimgears.protostuff.*
+com.slimgears.rxrepo.*
+com.slimgears.rxrpc.*
+com.slimgears.utils.*
+com.slimpay.*
+com.slm-dev.*
+com.sludev.commons.*
+com.slyak.*
+com.smaato.switchgear.*
+com.smallaswater.*
+com.smallaswater.easysql.*
+com.smallaswater.npc.*
+com.smallbuer.*
+com.smallnico.*
+com.smalls0098.*
+com.smallsoho.mobcase.*
+com.smarchive.dropwizard.*
+com.smart4y.*
+com.smartahc.android.splitcore.*
+com.smartarmenia.*
+com.smartbear.*
+com.smartbear.readyapi.*
+com.smartbear.readyapi.testserver.cucumber.*
+com.smartcar.sdk.*
+com.smartcodeltd.*
+com.smartdevicelink.*
+com.smartertravel.metrics.aop.*
+com.smartertravel.metrics.config.*
+com.smartfoxpro.util.*
+com.smartgwt.*
+com.smarthito.*
+com.smartitengineering.*
+com.smartitengineering.smart-util.*
+com.smartling.*
+com.smartling.aem.*
+com.smartling.api.*
+com.smartling.cc4j.*
+com.smartling.maven.*
+com.smartlogic.*
+com.smartlogic.cloud.*
+com.smartlogic.csclient.*
+com.smartlogic.modelmanipulation.*
+com.smartlogic.oebatch.*
+com.smartlogic.oeclient.*
+com.smartlogic.sesclient.*
+com.smartlook.*
+com.smartmeapp.com.smartmeapp.monitor.*
+com.smartmeapp.monitor.*
+com.smartmeapp.sdk.*
+com.smartnews.*
+com.smartsensesolutions.*
+com.smartsheet.*
+com.smarttested.*
+com.smartthings.sdk.*
+com.smarttransactions.*
+com.smartydroid.*
+com.smartystreets.api.*
+com.smatechnologies.*
+com.smattme.*
+com.smb-tec.neo4j.*
+com.smb-tec.xo.*
+com.smb-tec.xo.archetypes.*
+com.smile24es.*
+com.smileidentity.*
+com.smith9.geiger.*
+com.smith9.simply.*
+com.smithsocial.*
+com.smoketurner.*
+com.smoketurner.dropwizard.*
+com.smoketurner.notification.*
+com.smoketurner.pipeline.*
+com.smoketurner.snowizard.*
+com.smoketurner.uploader.*
+com.smoope.sdk.*
+com.smoope.utils.*
+com.smparkworld.hiltbinder.*
+com.smparkworld.parkdatetimepicker.*
+com.smsfactor.*
+com.smsjuice.*
+com.smyachenkov.*
+com.sna-projects.cleo.*
+com.sna-projects.kamikaze.*
+com.sna-projects.krati.*
+com.snacktrace.*
+com.snap.adkit.*
+com.snap.appadskit.*
+com.snap.business.sdk.*
+com.snap.camerakit.*
+com.snap.corekit.*
+com.snap.creativekit.*
+com.snap.daggerbrowser.*
+com.snap.loginkit.*
+com.snap.shopping.camerakit.*
+com.snappydb.*
+com.snapyr.sdk.android.*
+com.snda.*
+com.sndo.data.*
+com.sndyuk.*
+com.sneakxy.*
+com.snell.michael.cutlet.*
+com.snell.michael.highlander.*
+com.snell.michael.kawaii.*
+com.sngular.*
+com.snicesoft.*
+com.snilius.*
+com.snilius.aboutit.*
+com.snilius.actionbarpreferenceactivity.*
+com.snilius.appcompatprefactivity.*
+com.snippetexample.*
+com.snourian.micronaut.*
+com.snowflake.*
+com.snowfort.carbon.*
+com.snoworca.*
+com.snowplowanalytics.*
+com.snowtide.*
+com.soartech.*
+com.soashable.activitystreams.*
+com.soashable.jquery.*
+com.soasta.*
+com.soasta.mpulse.*
+com.soasta.touchtest.*
+com.sobercoding.*
+com.sobot.*
+com.sobot.call.*
+com.sobot.chat.*
+com.sobot.library.*
+com.sobot.zcsdk.*
+com.sobte.cqp.*
+com.socialbakers.*
+com.socialbakers.easy-config.*
+com.socialize.*
+com.socialmetrix.*
+com.societegenerale.*
+com.societegenerale.ci-droid.*
+com.societegenerale.ci-droid.tasks-consumer.*
+com.societegenerale.cidroid.*
+com.societegenerale.commons.*
+com.societegenerale.failover.*
+com.societegenerale.github-crawler.*
+com.societegenerale.sonar.openapi.*
+com.societegenerale.sonar.sslr.*
+com.socketlabs.*
+com.socklabs.*
+com.socrata.*
+com.socratica.mobile.*
+com.sodyo.*
+com.soebes.itf.jupiter.extension.*
+com.soebes.junit.jupiter.extensions.resources.*
+com.soebes.maven.extensions.*
+com.soebes.maven.extensions.profiler.test.*
+com.soebes.maven.plugins.*
+com.soebes.maven.plugins.dmg.*
+com.soebes.maven.plugins.mlv.*
+com.soebes.smpp.*
+com.soebes.subversion.sapm.*
+com.soecode.wx-tools.*
+com.soento.*
+com.soento.cms.*
+com.soento.framework.*
+com.soerensen.maven.plugins.*
+com.soerensen.pomedit.*
+com.sofort.*
+com.softamo.*
+com.softbankrobotics.pddl.*
+com.softcand.supsis.*
+com.softfeeder.*
+com.softicar.camt053.*
+com.softicar.platform.*
+com.softlayer.*
+com.softlayer.api.*
+com.softnoesis.shakebug.*
+com.softos.maven.*
+com.softos.net.*
+com.software-crafter.*
+com.software-ninja.*
+com.software.*
+com.software5000.*
+com.softwareloop.*
+com.softwaremagico.*
+com.softwaremill.*
+com.softwaremill.akka-http-session.*
+com.softwaremill.clippy.*
+com.softwaremill.common.*
+com.softwaremill.correlator.*
+com.softwaremill.diffx.*
+com.softwaremill.events.*
+com.softwaremill.gatling-zeromq.*
+com.softwaremill.kmq.*
+com.softwaremill.macmemo.*
+com.softwaremill.macwire.*
+com.softwaremill.magnolia.*
+com.softwaremill.magnolia1_2.*
+com.softwaremill.magnolia1_3.*
+com.softwaremill.neme.*
+com.softwaremill.odelay.*
+com.softwaremill.ox.*
+com.softwaremill.pekko-http-session.*
+com.softwaremill.quicklens.*
+com.softwaremill.reactivekafka.*
+com.softwaremill.retry.*
+com.softwaremill.sbt-softwaremill.*
+com.softwaremill.scalamacrodebug.*
+com.softwaremill.scalaval.*
+com.softwaremill.stringmask.*
+com.softwaremill.sttp.*
+com.softwaremill.sttp.apispec.*
+com.softwaremill.sttp.client.*
+com.softwaremill.sttp.client3.*
+com.softwaremill.sttp.client4.*
+com.softwaremill.sttp.livestub.*
+com.softwaremill.sttp.model.*
+com.softwaremill.sttp.openai.*
+com.softwaremill.sttp.shared.*
+com.softwaremill.sttp.tapir.*
+com.softwaremill.supler.*
+com.softwaremill.tapir.*
+com.softwaremill.testrelease.*
+com.softwaremill.testrelease2.*
+com.softwaremill.undelay.*
+com.softwaresecured.plugin.*
+com.softwaresecured.reshift.*
+com.sogou.module.*
+com.sohu.*
+com.sohu.cache.*
+com.sohu.jafka.*
+com.soklet.*
+com.solab.scalasql.*
+com.solace.*
+com.solace.camel.component.*
+com.solace.cloud.cloudfoundry.*
+com.solace.cloud.core.*
+com.solace.connector.beam.*
+com.solace.connector.core.*
+com.solace.connector.core.archetype.*
+com.solace.connector.core.io.*
+com.solace.connector.core.resource.*
+com.solace.connector.kafka.connect.*
+com.solace.labs.cloud.cloudfoundry.*
+com.solace.labs.spring.boot.*
+com.solace.spring.boot.*
+com.solace.spring.cloud.*
+com.solacecoe.connectors.*
+com.solacecoe.spring.cloud.stream.binders.*
+com.solacesystems.*
+com.solanamobile.*
+com.solarmosaic.client.*
+com.solarmosaic.client.mail-client.*
+com.solidfire.*
+com.solidfire.code.gson.*
+com.solidgate.*
+com.solidstategroup.*
+com.solubris.*
+com.solusguard.*
+com.solusguard.hyperlog.*
+com.solutionappliance.*
+com.solveurits.*
+com.solvoj.zxing-java6.*
+com.somainer.*
+com.sombrainc.*
+com.some-sec.libs.*
+com.someok.*
+com.somospnt.*
+com.somtacode.*
+com.sonalake.*
+com.sonar-scala.*
+com.sonatype.clm.*
+com.sonatype.insight.*
+com.sonatype.nexus.*
+com.sondertara.*
+com.songminju.*
+com.sonian.*
+com.sonicbase.*
+com.sonicbottle.*
+com.sonluo.*
+com.sonoport.*
+com.sonsure.*
+com.sonyericsson.hudson.plugins.gerrit.*
+com.sonyericsson.hudson.plugins.rebuild.*
+com.sonymobile.*
+com.sonymobile.tools.gerrit.*
+com.sop4j.*
+com.sopinet.*
+com.sopranoworks.*
+com.sorcix.*
+com.sorrowblue.jetpack.*
+com.sorrowblue.twitlin.*
+com.sorskod.webserver.*
+com.sortable.*
+com.sos-berlin.*
+com.sos-berlin.jobscheduler.engine.*
+com.sosovia.*
+com.soterianetworks.*
+com.sothawo.*
+com.sothree.slidinguppanel.*
+com.souche.open.*
+com.souher.*
+com.soulgalore.*
+com.soulgalore.web.*
+com.soulwarelabs.jcommons.*
+com.soulwarelabs.jparley.*
+com.soulwarelabs.sonatype.*
+com.soundcloud.*
+com.soundcloud.android.*
+com.soundcloud.delect.*
+com.soundcloud.lightcycle.*
+com.sourceallies.beanoh.*
+com.sourceclear.*
+com.sourceclear.headlines.*
+com.sourcecoding.*
+com.sourcegraph.*
+com.sourcemuse.gradle.plugin.*
+com.sourceninja.*
+com.sourcepoint.ccpa_cmplibrary.*
+com.sourcepoint.cmplibrary.*
+com.sourcesense.*
+com.sourcesense.maven.*
+com.sourcesense.solr.*
+com.sourcetohtml.*
+com.sovilo.scratch.*
+com.sovren.*
+com.soychat.*
+com.soywiz.*
+com.soywiz.kirpter.*
+com.soywiz.korge.*
+com.soywiz.korlibs.*
+com.soywiz.korlibs.kbignum.*
+com.soywiz.korlibs.kbox2d.*
+com.soywiz.korlibs.kds.*
+com.soywiz.korlibs.klock.*
+com.soywiz.korlibs.klogger.*
+com.soywiz.korlibs.kmem.*
+com.soywiz.korlibs.kminiorm.*
+com.soywiz.korlibs.korau.*
+com.soywiz.korlibs.korcoutines.*
+com.soywiz.korlibs.korge.plugins.*
+com.soywiz.korlibs.korge.reloadagent.*
+com.soywiz.korlibs.korge2.*
+com.soywiz.korlibs.korgw.*
+com.soywiz.korlibs.korim.*
+com.soywiz.korlibs.korinject.*
+com.soywiz.korlibs.korio.*
+com.soywiz.korlibs.korma.*
+com.soywiz.korlibs.korte.*
+com.soywiz.korlibs.korvi.*
+com.soywiz.korlibs.krypto.*
+com.soywiz.korlibs.ktruth.*
+com.soywiz.korlibs.luak.*
+com.soywiz.kproject.*
+com.soywiz.kproject.root.*
+com.soywiz.kproject.settings.*
+com.spacewl.*
+com.spadesdk.*
+com.sparetimecoders.*
+com.spark-engine.*
+com.sparkcentral.*
+com.sparkjava.*
+com.sparklinedata.*
+com.sparkpost.*
+com.sparkutils.*
+com.sparrowwallet.*
+com.sparrowzoo.*
+com.sparsity.*
+com.spatial4j.*
+com.spatineo.*
+com.spearline.*
+com.specdevs.*
+com.specialprojectslab.*
+com.specshell.maven.*
+com.spectralogic.ds3.*
+com.specyci.*
+com.speechly.*
+com.speechpro.android.*
+com.speedledger.*
+com.speedment.*
+com.speedment.archetypes.*
+com.speedment.build.*
+com.speedment.common.*
+com.speedment.connector.*
+com.speedment.example.*
+com.speedment.fika.*
+com.speedment.generator.*
+com.speedment.jpastreamer.*
+com.speedment.jpastreamer.integration.*
+com.speedment.jpastreamer.integration.cdi.*
+com.speedment.jpastreamer.integration.spring.*
+com.speedment.plugins.*
+com.speedment.runtime.*
+com.speedment.test.*
+com.speedment.tool.*
+com.speedui.*
+com.speedui.android.*
+com.spencerwi.*
+com.spidercoding.*
+com.spikeify.*
+com.spikhalskiy.*
+com.spikhalskiy.futurity.*
+com.spingo.*
+com.spinoco.*
+com.spinpi.*
+com.spinthechoice.*
+com.spirit-testing.testoffice.*
+com.spirit21.*
+com.spirit21.swagger.*
+com.spirytusz.*
+com.spiwer.*
+com.splendo.kaluga.*
+com.splinter-log.*
+com.splittypay.*
+com.splitwise.*
+com.splout.db.*
+com.splunk.*
+com.sporniket.core.*
+com.sporniket.iyzico.*
+com.sporniket.javabeans.*
+com.sporniket.networking.*
+com.sporniket.p3.*
+com.sporniket.scripting.sslpoi.*
+com.sporniket.spring-test-dbunit.*
+com.sporniket.testing.*
+com.sportradar.livedata.sdk.*
+com.sportradar.mts.sdk.*
+com.sportradar.mts.sdk.api.*
+com.sportradar.mts.sdk.app.*
+com.sportradar.mts.sdk.impl.*
+com.sportradar.mts.sdk.impl.di.*
+com.sportradar.mts.sdk.impl.libs.*
+com.sportradar.unifiedodds.sdk.*
+com.spotflock.*
+com.spothero.emailvalidator.*
+com.spothero.volley.*
+com.spotify.*
+com.spotify.android.*
+com.spotify.checkstyle.*
+com.spotify.crunch.*
+com.spotify.data.spydra.*
+com.spotify.dataenum.*
+com.spotify.docgenerator.*
+com.spotify.ffwd.*
+com.spotify.fmt.*
+com.spotify.heroic.*
+com.spotify.metrics.*
+com.spotify.ml.*
+com.spotify.mobius.*
+com.spotify.nativeformat.*
+com.spotify.ruler.*
+com.spotify.sparkey.*
+com.spotify.tracing.*
+com.spotinst.*
+com.spoton.*
+com.spotty-server.*
+com.spotxchange.*
+com.spreadthesource.*
+com.spredfast.kafka.connect.s3.*
+com.spren.*
+com.sprhibrad.*
+com.spring4all.*
+com.springcard.keyple.*
+com.springer.*
+com.springernature.*
+com.springml.*
+com.springrts.*
+com.springrts.springls.*
+com.springsciyon.*
+com.springtip.*
+com.sprinklr.*
+com.sprinthive.tiles.*
+com.sproutigy.*
+com.sproutigy.commons.*
+com.sproutigy.libs.luceneplus.*
+com.sproutsocial.*
+com.spruenker.*
+com.sprylab.android.texturevideoview.*
+com.sprylab.webinloop.*
+com.sprylab.xar.*
+com.spt-development.*
+com.sqality.*
+com.sqality.scct.*
+com.sqlancer.*
+com.sqlapp.*
+com.sqream.*
+com.squants.*
+com.squaredem.*
+com.squarespace.cldr-engine.*
+com.squarespace.cldr.*
+com.squarespace.compiler.*
+com.squarespace.jersey2-guice.*
+com.squarespace.less.*
+com.squarespace.template.*
+com.squareup.*
+com.squareup.affected.paths.*
+com.squareup.anvil.*
+com.squareup.assertj.*
+com.squareup.auto.value.*
+com.squareup.burst.*
+com.squareup.coordinators.*
+com.squareup.curtains.*
+com.squareup.cycler.*
+com.squareup.dagger.*
+com.squareup.dagger.example.*
+com.squareup.duktape.*
+com.squareup.flow.*
+com.squareup.gradle.*
+com.squareup.haha.*
+com.squareup.hephaestus.*
+com.squareup.inject.*
+com.squareup.jnagmp.*
+com.squareup.keywhiz.*
+com.squareup.leakcanary.*
+com.squareup.leakcanary.deobfuscation.*
+com.squareup.logcat.*
+com.squareup.mimecraft.*
+com.squareup.misk.*
+com.squareup.mortar.*
+com.squareup.moshi.*
+com.squareup.okhttp.*
+com.squareup.okhttp.sample.*
+com.squareup.okhttp3.*
+com.squareup.okhttp3.sample.*
+com.squareup.okhttpicu.*
+com.squareup.okio.*
+com.squareup.osstrich.*
+com.squareup.pagerduty.*
+com.squareup.papa.*
+com.squareup.paparazzi.*
+com.squareup.phrase.*
+com.squareup.picasso.*
+com.squareup.picasso3.*
+com.squareup.rack.*
+com.squareup.radiography.*
+com.squareup.retrofit.*
+com.squareup.retrofit.samples.*
+com.squareup.retrofit2.*
+com.squareup.rx.idler.*
+com.squareup.sdk.*
+com.squareup.sort-dependencies.*
+com.squareup.spoon.*
+com.squareup.sqlbrite.*
+com.squareup.sqlbrite2.*
+com.squareup.sqlbrite3.*
+com.squareup.sqldelight.*
+com.squareup.tape2.*
+com.squareup.tart.*
+com.squareup.testing.protolib.*
+com.squareup.tooling.*
+com.squareup.tools.build.*
+com.squareup.trex.*
+com.squareup.whorlwind.*
+com.squareup.wire.*
+com.squareup.workflow.*
+com.squareup.workflow1.*
+com.squashedbug.camunda.bpm.extension.monitor.*
+com.squeakysand.*
+com.squeakysand.devtools.*
+com.squeakysand.jcr.*
+com.squeakysand.jsp.*
+com.squeakysand.osgi.*
+com.squeakysand.schema.javaee.*
+com.squeakysand.sling.*
+com.squedgy.*
+com.squidpony.*
+com.squins.google.fork.schema-org-client.*
+com.squins.media.conversion.*
+com.srcclr.*
+com.srchulo.roundrobin.*
+com.sreenidhi-gsd.*
+com.srikalyan.*
+com.srmarlins.simpleexoplayer.*
+com.srnjak.*
+com.srotya.*
+com.srotya.flume.*
+com.srotya.marauder.*
+com.srotya.minuteman.*
+com.srotya.monitoring.*
+com.srotya.sidewinder.*
+com.srotya.sidewinder.examples.*
+com.srotya.sys.*
+com.srotya.tau.*
+com.srotya.tools.*
+com.srpago.*
+com.srpago.connectionmanager.*
+com.srpago.locationmanager.*
+com.srpago.openkeyboard.*
+com.srpago.sdk.*
+com.srpago.sdk.aio.*
+com.srpago.sdk.wpos.*
+com.srpago.sdkentities.*
+com.srpago.sdkservices.*
+com.srpago.sprinter.*
+com.srpago.storagemanager.*
+com.ssg.tools.*
+com.sshtools.*
+com.ssomai.*
+com.sta-soft.*
+com.stableforever.*
+com.stabletechs.*
+com.stabtechs.*
+com.stackdriver.*
+com.stackhour.lib.*
+com.stackify.*
+com.stackmob.*
+com.stackspot.*
+com.stackspot.openapi.*
+com.stackspot.springboot.*
+com.stackstate.*
+com.staffbase.*
+com.stakater.kubernetes.*
+com.stakkfactory.mediacache.*
+com.stalary.*
+com.stalary.easydoc.*
+com.stalecode.maven.*
+com.stanfy.*
+com.stanfy.android.*
+com.stanfy.enroscar.*
+com.stanfy.helium.*
+com.stanfy.mattock.*
+com.stanfy.spoon.*
+com.stanslab.jimdb.*
+com.stansonhealth.*
+com.stanwind.*
+com.staples-sparx.*
+com.star-zero.*
+com.starburstdata.*
+com.stardog.*
+com.stardog.ext.*
+com.starimmortal.*
+com.starkbank.*
+com.starkbank.ellipticcurve.*
+com.starkbank.sdk.*
+com.starkinfra.*
+com.starksign.*
+com.starlingbank.*
+com.starmcc.*
+com.starmicronics.*
+com.starrocks.*
+com.startapp.*
+com.starworking.*
+com.starxg.*
+com.starxmind.*
+com.stateforge.*
+com.stateforge.statebuilder.*
+com.stateforge.statebuilder.ant.*
+com.stateforge.statebuilder.maven.*
+com.statemachinesystems.*
+com.statful.client.*
+com.statful.client.framework.*
+com.staticbloc.*
+com.staticbloc.media.*
+com.staticbloc.twv.*
+com.statsig.*
+com.staui.*
+com.stavshamir.*
+com.stc.jmsjca.*
+com.steadybit.*
+com.stealthmountain.sqldim.*
+com.stealthymonkeys.pdf.*
+com.steampunk.swtf.*
+com.steamstreet.*
+com.steatoda.nar.*
+com.steelbridgelabs.oss.*
+com.steenhq.*
+com.steeplesoft.jsf.*
+com.stehno.ersatz.*
+com.steinf.*
+com.stellariver.*
+com.stellariver.milky.*
+com.stellariver.milky.demo.*
+com.stellarstation.api.*
+com.stenopolz.*
+com.stenway.*
+com.stephenduncanjr.*
+com.stephenn.*
+com.stepiz62.*
+com.stepleaderdigital.reveal.*
+com.stepstone.inbucket.*
+com.stepstone.search.hnswlib.jna.*
+com.stepstone.search.hnswlib.jna.example.*
+com.stepstone.xrunner.*
+com.sterlingts.*
+com.stetel.*
+com.steveniemitz.*
+com.stevenpaligo.*
+com.stevenpg.aop.*
+com.stevenpg.catfacts.*
+com.stevesoft.pat.*
+com.stevewedig.*
+com.stijndewitt.undertow.cors.*
+com.stilesyu.www.*
+com.stimulsoft.*
+com.stimulussoft.*
+com.stitchdata.*
+com.storebrand.healthcheck.*
+com.storecove.*
+com.storedobject.*
+com.storifyme.sdk.*
+com.storm-enroute.*
+com.stormpath.sdk.*
+com.stormpath.shiro.*
+com.stormpath.shiro.tutorial.*
+com.stormpath.spring.*
+com.stormpath.spring.boot.samza.*
+com.stormpath.spring.security.*
+com.storyclm.*
+com.stoyanr.*
+com.stoyanr.mastermind.*
+com.straal.*
+com.straitchain.*
+com.strandls.alchemy.*
+com.strapdata.*
+com.strapdata.cassandra.*
+com.strapdata.elassandraunit.*
+com.strapdata.elasticsearch.*
+com.strapdata.elasticsearch.client.*
+com.strapdata.elasticsearch.distribution.*
+com.strapdata.elasticsearch.distribution.deb.*
+com.strapdata.elasticsearch.distribution.integ-test-zip.*
+com.strapdata.elasticsearch.distribution.tar.*
+com.strapdata.elasticsearch.distribution.test.*
+com.strapdata.elasticsearch.distribution.zip.*
+com.strapdata.elasticsearch.gradle.*
+com.strapdata.elasticsearch.module.*
+com.strapdata.elasticsearch.plugin.*
+com.strapdata.elasticsearch.qa.*
+com.strapdata.elasticsearch.qa.backwards.*
+com.strapdata.elasticsearch.test.*
+com.strategicgains.*
+com.strategicgains.archetype.*
+com.strategicgains.domain-eventing.*
+com.strategicgains.plugin-express.*
+com.strategicgains.repoexpress.*
+com.stratio.*
+com.stratio.akka.auth.*
+com.stratio.cassandra.*
+com.stratio.common.*
+com.stratio.connector.*
+com.stratio.crossdata.*
+com.stratio.crossdata.connector.*
+com.stratio.datasource.*
+com.stratio.decision.*
+com.stratio.deep.*
+com.stratio.maven.*
+com.stratio.meta.*
+com.stratio.mojo.unix.*
+com.stratio.morphlines.*
+com.stratio.qa.*
+com.stratio.receiver.*
+com.stratio.sparta.*
+com.stratio.spray.auth.*
+com.stratio.streaming.*
+com.stratio.tikitakka.*
+com.stratumn.*
+com.stratumn.sdk.*
+com.streametry.*
+com.streamlio.*
+com.streamr.*
+com.streamr.labs.*
+com.streamsend.*
+com.streamsets.*
+com.streamsets.datacollector.archetype.*
+com.streamxhub.streamx.*
+com.streese.registravka4s.*
+com.streetcodevn.*
+com.streethawk.*
+com.streethawk.phonegap.*
+com.stringee.sdk.android.*
+com.stringflow.client.*
+com.stripe.*
+com.strivacity.*
+com.strivacity.android.*
+com.strongjoshua.*
+com.strongloop.*
+com.strongsalt.crypto.*
+com.strongsalt.strongdoc.sdk.*
+com.structurizr.*
+com.strumenta.*
+com.strumenta.antlr-kotlin.*
+com.strumenta.kolasu.*
+com.strumenta.mpsserver.*
+com.struqt.*
+com.stuart.*
+com.stuartbeard.iorek.*
+com.studerw.tda.*
+com.studio4365.*
+com.studiogdo.*
+com.stuforbes.*
+com.stuforbes.kapacity.*
+com.stumbleupon.*
+com.stun4j.*
+com.stun4j.boot.*
+com.stvconsultants.*
+com.stylingandroid.prism.*
+com.styra.run.*
+com.stytch.java.*
+com.stytch.kotlin.*
+com.stytch.sdk.*
+com.subgarden.airbrush.*
+com.subiger.openehr.*
+com.subinkrishna.*
+com.subnit.*
+com.subshell.maven.*
+com.subshell.simpleframework.*
+com.subtlesolution.*
+com.suddenh4x.ratingdialog.*
+com.sudhir.utils.*
+com.sudicode.*
+com.sudoplatform.*
+com.sudoplatform.sudoprofiles.*
+com.sudoplatform.sudouser.*
+com.sudoplatform.telephony.*
+com.sudoplay.axion.*
+com.sudoplay.ecs.*
+com.sudoplay.joise.*
+com.sudoplay.json.*
+com.sudoplay.math.*
+com.sudoplay.particle.*
+com.sudoplay.sudoxt.*
+com.sugarcrm.*
+com.sugarmanz.npm.*
+com.suhasgaddam.dummy.*
+com.suisrc.*
+com.suisrc.core.*
+com.suisrc.jaxrsapi.*
+com.suisrc.three.*
+com.suitbots.*
+com.suixingpay.config-keeper.*
+com.sulacosoft.*
+com.sumitanantwar.*
+com.summitsystemsinc.maven.*
+com.sumologic.*
+com.sumologic.api.client.*
+com.sumologic.elasticsearch.*
+com.sumologic.plugins.http.*
+com.sumologic.plugins.log4j.*
+com.sumologic.plugins.logback.*
+com.sumologic.shellbase.*
+com.sumologic.sumobot.*
+com.sun.*
+com.sun.activation.*
+com.sun.akuma.*
+com.sun.bigbrother.*
+com.sun.bigbrother.javanet.*
+com.sun.codemodel.*
+com.sun.comm.*
+com.sun.commons.*
+com.sun.corba.*
+com.sun.el.*
+com.sun.electric.*
+com.sun.enterprise.*
+com.sun.enterprise.auto-depends-test.*
+com.sun.enterprise.glassfish.*
+com.sun.facelets.*
+com.sun.faces.*
+com.sun.faces.extensions.*
+com.sun.faces.extensions.maven.*
+com.sun.faces.portlet.*
+com.sun.faces.regression.*
+com.sun.faces.test.*
+com.sun.fastinfoset.runtime.*
+com.sun.georss-rome.*
+com.sun.grizzly.*
+com.sun.grizzly.contribs.*
+com.sun.grizzly.osgi.*
+com.sun.grizzly.samples.*
+com.sun.grizzly.scripting.*
+com.sun.istack.*
+com.sun.japex.*
+com.sun.japex.jdsl.*
+com.sun.javaee.blueprints.*
+com.sun.javaee6.samples.*
+com.sun.jbi.*
+com.sun.jdmk.*
+com.sun.jersey.*
+com.sun.jersey.archetypes.*
+com.sun.jersey.contribs.*
+com.sun.jersey.contribs.bill-burke-book.*
+com.sun.jersey.contribs.jersey-oauth.*
+com.sun.jersey.glassfish.*
+com.sun.jersey.glassfish.v2.*
+com.sun.jersey.glassfish.v2.internal.*
+com.sun.jersey.glassfish.v3.*
+com.sun.jersey.glassfish.v3.osgi.*
+com.sun.jersey.glassfish.v32.*
+com.sun.jersey.glassfish.v32.osgi.*
+com.sun.jersey.jersey-test-framework.*
+com.sun.jersey.oauth.*
+com.sun.jersey.ri.*
+com.sun.jersey.samples.*
+com.sun.jersey.samples.atompub-contacts.*
+com.sun.jersey.samples.helloworld-osgi-webapp.*
+com.sun.jersey.samples.moxy-oxm-mapping.*
+com.sun.jersey.samples.osgi-http-service.*
+com.sun.jersey.test.*
+com.sun.jersey.test.framework.*
+com.sun.jersey.test.osgi.*
+com.sun.jersey.test.osgi.runtime-delegate-tests.*
+com.sun.jini.*
+com.sun.jmx.*
+com.sun.jna.*
+com.sun.jndi.*
+com.sun.jsf-extensions.*
+com.sun.jsftemplating.*
+com.sun.kvem.*
+com.sun.localizer.*
+com.sun.mail.*
+com.sun.maven.*
+com.sun.media.*
+com.sun.mep.*
+com.sun.messaging.mq.*
+com.sun.mojarra.*
+com.sun.msv.datatype.xsd.*
+com.sun.net.httpserver.*
+com.sun.org.apache.*
+com.sun.org.apache.xml.internal.*
+com.sun.phobos.*
+com.sun.phobos.samples.*
+com.sun.pkg.*
+com.sun.pkg.bootstrap.*
+com.sun.pkg.client.*
+com.sun.portal.portletcontainer.*
+com.sun.scn.*
+com.sun.script.jruby.*
+com.sun.script.php.*
+com.sun.solaris.*
+com.sun.tools.btrace.*
+com.sun.tools.jxc.maven2.*
+com.sun.tools.ws.*
+com.sun.tools.xjc.maven2.*
+com.sun.voip.*
+com.sun.webkit.*
+com.sun.winsw.*
+com.sun.woodstock.*
+com.sun.woodstock.dependlibs.*
+com.sun.wts.tools.ant.*
+com.sun.wts.tools.maven.*
+com.sun.wts.tools.mri.*
+com.sun.xml.*
+com.sun.xml.bind.*
+com.sun.xml.bind.external.*
+com.sun.xml.bind.jaxb.*
+com.sun.xml.bind.mvn.*
+com.sun.xml.dtd-parser.*
+com.sun.xml.fastinfoset.*
+com.sun.xml.messaging.saaj.*
+com.sun.xml.parsers.*
+com.sun.xml.registry.*
+com.sun.xml.rpc.*
+com.sun.xml.security.*
+com.sun.xml.stream.*
+com.sun.xml.stream.buffer.*
+com.sun.xml.txw2.*
+com.sun.xml.ws.*
+com.sun.xml.ws.security.kerb.*
+com.sun.xml.wss.*
+com.sun.xml.wss.core.reference.*
+com.sun.xsom.*
+com.sunfusheng.*
+com.sunlands.gateway.*
+com.sunmi.*
+com.sunnydsouza.*
+com.sunquakes.*
+com.sunrun.*
+com.sunshinator.*
+com.supalle.*
+com.suparnatural.kotlin.*
+com.supensour.*
+com.supernovapps.audio.*
+com.supersoftcafe.json.*
+com.supersonic.*
+com.suppresswarnings.*
+com.suprsend.*
+com.supwisdom.*
+com.surahul.*
+com.surelogic.*
+com.surenpi.autotest.*
+com.surenpi.ci.*
+com.surevine.*
+com.surftools.*
+com.suriyaprakhash.*
+com.surrealdb.*
+com.surveymonkey.*
+com.survivingwithandroid.*
+com.suse.salt.*
+com.suse.saltstack.*
+com.sushengren.*
+com.sushobh.*
+com.sushobh.gradle.exampleplugin.*
+com.suyanliu.*
+com.suyeer.*
+com.suzukiplan.*
+com.svashishtha.*
+com.svenjacobs.*
+com.svenjacobs.gwtbootstrap3.*
+com.svenjacobs.lugaene.*
+com.svenjacobs.reveal.*
+com.svenvandam.*
+com.svetylkovo.*
+com.svix.*
+com.svix.kotlin.*
+com.svnkit.*
+com.svrf.*
+com.sw926.imagefileselector.*
+com.swan-pro.*
+com.swardana.*
+com.swardana.kanagara.*
+com.swardana.mangata.*
+com.swardana.midnight.*
+com.swedbankpay.mobilesdk.*
+com.swedbankpay.pax.*
+com.swensonhe.*
+com.swift.*
+com.swift.swiftref.*
+com.swiftelan.*
+com.swiftmq.*
+com.swiftnav.*
+com.swingfrog.summer.*
+com.swipecrowd.captainhook.*
+com.swirepay.*
+com.swirl.*
+com.swirlds.*
+com.swissborg.*
+com.swisscom.cloud.sb.*
+com.switchfully.tools.*
+com.swmansion.starknet.*
+com.swoop.*
+com.sword-group.bizdock.dbmdl.*
+com.sword-group.bizdock.desktop.*
+com.sword-group.bizdock.lib.*
+com.sword-group.bizdock.packaging.*
+com.swordintent.chatgpt.*
+com.swoval.*
+com.swoval.jline.*
+com.swrve.*
+com.swrve.mparticle-beta.*
+com.swrve.mparticle.*
+com.swrve.sdk.android.*
+com.swrve.segment.*
+com.swvl.lint.*
+com.swyftstore.*
+com.sxtanna.*
+com.sxtanna.database.*
+com.sxtanna.db.*
+com.sxtanna.korm.*
+com.syject.*
+com.sylvona.leona.*
+com.symas.*
+com.symbaloo.*
+com.symphony.oss.*
+com.symphony.oss.allegro.*
+com.symphony.oss.canon.*
+com.symphony.oss.commons.*
+com.symphony.oss.fugue.*
+com.symphony.oss.models.*
+com.symphony.platformsolutions.*
+com.symxns.*
+com.synack.*
+com.synaptic-tools.*
+com.syncano.*
+com.synchronica.mep.*
+com.syncleus.*
+com.syncleus.aparapi.*
+com.syncleus.dann.*
+com.syncleus.ferma.*
+com.syncleus.maven.plugins.*
+com.syncleus.philipshue.*
+com.syncron.amazonaws.*
+com.syncron.common.*
+com.syncthemall.*
+com.synditcorp.*
+com.syndloanhub.loansum.*
+com.synedge.oss.*
+com.synedge.oss.enforcer.*
+com.synerset.*
+com.synhaptein.*
+com.syniverse.sdk.*
+com.synopsys.*
+com.synopsys.blackducksoftware.*
+com.synopsys.integration.*
+com.synsys.org.apache.spark.*
+com.syntaxphoenix.bundles.generator.*
+com.syntaxphoenix.syntaxapi.*
+com.syntifi.casper.*
+com.syntifi.crypto.*
+com.syntifi.near.*
+com.sypht.*
+com.syriaalgadportal.libraries.*
+com.sysbean.*
+com.sysco.qe.*
+com.sysgears.grain.*
+com.systemcn.*
+com.systemkern.*
+com.systemsplanet.plugin.*
+com.sysunite.*
+com.sysunite.coinsweb.*
+com.syt123450.*
+com.sythesystems.jeb.*
+com.syyai.spring.boot.*
+com.szadowsz.*
+com.szityu.oss.spring.recaptcha.*
+com.szityu.oss.timemachine.*
+com.t-zomu.libs.*
+com.t4cloud.*
+com.tabasoft.*
+com.taboola.*
+com.taboola.testmavenlibrary.*
+com.tachen.android.*
+com.tacitknowledge.*
+com.tacitknowledge.flip.*
+com.tacitknowledge.maven.plugins.*
+com.tactix4.*
+com.tadamski.glassfish.*
+com.taengsic.ophttp.*
+com.taeroen.*
+com.tagcommander.lib.*
+com.tagdynamics.*
+com.tagmycode.*
+com.tagtraum.*
+com.tailoredshapes.*
+com.tailoredshapes.underbar.*
+com.tailoredshapes.valkyrie.*
+com.tailrocks.graphql.*
+com.tailrocks.jambalaya.*
+com.tairanchina.csp.dew.*
+com.tairitsu.*
+com.taiyuechain.*
+com.takashiharano.*
+com.takeseem.*
+com.takipi.*
+com.takisoft.colorpicker.*
+com.takisoft.datetimepicker.*
+com.takisoft.preferencex.*
+com.talanlabs.*
+com.talecel.*
+com.talent-aio.*
+com.talenteca.*
+com.talentica.*
+com.talk2duck.*
+com.talk2object.*
+com.talk2object.plum.*
+com.talkdesk.*
+com.talkingdata.fregata.*
+com.talkinggenie.*
+com.talklittle.basecontentprovider.*
+com.talobin.*
+com.talobin.music.*
+com.talosvfx.*
+com.tamaton.util.*
+com.tambapps.fft4j.*
+com.tambapps.http.*
+com.tambapps.maven.*
+com.tambapps.p2p.speer.*
+com.tamber.*
+com.tamirguru.*
+com.tananaev.*
+com.tanchengjin.*
+com.tandaima.*
+com.tandt53.*
+com.tangguangdi.*
+com.tangorabox.*
+com.tangyujun.*
+com.tangzc.*
+com.tantowi.maven.*
+com.tanx.*
+com.tanx.core.*
+com.tanx.ui.*
+com.taobao.*
+com.taobao.arthas.*
+com.taobao.common.*
+com.taobao.configserver.*
+com.taobao.csp.ahas.*
+com.taobao.diamond.*
+com.taobao.gcanvas.*
+com.taobao.gcanvas.adapters.*
+com.taobao.gcanvas.bridges.*
+com.taobao.gecko.*
+com.taobao.hsf.*
+com.taobao.itest.*
+com.taobao.metamorphosis.*
+com.taobao.middleware.*
+com.taobao.open-link-platform.*
+com.taobao.tair.*
+com.taobao.test.*
+com.taobao.text.*
+com.taofen8.mid.*
+com.taosdata.jdbc.*
+com.taoyuanx.*
+com.tapad.sbt.*
+com.tapglue.android.*
+com.tappx.sdk.android.*
+com.tapstream.*
+com.tapstream.sdk.*
+com.taptap.*
+com.taptrack.*
+com.taqtile.*
+com.taradevko.*
+com.target.*
+com.target2sell.library.*
+com.targomo.*
+com.tarkalabs.*
+com.tascape.*
+com.tascape.qa.*
+com.taskadapter.*
+com.taskbase.arson.*
+com.taskbase.bitmark.*
+com.tasktop.*
+com.tasktop.koans.*
+com.tasktop.maven.*
+com.tasomaniac.*
+com.tatateo.*
+com.tatsuyafw.*
+com.tatzan.*
+com.tauk.*
+com.taverok.*
+com.tavianator.sangria.*
+com.taxamo.*
+com.taxjar.*
+com.taxonic.carml.*
+com.taypo.*
+com.tazkiyatech.*
+com.tbuonomo.*
+com.tcashcroft.*
+com.tcdng.jacklyn.*
+com.tcdng.unify.*
+com.tchepannou.payment.*
+com.tchepannou.util.*
+com.tchristofferson.pagedinventories.*
+com.tdrhq.eyepatch.*
+com.tduckcloud.*
+com.tdull.commons.db.*
+com.tdunning.*
+com.tealcube.minecraft.bukkit.*
+com.tealcube.se.ranzdo.bukkit.*
+com.team2539.*
+com.team4924.*
+com.teambytes.*
+com.teambytes.handy.*
+com.teambytes.logback.*
+com.teamcodeflux.android.*
+com.teamdev.jxbrowser.*
+com.teamide.*
+com.teamscale.*
+com.teamtter.build.*
+com.teamtter.maven.*
+com.teamtter.mavennatives.*
+com.teamtter.test.*
+com.teamunify.*
+com.teamwizardry.librarianlib.*
+com.teamwork.multiautocomplete.*
+com.tecacet.*
+com.tech-consortium.*
+com.techatpark.sjson.*
+com.techbulls.commons.securelog.*
+com.techconative.*
+com.techempower.*
+com.techibi.*
+com.techmale.*
+com.technochord.spring.starter.stripe.*
+com.technochord.stripe.*
+com.technodabble.examples.*
+com.technologicgroup.cluster.*
+com.technophobia.substeps.*
+com.techshroom.*
+com.techshroom.templar.*
+com.techsophy.*
+com.techyourchance.*
+com.tecnoguru.*
+com.tecnoguru.scuby.*
+com.tecsisa.*
+com.tectonica.*
+com.teesoft.*
+com.tegeltech.*
+com.tegonal.*
+com.tehmou.*
+com.tejasn.*
+com.tek271.*
+com.tek271.tecuj2-db.*
+com.teketik.*
+com.tekingb.tekboolexp.*
+com.tekingb.tekquerydslbuilder.*
+com.tekingb.testapp.*
+com.tekmare.*
+com.telapi.api.*
+com.telecomsys.cmc.*
+com.telefonica.*
+com.telegram4j.*
+com.telekom.m2m.cot.*
+com.telenav.*
+com.telenav.cactus.*
+com.telenav.cactus.metadata.*
+com.telenav.kivakit.*
+com.telenav.lexakai.*
+com.telenav.lexakai.annotations.*
+com.telenav.mesakit.*
+com.telenav.third.party.*
+com.telenav.thirdparty.*
+com.telenordigital.sms.*
+com.telerivet.*
+com.telesign.*
+com.telly.*
+com.telnyx.sdk.*
+com.telqtele.*
+com.temis.*
+com.tempodb.*
+com.tempoiq.*
+com.tenable.*
+com.tencent.*
+com.tencent.ads.*
+com.tencent.android.tpns.*
+com.tencent.angel.*
+com.tencent.bk.base.dataflow.*
+com.tencent.bk.base.datahub.*
+com.tencent.bk.base.datalab.*
+com.tencent.bk.devops.ci.*
+com.tencent.bk.devops.ci.artifactory.*
+com.tencent.bk.devops.ci.auth.*
+com.tencent.bk.devops.ci.buildless.*
+com.tencent.bk.devops.ci.common.*
+com.tencent.bk.devops.ci.dispatch.*
+com.tencent.bk.devops.ci.dispatch.bcs.*
+com.tencent.bk.devops.ci.dispatch.docker.*
+com.tencent.bk.devops.ci.dispatch.kubernetes.*
+com.tencent.bk.devops.ci.dockerhost.*
+com.tencent.bk.devops.ci.environment.*
+com.tencent.bk.devops.ci.image.*
+com.tencent.bk.devops.ci.log.*
+com.tencent.bk.devops.ci.metrics.*
+com.tencent.bk.devops.ci.monitoring.*
+com.tencent.bk.devops.ci.notify.*
+com.tencent.bk.devops.ci.plugin.*
+com.tencent.bk.devops.ci.process.*
+com.tencent.bk.devops.ci.project.*
+com.tencent.bk.devops.ci.quality.*
+com.tencent.bk.devops.ci.repository.*
+com.tencent.bk.devops.ci.scm.*
+com.tencent.bk.devops.ci.sign.*
+com.tencent.bk.devops.ci.store.*
+com.tencent.bk.devops.ci.stream.*
+com.tencent.bk.devops.ci.ticket.*
+com.tencent.bk.devops.ci.websocket.*
+com.tencent.bk.devops.ci.worker.*
+com.tencent.bk.devops.git.*
+com.tencent.bk.devops.turbo.*
+com.tencent.bk.repo.*
+com.tencent.bk.sdk.*
+com.tencent.bkrepo.*
+com.tencent.bugly.*
+com.tencent.cast.*
+com.tencent.cloud.*
+com.tencent.devops.*
+com.tencent.devops.boot.*
+com.tencent.devops.ci-plugins.*
+com.tencent.devops.leaf.*
+com.tencent.devops.publish.*
+com.tencent.devops.release.*
+com.tencent.devops.rules.*
+com.tencent.edu.*
+com.tencent.hippy.*
+com.tencent.homeworkkun.*
+com.tencent.imsdk.*
+com.tencent.imsdk.tuiplugin.*
+com.tencent.iot.explorer.*
+com.tencent.iot.hub.*
+com.tencent.iot.thirdparty.android.*
+com.tencent.iot.video.*
+com.tencent.klevin.*
+com.tencent.kona.*
+com.tencent.liteav.*
+com.tencent.liteav.customize.*
+com.tencent.liteav.tuikit.*
+com.tencent.liteav.tuikit.customize.*
+com.tencent.liteavsdk.*
+com.tencent.map.*
+com.tencent.map.geolocation.*
+com.tencent.matrix.*
+com.tencent.mediacloud.*
+com.tencent.mirrors.base.*
+com.tencent.mm.*
+com.tencent.mm.opensdk.*
+com.tencent.mna.*
+com.tencent.mpacc.*
+com.tencent.openmap.*
+com.tencent.polaris.*
+com.tencent.qqmini.*
+com.tencent.sr.rmall.*
+com.tencent.svp.*
+com.tencent.tars.*
+com.tencent.tav.*
+com.tencent.tbs.*
+com.tencent.tcic.*
+com.tencent.tcr.*
+com.tencent.tcvectordb.*
+com.tencent.tdfcore.*
+com.tencent.testaar.*
+com.tencent.tinker.*
+com.tencent.tpns.*
+com.tencent.tsf.*
+com.tencent.vasdolly.*
+com.tencent.wcdb.*
+com.tencent.wemeet.sdk.*
+com.tencent.yunxiaowei.abtest.*
+com.tencent.yunxiaowei.base.*
+com.tencent.yunxiaowei.beacon.*
+com.tencent.yunxiaowei.codec.*
+com.tencent.yunxiaowei.cv.*
+com.tencent.yunxiaowei.dmsdk.*
+com.tencent.yunxiaowei.net.*
+com.tencent.yunxiaowei.net.diagno.*
+com.tencent.yunxiaowei.speech.*
+com.tencent.yunxiaowei.tools.*
+com.tencent.yunxiaowei.tvs.*
+com.tencent.yunxiaowei.webviewsdk.*
+com.tencentcloudapi.*
+com.tencentcloudapi.cls.*
+com.tencentcloudapi.im.*
+com.tencentcloudapi.smh.*
+com.tencentcloudapi.wemeet.*
+com.tencyle.fixes.*
+com.tenderowls.opensource.*
+com.tenduke.events.*
+com.tenjin.*
+com.tenkiv.coral.*
+com.tenkiv.coral.jdk.*
+com.tenkiv.tekdaqc.*
+com.tenkiv.tekdaqc.android.*
+com.tennetcn.free.*
+com.tenonedesign.t1autograph.*
+com.tenqube.*
+com.tensorwrench.gradle.*
+com.tensorwrench.mongodb.*
+com.tensorwrench.shiro.*
+com.tenxerconsulting.*
+com.teodorstoev.*
+com.teotas.*
+com.teradata.*
+com.teradata.airlift.*
+com.teradata.benchto.*
+com.teradata.example.app.*
+com.teradata.jdbc.*
+com.teradata.presto.hadoop.*
+com.teradata.tempto.*
+com.teradata.tpcds.*
+com.teragrep.*
+com.terathought.enchant.*
+com.terheyden.*
+com.terradue.*
+com.terrafolio.*
+com.terremark.*
+com.tersesystems.*
+com.tersesystems.blacklite.*
+com.tersesystems.blindsight.*
+com.tersesystems.debugjsse.*
+com.tersesystems.echopraxia.*
+com.tersesystems.echopraxia.plusakka.*
+com.tersesystems.echopraxia.plusscala.*
+com.tersesystems.jmxbuilder.*
+com.tersesystems.logback.*
+com.tersesystems.securitybuilder.*
+com.tesera.andbtiles.*
+com.teskalabs.seacat.*
+com.teslagov.*
+com.test-ape.*
+com.testautomationguru.ocular.*
+com.testautomationguru.pdfutil.*
+com.testcompose.*
+com.testdroid.*
+com.testerum.*
+com.testfabrik.webmate.sdk.*
+com.testfairy.*
+com.testflo.*
+com.testingbot.*
+com.testingsyndicate.*
+com.testlitmus.*
+com.testmile.*
+com.testmonitor.*
+com.testpoke.*
+com.testpros.*
+com.testquack.*
+com.testquack.liken.*
+com.testquack.smith.*
+com.testrail.*
+com.testrigor.*
+com.testsigma.*
+com.testsigma.kibbutz.archetypes.*
+com.testvagrant.*
+com.testvagrant.devicemanagement.*
+com.testvagrant.ekam.*
+com.testvagrant.intents.*
+com.testvagrant.mdb.*
+com.testvagrant.optimus-commons.*
+com.testvagrant.optimus.*
+com.testvagrant.optimusMonitor.*
+com.testvagrant.optimuscloud.*
+com.testvagrant.stepdefs.*
+com.testyantra.optimize.*
+com.testzeus.*
+com.tesults.*
+com.tesults.junit5.*
+com.tesults.testng.*
+com.tethys-json.*
+com.tetradotoxina.*
+com.tetsuwan-tech.atom.*
+com.texry.*
+com.textkey.rest.*
+com.textmagic.sdk.*
+com.textrazor.*
+com.textrecruit.ustack.*
+com.tezro.api.*
+com.tfgco.*
+com.tfowl.cosmobuzz.*
+com.tfowl.jsoup.*
+com.tfowl.ktor.*
+com.tfowl.socketio.*
+com.tfyre.*
+com.tguzik.*
+com.thaiopensource.*
+com.thamtech.gwt.*
+com.thanhtrong.*
+com.thankjava.toolkit.*
+com.thankjava.toolkit3d.*
+com.thankjava.toolkitroot.*
+com.thankjava.wqq.*
+com.thdlee.*
+com.the-mgi.*
+com.the-qa-company.*
+com.the-tech-warriors.*
+com.the99tests.photon.*
+com.theagilemonkeys.meets.*
+com.theahoyapp.*
+com.theakashv22.util.*
+com.thealtening.api.*
+com.thealtening.auth.*
+com.thealvistar.crudgenerics.*
+com.theartos.*
+com.thebhumilsoni.*
+com.thebhumilsoni.test-android-sdk-and-plugin-creation.*
+com.thebhumilsoni.test-android-sdk-and-plugin-creation.utest.analytics.*
+com.thebhumilsoni.utest.analytics.*
+com.thebluealliance.*
+com.thebluekernel.common.*
+com.theboreddev.*
+com.thecoderscorner.tcmenu.*
+com.thecodingdevs.apps.*
+com.thedeanda.*
+com.thedesignium.*
+com.theflyy.sdk.*
+com.thefuntasty.mvvm.*
+com.thegeekyasian.*
+com.thegoate.*
+com.thegreatapi.demolibrary.*
+com.theguardian.*
+com.thehayro.*
+com.thehellings.*
+com.thehellings.gully.*
+com.theicenet.*
+com.theinternate.*
+com.theisenp.*
+com.theisenp.harbor.*
+com.theisenp.vicarious.*
+com.thejholmes.russound.*
+com.thejohnfreeman.*
+com.thekayani.*
+com.thelastcheck.*
+com.thelastcheck.commons.*
+com.thelastpickle.*
+com.themightystags.*
+com.themillhousegroup.*
+com.themodernway.*
+com.theneura.*
+com.thenewentity.*
+com.thenewmotion.*
+com.theokanning.openai-gpt3-java.*
+com.theonlytails.*
+com.theoremlp.conjure.openapi.*
+com.theoremreach.*
+com.theoryinpractise.*
+com.theoryinpractise.datatyper.*
+com.theoryinpractise.dbng.*
+com.theoryinpractise.frege.*
+com.theotherian.dns.*
+com.thepracticaldeveloper.*
+com.therealvan.*
+com.thesamet.*
+com.thesamet.scalapb.*
+com.thesamet.scalapb.common-protos.*
+com.thesamet.scalapb.grpcweb.*
+com.thesamet.scalapb.zio-grpc.*
+com.thesamet.test.*
+com.thesett.*
+com.thesett.archetype.*
+com.thesett.jenerator.utils.*
+com.thesett.validation.*
+com.thetachain.*
+com.thetransactioncompany.*
+com.thetus.build.*
+com.thetus.maven.*
+com.theupswell.appengine.counter.*
+com.thewebsemantic.*
+com.thewonggei.*
+com.theworkshop.*
+com.thihy.*
+com.thilko.spring.*
+com.thimbleware.jmemcached.*
+com.thindeck.*
+com.thing2x.*
+com.thingschained.*
+com.thinkaurelius.faunus.*
+com.thinkaurelius.groovy-shaded-asm.*
+com.thinkaurelius.thrift.*
+com.thinkaurelius.titan.*
+com.thinkbiganalytics.kylo.*
+com.thinkbiganalytics.kylo.plugins.*
+com.thinkfree.android.*
+com.thinkinglogic.builder.*
+com.thinkitcms.*
+com.thirdpartylabs.*
+com.thirtyai.*
+com.thizzer.jtouchbar.*
+com.thizzer.kt-git-repository.*
+com.thizzer.kt-swift-package-collections.*
+com.thizzer.kt-swift-package.*
+com.thomashaertel.*
+com.thomasjensen.checkstyle.addons.*
+com.thomasjensen.sercoll.*
+com.thomaskasene.wiremock.*
+com.thomaskint.*
+com.thomaspaulmann.*
+com.thomsonreuters.*
+com.thomsonreuters.datafusion.*
+com.thomsonreuters.ema.*
+com.thomsonreuters.upa.*
+com.thomsonreuters.upa.ansi.*
+com.thomsonreuters.upa.valueadd.*
+com.thomsonreuters.upa.valueadd.cache.*
+com.thonbecker.simplewebsitedeploy.*
+com.thorstenmarx.modules.*
+com.thorstenmarx.webtools.*
+com.thothsun.*
+com.thoughtbot.*
+com.thoughtworks.*
+com.thoughtworks.adtd.*
+com.thoughtworks.akka-http-rpc.*
+com.thoughtworks.akka-http-twirl.*
+com.thoughtworks.akka-http-webjars.*
+com.thoughtworks.binding.*
+com.thoughtworks.binding.bindable.*
+com.thoughtworks.binding.experimental.*
+com.thoughtworks.compute.*
+com.thoughtworks.constructor.*
+com.thoughtworks.continuation.*
+com.thoughtworks.datacommons.*
+com.thoughtworks.datacommons.prepbuddy.*
+com.thoughtworks.deeplearning.*
+com.thoughtworks.deeplearning.etl.*
+com.thoughtworks.dsl.*
+com.thoughtworks.each.*
+com.thoughtworks.enableIf.*
+com.thoughtworks.example.*
+com.thoughtworks.extractor.*
+com.thoughtworks.feature.*
+com.thoughtworks.future.*
+com.thoughtworks.gauge.*
+com.thoughtworks.gauge.gradle.*
+com.thoughtworks.gauge.maven.*
+com.thoughtworks.implicit-dependent-type.*
+com.thoughtworks.import.*
+com.thoughtworks.inproctester.*
+com.thoughtworks.microbuilder.*
+com.thoughtworks.microbuilder.tutorial.*
+com.thoughtworks.mockpico.*
+com.thoughtworks.paranamer.*
+com.thoughtworks.proxytoys.*
+com.thoughtworks.q.*
+com.thoughtworks.qdox.*
+com.thoughtworks.raii.*
+com.thoughtworks.sbt-api-mappings.*
+com.thoughtworks.sbt-best-practice.*
+com.thoughtworks.sbt-scala-js-map.*
+com.thoughtworks.sbt.*
+com.thoughtworks.sde.*
+com.thoughtworks.spark-flatter.*
+com.thoughtworks.spring.security.acls.jdbc.*
+com.thoughtworks.template.*
+com.thoughtworks.tools.*
+com.thoughtworks.tryt.*
+com.thoughtworks.xstream.*
+com.thoughtworks.zeratul.*
+com.thoughtworks.zerocost.*
+com.thousandmemories.photon.*
+com.thrblock.aria.*
+com.threatconnect.*
+com.threatconnect.app.*
+com.threatconnect.sdk.*
+com.threatconnect.sdk.addons.*
+com.threatconnect.sdk.core.*
+com.threecrickets.creel.*
+com.threecrickets.jvm.*
+com.threegsimplified.planhound.*
+com.threeleaf.*
+com.threerings.*
+com.threerings.getdown.*
+com.threerings.nexus.*
+com.threewks.analytics.*
+com.threewks.spring.*
+com.threewks.thundr.*
+com.thron.*
+com.thron.sdk.*
+com.thuisapp.*
+com.thycotic.*
+com.thycotic.secrets.*
+com.ti-net.*
+com.ti-net.lcw.*
+com.ti-net.mqtt.*
+com.ti-net.oskit.*
+com.ti-net.oslib.*
+com.ti-net.spanhtml.*
+com.ti-net.threepart.*
+com.ti-net.timpush.*
+com.ti-net.widget.*
+com.tiandilianxian.xxn.*
+com.tianscar.*
+com.tianscar.android.*
+com.tianscar.awt.x11.*
+com.tianscar.imageio.*
+com.tianscar.javasound.*
+com.tianscar.jme3.*
+com.tianscar.properties.*
+com.tianscar.soundtouch.*
+com.tianshouzhi.*
+com.tianti.*
+com.tianyisoft.database.*
+com.tianyisoft.jvalidate.*
+com.tiarebalbi.infinitic.*
+com.tibco.ep.*
+com.tibco.plugins.*
+com.tickaroo.tikxml.*
+com.ticketfly.*
+com.ticketmaster.accounts.*
+com.ticketmaster.api.*
+com.ticketmaster.mobile.discovery.*
+com.ticketmaster.presence.*
+com.ticketmaster.purchase.*
+com.ticketmaster.retail.*
+com.ticketmaster.servos.*
+com.ticketmaster.tickets.*
+com.ticketmaster.voltron.*
+com.tictactec.*
+com.tiduyun.*
+com.tiemens.*
+com.tietoevry.quarkus.*
+com.tifosi-m.*
+com.tigerbeetle.*
+com.tigergraph.*
+com.tiggee.commons.*
+com.tigrisdata.*
+com.tigrisdata.tools.*
+com.tigrisdata.tools.code-generator.*
+com.tigrisdata.tools.schema-generator.*
+com.tikal.*
+com.tikinou.oss.*
+com.tilal6991.listen.*
+com.tilal6991.messageloop.*
+com.timcharper.*
+com.timecho.iotdb.*
+com.timecho.timechodb.*
+com.timehop.fragmentswitcher.*
+com.timehop.stickyheadersrecyclerview.*
+com.timeinc.*
+com.timemf.*
+com.timeout.*
+com.timesprint.*
+com.timeular.nytta.*
+com.timeular.nytta.email.*
+com.timeular.nytta.prova.*
+com.timgroup.*
+com.timgroup.bildungsroman.*
+com.timotta.*
+com.timsanalytics.jar.*
+com.timshadel.*
+com.timushev.*
+com.tinder.gitquery.*
+com.tinder.scarlet.*
+com.tinder.statemachine.*
+com.tinesoft.*
+com.tingyun.*
+com.tinify.*
+com.tink.*
+com.tinkerforge.*
+com.tinkerpop.*
+com.tinkerpop.blueprints.*
+com.tinkerpop.gremlin.*
+com.tinkerpop.rexster.*
+com.tinkerpop.rexster.rexster-kibbles.*
+com.tinslice.crusader.*
+com.tinyield.*
+com.tiobe.jacobe.*
+com.tiqwab.*
+com.tiscover.*
+com.tispr.gocd.*
+com.tistory.devilnangel.*
+com.titusfortner.*
+com.tiyatech.jacksunny.*
+com.tjek.sdk.*
+com.tkroman.*
+com.tkruse.gradle.*
+com.tlaloc-es.*
+com.tlcsdm.*
+com.tlorrain.android.rezenerator.*
+com.tlv8.chromium.*
+com.tmirob.*
+com.tmirob.medical.*
+com.tmiyapub.*
+com.tmobile.opensource.casquatch.*
+com.tmsps.*
+com.tmsps.fk.common.*
+com.tmsps.util.*
+com.tmtron.*
+com.tmtron.enums.*
+com.tmtron.immutables.*
+com.tngtech.archunit.*
+com.tngtech.atlassian.*
+com.tngtech.java.*
+com.tngtech.jgiven.*
+com.tngtech.junit.dataprovider.*
+com.tngtech.keycloakmock.*
+com.tngtech.valueprovider.*
+com.tnkfactory.*
+com.toao.*
+com.toast.android.*
+com.toast.android.gamebase.*
+com.toast.iap.*
+com.toastcoders.*
+com.toasttab.*
+com.toasttab.android.*
+com.toasttab.can-i-use-anvil.*
+com.toasttab.canv.*
+com.toasttab.expediter.*
+com.toasttab.ksp.builder.*
+com.toasttab.protokt.*
+com.toasttab.protokt.thirdparty.*
+com.tobedevoured.*
+com.tobedevoured.command.*
+com.tobedevoured.json.*
+com.tobedevoured.modelcitizen.*
+com.tobedevoured.naether.*
+com.tobianoapps.*
+com.tobiasdiez.*
+com.tocea.easycoverage.*
+com.tocea.scertify.maven.*
+com.toceansoft.*
+com.toddfast.mutagen.*
+com.toddfast.preconditions.*
+com.toddfast.typeconverter.*
+com.toddway.shelf.*
+com.todostudy.*
+com.toedter.*
+com.toggl.*
+com.tojc.ormlite.android.*
+com.tokbox.*
+com.tokenopoly.coinbridge.*
+com.tokera.*
+com.tollge.*
+com.tolpp.memguard.*
+com.tom-roush.*
+com.tomakeitgo.markdown.*
+com.tombrus.hudson.dostrigger.*
+com.tomcawley.*
+com.tomczyn.*
+com.tomczyn.ellipse.*
+com.tomekgrobel.mnemonic.*
+com.tomergoldst.android.*
+com.tomgibara.*
+com.tomgibara.bits.*
+com.tomgibara.choose.*
+com.tomgibara.coding.*
+com.tomgibara.ezo.*
+com.tomgibara.fundament.*
+com.tomgibara.geo.*
+com.tomgibara.hashing.*
+com.tomgibara.keycode.*
+com.tomgibara.money.*
+com.tomgibara.permute.*
+com.tomgibara.radix4.*
+com.tomgibara.storage.*
+com.tomgibara.streams.*
+com.tomgibara.ticket.*
+com.tomgibara.tries.*
+com.tomreznik.generify.*
+com.tomsquest.*
+com.tomtom.http.*
+com.tomtom.jsystemd.*
+com.tomtom.kotlin.*
+com.tomtom.speedtools.*
+com.tomtom.traffic.*
+com.tomtorsneyweir.*
+com.tomtrein.*
+com.tonelope.tennis.*
+com.tonethink.*
+com.tonicartos.*
+com.tonicsystems.*
+com.tonylawrence.*
+com.tookanapp.app.*
+com.toolazydogs.*
+com.toolazydogs.aunit.*
+com.toolazydogs.shiro.*
+com.tools20022.*
+com.tooltwist.*
+com.toomasr.*
+com.toomuchcoding.*
+com.toomuchcoding.jsonassert.*
+com.toomuchcoding.xmlassert.*
+com.tooonly.*
+com.top-logic.*
+com.top10.*
+com.topdesk.*
+com.topfoxs.*
+com.tophermiller.*
+com.topperbotics.*
+com.toptal.*
+com.toptal.ammonitex.*
+com.torchmind.*
+com.torchmind.mango.*
+com.torchmind.utility.*
+com.torocloud.*
+com.torodb.*
+com.torodb.engine.*
+com.torodb.engine.backend.*
+com.torodb.engine.kvdocument.*
+com.torodb.engine.mongodb.*
+com.torodb.kvdocument.*
+com.torodb.mongowp.*
+com.torodb.mongowp.bson.*
+com.torodb.mongowp.client.*
+com.torodb.testing.*
+com.torodb.torod.*
+com.torodb.torod.backends.*
+com.torodb.torod.backends.drivers.*
+com.torstling.intellij.*
+com.tortoisehq.*
+com.torunski.crawler.*
+com.tosan.camunda.*
+com.tosan.client.http.*
+com.tosan.client.soap.*
+com.tosan.plugin.*
+com.tosan.server.http.*
+com.tosan.tools.*
+com.totaalsoftware.testlog.*
+com.totalchange.servlicle.*
+com.totalcross.knowcode.*
+com.totango.*
+com.totsp.feedpod.*
+com.touchgui.*
+com.touchlane.*
+com.touktw.architecture.*
+com.tourapp.config.*
+com.tourapp.model.*
+com.tourapp.res.*
+com.tourapp.thin.*
+com.tourapp.thin.app.*
+com.tourapp.tour.*
+com.tourgeek.config.*
+com.tourgeek.model.*
+com.tourgeek.res.*
+com.tourgeek.thin.*
+com.tourgeek.thin.app.*
+com.tourgeek.tour.*
+com.touscm.*
+com.touwolf.*
+com.townmc.*
+com.tozny.e3db.*
+com.tperamaki.*
+com.tpshion.util.*
+com.tqdev.metrics.*
+com.tqlab.docbook.*
+com.tqlab.plugin.*
+com.tqlab.sense.*
+com.tr8nhub.*
+com.traackr.*
+com.tracelytics.agent.java.*
+com.trackier.*
+com.trackingio.*
+com.trackingplan.client.*
+com.tracmobility.*
+com.tractionsoftware.*
+com.tradenity.*
+com.tradeshift.*
+com.tradeshift.sdk.*
+com.tradesy.binder.*
+com.tradier.*
+com.tradingview.*
+com.tradologics.*
+com.tradplusad.*
+com.trafi.maas.*
+com.traitify.*
+com.trankimtung.*
+com.trankimtung.kotlin.*
+com.trankimtung.spring.*
+com.transempiric.*
+com.transferwise.*
+com.transferwise.common.*
+com.transferwise.envoy.*
+com.transferwise.idempotence4j.*
+com.transferwise.kafka.*
+com.transferwise.tasks.*
+com.transferzero.sdk.*
+com.transficc.*
+com.transgee.*
+com.transifex.txnative.*
+com.translationexchange.*
+com.translations.globallink.*
+com.translnd.*
+com.transloadit.android.sdk.*
+com.transloadit.sdk.*
+com.transmitsecurity.*
+com.tranxactive.*
+com.trasier.*
+com.tratao.*
+com.traveltime.*
+com.traverse-tms.*
+com.trcooke.breakerbreaker.*
+com.treasuredata.*
+com.treasuredata.bigdam.*
+com.treasuredata.client.*
+com.treasuredata.embulk.plugins.*
+com.treatwell.*
+com.treblle.*
+com.trebogeer.jcql.*
+com.treelogic-swe.*
+com.treeyh.raindrop.*
+com.trello.*
+com.trello.flowbius.*
+com.trello.identifier.*
+com.trello.mrclean.*
+com.trello.navi2.*
+com.trello.rxlifecycle2.*
+com.trello.rxlifecycle3.*
+com.trello.rxlifecycle4.*
+com.trend.*
+com.trendyol.*
+com.trendyol.android.devtools.*
+com.treode.*
+com.tresata.*
+com.trevisol.*
+com.tri-systems.persistence.*
+com.tri-systems.ui.ldc.*
+com.triangleleft.*
+com.triangleleft.assertdialog.*
+com.trib3.*
+com.tribalyte.*
+com.tribbloids.spookystuff.*
+com.triceracode.*
+com.trickyandroid.*
+com.tridion.*
+com.tridion.smarttarget.*
+com.trievosoftware.*
+com.trigersoft.*
+com.trigonic.*
+com.trigyn.*
+com.trilead.*
+com.trimble.*
+com.trinetix.*
+com.trip38.trip38lib.*
+com.tripfinger.commons.*
+com.triplelift.gdpr.*
+com.triptheone.*
+com.tristanhunt.*
+com.tritondigital.*
+com.trivago.*
+com.trivago.rta.*
+com.trivore.*
+com.trolley.*
+com.tronstone.*
+com.trsvax.*
+com.truchsess.*
+com.truclinic.*
+com.trueaccord.lenses.*
+com.trueaccord.repos.*
+com.trueaccord.scalapb.*
+com.truecaller.*
+com.truecaller.android.sdk.*
+com.truecar.mleap.*
+com.truedei.swagger.plugin.*
+com.truelayer.*
+com.truelayer.payments.*
+com.trulioo.*
+com.truncon.*
+com.trunkrs.*
+com.truora.*
+com.trusona.*
+com.trustdecision.android.*
+com.trustedchoice.*
+com.trustev.*
+com.trustingsocial.apisdk.*
+com.trustly.*
+com.trustly.api.*
+com.trustpayments.mobile.*
+com.trustwallet.walletcore.*
+com.truthbean.*
+com.truthbean.code.*
+com.truthbean.debbie.*
+com.truthbean.logger.*
+com.truward.*
+com.truward.brikar.*
+com.truward.brikar.error.*
+com.truward.brikar.protobuf.*
+com.truward.brikar.rpc.*
+com.truward.builder.*
+com.truward.demo.*
+com.truward.di.*
+com.truward.it.httpserver.*
+com.truward.kvdao.*
+com.truward.metrics.*
+com.truward.orion.*
+com.truward.protobuf.*
+com.truward.semantic.*
+com.truward.simpleaop.*
+com.truward.time.*
+com.truward.tupl.*
+com.tryadhawk.*
+com.tryfinch.api.*
+com.tryflux.*
+com.tryspare.*
+com.trytotry.*
+com.trywildcard.pair.*
+com.tryzage.*
+com.tsc9526.*
+com.tsengvn.*
+com.tsukaby.*
+com.tsvetilian.*
+com.tsyba.core.*
+com.tsystems.cargo.wso2.*
+com.tsystems.ficum.*
+com.ttcble.android.*
+com.ttdev.*
+com.ttianjun.*
+com.ttlock.*
+com.ttulka.flyway.*
+com.ttulka.opcua.*
+com.ttulka.spring.boot.configstore.*
+com.tuana9a.*
+com.tuanbaol.*
+com.tubitv.*
+com.tuccicode.*
+com.tuccicode.concise.*
+com.tuenti.buttonmenu.*
+com.tuenti.smsradar.*
+com.tukeof.common.*
+com.tulsian.*
+com.tumblr.*
+com.tundem.aboutlibraries.*
+com.tundem.actionitembadge.*
+com.tundem.materialdrawer.*
+com.tune.*
+com.tune.reporting.*
+com.tune.sdk.*
+com.tungsten-labs.*
+com.tunjid.*
+com.tunjid.androidx.*
+com.tunjid.mutator.*
+com.tunjid.tiler.*
+com.tunjid.treenav.*
+com.tunnelvisionlabs.*
+com.tuntunhz.rocket.*
+com.tuntunhz.tools.*
+com.tunyk.currencyconverter.*
+com.tunyk.jsonbatchtranslate.*
+com.tunyk.mvn.plugins.htmlcompressor.*
+com.tupilabs.*
+com.tuplejump.*
+com.tuplejump.play-utils.*
+com.tuplejump.utils.*
+com.turbo-rpc.*
+com.turbomanage.basic-http-client.*
+com.turbomanage.storm.*
+com.turbomates.*
+com.turbomates.ktor.*
+com.turbospaces.*
+com.turbospaces.boot.*
+com.turhanoz.android.*
+com.turikhay.*
+com.turkraft.*
+com.turkraft.springfilter.*
+com.turn.*
+com.turn.sorcerer.*
+com.turo.*
+com.turtlequeue.*
+com.tusharmath.*
+com.tutego.*
+com.tuyenmonkey.*
+com.tuzhihai.*
+com.tvd12.*
+com.tweesky.cloudtools.*
+com.twelvemonkeys.*
+com.twelvemonkeys.bom.*
+com.twelvemonkeys.common.*
+com.twelvemonkeys.contrib.*
+com.twelvemonkeys.imageio.*
+com.twelvemonkeys.servlet.*
+com.twikey.*
+com.twilio.*
+com.twilio.sdk.*
+com.twineworks.*
+com.twingly.*
+com.twitter.*
+com.twitter.ambrose.*
+com.twitter.common.*
+com.twitter.common.zookeeper.*
+com.twitter.compose.rules.*
+com.twitter.diagnostics.*
+com.twitter.elephantbird.*
+com.twitter.finatra.*
+com.twitter.heron.*
+com.twitter.hraven.*
+com.twitter.inject.*
+com.twitter.penguin.*
+com.twitter.scoverage.*
+com.twitter.serial.*
+com.twitter.twittertext.*
+com.twizo.*
+com.twobuffers.suricate.*
+com.twobuffers.wire.*
+com.twocater.util.*
+com.twocheckout.*
+com.twodragonlake.*
+com.twofortyfouram.*
+com.twosigma.*
+com.twosigma.webtau.*
+com.twosigma.znai.*
+com.twosigmaiq.*
+com.twosixlabs.*
+com.twosixlabs.cdr4s.*
+com.twosixlabs.dart.*
+com.twosixlabs.dart.auth.*
+com.twosixlabs.dart.concepts.*
+com.twosixlabs.dart.corpex.*
+com.twosixlabs.dart.elasticsearch.*
+com.twosixlabs.dart.forklift.*
+com.twosixlabs.dart.ontologies.*
+com.twosixlabs.dart.operations.*
+com.twosixlabs.dart.rest.*
+com.twosixlabs.dart.status.reader.*
+com.twosixlabs.dart.tenants.*
+com.twosixlabs.dart.ui.*
+com.twosixlabs.dart.users.*
+com.twotoasters.GridViewPager.*
+com.twotoasters.RecyclerViewLib.*
+com.twotoasters.SectionCursorAdapter.*
+com.twotoasters.clusterkraf.*
+com.twotoasters.jazzylistview.*
+com.twotoasters.multicolumnlistadapter.*
+com.twotoasters.servos.*
+com.tx06.*
+com.tyagiabhinav.*
+com.tylereastman.*
+com.tylerhoersch.lingo24.*
+com.tylerthrailkill.*
+com.tylerthrailkill.helpers.*
+com.tylerwhitehurst.*
+com.tymate.couponlibrary.*
+com.tyntec.*
+com.typedpath.*
+com.typesafe.*
+com.typesafe.akka.*
+com.typesafe.conductr.*
+com.typesafe.dbuild.*
+com.typesafe.genjavadoc.*
+com.typesafe.netty.*
+com.typesafe.play.*
+com.typesafe.play.extras.*
+com.typesafe.play.modules.*
+com.typesafe.sbt.*
+com.typesafe.scala-logging.*
+com.typesafe.slick.*
+com.typesafe.zinc.*
+com.tyro.oss.*
+com.tyro.oss.pact.*
+com.tzanou.*
+com.tzavellas.*
+com.u1aryz.*
+com.u51.calcite.*
+com.u51.marble.*
+com.uber.*
+com.uber.artist.*
+com.uber.autodispose.*
+com.uber.autodispose2.*
+com.uber.cadence.*
+com.uber.cherami.*
+com.uber.crumb.*
+com.uber.engsec.*
+com.uber.hoodie.*
+com.uber.jaeger.*
+com.uber.javaxextras.*
+com.uber.kafka.*
+com.uber.lint-checks.*
+com.uber.m3.*
+com.uber.motif.*
+com.uber.nullaway.*
+com.uber.piranha.*
+com.uber.rib.*
+com.uber.rxcentralble.*
+com.uber.rxdogtag.*
+com.uber.rxdogtag2.*
+com.uber.sdk.*
+com.uber.simplestore.*
+com.uber.stylist.*
+com.uber.tchannel.*
+com.uberfusion.*
+com.ubertob.funky.*
+com.ubertob.kondor.*
+com.ubertob.pesticide.*
+com.ubertob.rest4sftp.*
+com.ubervu.*
+com.ubidots.*
+com.ubikgs.*
+com.ubiqsecurity.*
+com.ubirch.*
+com.ubirch.auth.*
+com.ubirch.avatar.*
+com.ubirch.chain.*
+com.ubirch.key.*
+com.ubirch.notary.*
+com.ubirch.storage.*
+com.ubirch.user.*
+com.ubirch.util.*
+com.ucasoft.kcron.*
+com.uchicom.*
+com.uchuhimo.*
+com.ucloudlink.css.*
+com.ucomponent.*
+com.ucsunup.*
+com.ucsunup.easylog.*
+com.ucweb.crashsdk.*
+com.ucweb.wpk.*
+com.udaan.archetypes.*
+com.udaan.snorql.*
+com.uddernetworks.newocr.*
+com.udemy.*
+com.udojava.*
+com.uduncloud.*
+com.ueboot.*
+com.uetty.*
+com.uetty.jedis.*
+com.uetty.tool.*
+com.ufoscout.*
+com.ufoscout.coreutils.*
+com.ufoscout.properlty.*
+com.ufoscout.vertk.*
+com.ufoscout.vertxk.*
+com.ui4j.*
+com.uid2.*
+com.uifuture.*
+com.uifuture.maven.plugins.*
+com.uiobjects.*
+com.ukiuni.*
+com.ulassancak.*
+com.ulegalize.*
+com.uliian.*
+com.ullink.gradle.*
+com.ullink.slack.*
+com.ultikits.*
+com.ultimatesoftware.sonar.plugins.mulesoft.*
+com.ultipa.*
+com.ultlog.*
+com.ultracart.*
+com.ultralytics.*
+com.ultramegasoft.radarchart.*
+com.ultramixer.*
+com.ultramixer.jarbundler.*
+com.ultraspatial.*
+com.umakantpatil.*
+com.umatrangolo.*
+com.umbraltech.*
+com.umbraltech.rxchange.*
+com.umeng.*
+com.umeng.analytics.*
+com.umeng.push.*
+com.umeng.sdk.*
+com.umeng.umsdk.*
+com.umlet.*
+com.umpay.project-core.*
+com.umtone.*
+com.unblu.openapi.*
+com.unblu.tools.*
+com.unblu.ua-parser.*
+com.unboundedprime.tapioca.*
+com.unboundid.*
+com.unboundid.components.*
+com.unboundid.product.scim.*
+com.unboundid.product.scim2.*
+com.unbxd.*
+com.unclezs.*
+com.uncopt.*
+com.undabot.izzy-json-api-android.*
+com.undabot.izzy-json-api.*
+com.undefinedlabs.*
+com.undefinedlabs.scope.*
+com.underwaterapps.overlap2druntime.*
+com.unfbx.*
+com.unfinished.simplemvi.*
+com.unflow.*
+com.unic.maven.plugins.*
+com.unicodecollective.*
+com.unicodecollective.dropwizard.*
+com.unicodelabs.*
+com.uniformlyrandom.*
+com.unimtx.*
+com.unionhole.*
+com.unionpaysmart.*
+com.uniquext.android.*
+com.uniquext.androidx.*
+com.uniquext.imageloader.*
+com.uniquext.widget.*
+com.uniscon.*
+com.unister.semweb.*
+com.unittesters.*
+com.unity3d.ads.*
+com.unity3d.mediation.*
+com.unity3d.services.identifiers.*
+com.unitymarvel.*
+com.uniubi.cloud.*
+com.uniubi.cloud.athena.*
+com.uniubi.device.*
+com.univapay.*
+com.universalmediaserver.*
+com.univocity.*
+com.unotags.*
+com.unowmo.code.microservice-wrap.*
+com.unowmo.code.stacked-machinery.*
+com.unquietcode.tools.flapi.*
+com.unquietcode.tools.jcodemodel.*
+com.unquietcode.tools.jstate.*
+com.unquietcode.tools.spring.*
+com.unquietcode.utils.*
+com.unseenspace.*
+com.unseenspace.junit.*
+com.unstablebuild.*
+com.unstoppabledomains.*
+com.unstoppabledomains.resolution.*
+com.untzuntz.authy.*
+com.untzuntz.ustack.*
+com.unuuu.*
+com.unvired.*
+com.unvnv.multi-adapter.*
+com.unvus.*
+com.unvus.firo.*
+com.unzer.payment.*
+com.uogome.*
+com.up1234567.*
+com.upcex.*
+com.upcwangying.cloud.samples.*
+com.upcwangying.cloud.samples.data.process.*
+com.upcwangying.cloud.samples.mdm.*
+com.upcwangying.cloud.samples.order.*
+com.upcwangying.cloud.samples.oss.*
+com.upcwangying.cloud.samples.product.*
+com.upcwangying.cloud.samples.user.*
+com.upcwangying.cloud.see.*
+com.updateimpact.*
+com.uphyca.*
+com.uphyca.galette.*
+com.uphyca.gradle.*
+com.uphyca.idobata.*
+com.uphyca.robota.*
+com.uphyca.testing.*
+com.uploadcare.*
+com.uploadcare.android.library.*
+com.uploadcare.android.widget.*
+com.upokecenter.*
+com.upplication.*
+com.upserve.*
+com.upshotideas.*
+com.upsolver.*
+com.upstox.api.*
+com.upuphub.*
+com.upwork.donkey.*
+com.upyun.*
+com.uqpay.sdk.*
+com.uralian.*
+com.urawho.*
+com.urbanairship.*
+com.urbanairship.android.*
+com.urbanmania.*
+com.urcsoft.*
+com.urielsalis.*
+com.uriio.*
+com.urmich.android.*
+com.urosporo.*
+com.ursaj.hfs.*
+com.ursful.framework.*
+com.urswolfer.gerrit.client.rest.*
+com.urx.android.*
+com.us-forever.*
+com.usabilla.sdk.*
+com.usalko.*
+com.usebutton.*
+com.usebutton.merchant.*
+com.usedopamine.*
+com.usefulmilk.*
+com.useinspetor.*
+com.useoptic.*
+com.usercentrics.sdk.*
+com.userexperior.*
+com.usergeek.*
+com.userleap.*
+com.uservoice.*
+com.uship.*
+com.usmanhussain.*
+com.usmanhussain.ghost.*
+com.usmanhussain.habanero.*
+com.usmanhussain.paprika.*
+com.usmanhussain.sonora.*
+com.usoog.*
+com.usthe.sureness.*
+com.ustwo.android.*
+com.utest.*
+com.utoblock.*
+com.utocat.*
+com.utopia-rise.*
+com.utopia-rise.kotlin-preprocessors.*
+com.uttesh.*
+com.uulookingfor.*
+com.uvasoftware.*
+com.uvic-cfar.swim.*
+com.uvic-cfar.swim.nasa.*
+com.uvic-cfar.swim.nasa.worldwind.*
+com.uvic-cfar.swim.ubc.cs.beta.*
+com.uvic-cfar.swim.ubc.cs.beta.models.*
+com.uwemeding.*
+com.uwetrottmann.*
+com.uwetrottmann.androidutils.*
+com.uwetrottmann.endpoints.*
+com.uwetrottmann.photoview.*
+com.uwetrottmann.seriesguide.*
+com.uwetrottmann.thetvdb-java.*
+com.uwetrottmann.threetenabp.*
+com.uwetrottmann.tmdb2.*
+com.uwetrottmann.trakt5.*
+com.uwyn.*
+com.uwyn.rife2.*
+com.uyatu.sdk.*
+com.uyoqu.*
+com.uyoqu.framework.*
+com.uzabase.*
+com.uzio.*
+com.v-collaborate.*
+com.v1ok.*
+com.v2cross.googlebilling.*
+com.v2hoping.*
+com.v5analytics.simpleorm.*
+com.v5analytics.webster.*
+com.vaadin.*
+com.vaadin.addon.*
+com.vaadin.componentfactory.*
+com.vaadin.componentfactory.webjar.*
+com.vaadin.external.*
+com.vaadin.external.atmosphere.*
+com.vaadin.external.atmosphere.client.*
+com.vaadin.external.atmosphere.samples.*
+com.vaadin.external.flute.*
+com.vaadin.external.google.*
+com.vaadin.external.gwt.*
+com.vaadin.external.gwt.web.bindery.*
+com.vaadin.external.json.*
+com.vaadin.external.jsoup.*
+com.vaadin.external.slf4j.*
+com.vaadin.external.streamhtmlparser.*
+com.vaadin.flow.ai.*
+com.vaadin.observability.*
+com.vaadin.polymer.*
+com.vaadin.servletdetector.*
+com.vaadin.webjar.*
+com.vaadin.wscdn.*
+com.vabrantgames.actionsystem.*
+com.vackosar.gitflowincrementalbuilder.*
+com.vackosar.gitobsoletebranchremover.*
+com.vaclavdedik.*
+com.vadeen.*
+com.valaphee.*
+com.valchkou.datastax.*
+com.valcoon.utils.*
+com.valentinilk.shimmer.*
+com.valhalla-game.*
+com.valtech.aapm.*
+com.valubio.*
+com.vambraceservices.*
+com.vandalsoftware.*
+com.vandalsoftware.android.*
+com.vandalsoftware.tools.gradle.*
+com.vaneunen.*
+com.vangogiel.luhnalgorithms.*
+com.vanillasource.config.*
+com.vanillasource.function.*
+com.vanillasource.gerec.*
+com.vanillasource.jaywire.*
+com.vanillasource.wicket-gatling.*
+com.vanniktech.*
+com.vanniktech.code.quality.tools.*
+com.vanniktech.dependency.graph.generator.*
+com.vanniktech.maven.publish.*
+com.vanniktech.maven.publish.base.*
+com.vanoma.oss.*
+com.vansteve911.*
+com.vantfo.framework.*
+com.varabyte.kotter.*
+com.varabyte.kotterx.*
+com.varabyte.truthish.*
+com.variacode.cep.storm.esper.*
+com.varmateo.aktoro.*
+com.varmateo.yawg.*
+com.varsql.*
+com.varunrajput.*
+com.varwise.*
+com.vasiliyspodin.*
+com.vast.*
+com.vast.common.*
+com.vast.sbt.*
+com.vatbox.*
+com.vaulka.kit.*
+com.vaushell.*
+com.vauthenticator.*
+com.vaynberg.wicket.select2.*
+com.vaynberg.wicket.select25.*
+com.vbabc.core.*
+com.vczyh.*
+com.vdurmont.*
+com.veact.*
+com.vechain.*
+com.vecna.*
+com.vecna.checkstyle.*
+com.vecna.cxf.*
+com.vecna.maven.*
+com.vecna.parent.*
+com.vectorprint.*
+com.vegardit.maven.*
+com.vektorsoft.demux.*
+com.vektorsoft.demux.android.*
+com.vektorsoft.demux.core.*
+com.vektorsoft.demux.desktop.*
+com.vektorsoft.demux.mobile.*
+com.vektorsoft.demux.native.*
+com.vektorsoft.demux.tools.*
+com.vektorsoft.demux.web.*
+com.velasolaris.e2e.swing.*
+com.velasolaris.polysun.*
+com.velevedi.baqla.*
+com.velexio.*
+com.velocidi.*
+com.velopayments.*
+com.velopayments.api.*
+com.vendasta.*
+com.venikkin.*
+com.venmo.android.pin.*
+com.venmo.cursor.*
+com.venmo.view.tooltip.*
+com.venomvendor.*
+com.venturocket.*
+com.venusource.app.qywechat.*
+com.venusource.ms.base.*
+com.veracode.annotation.*
+com.veracode.annotations.*
+com.veracode.vosp.api.wrappers.*
+com.verapi.abyss.*
+com.verhas.*
+com.vericite.*
+com.verifai.*
+com.verisec.frejaeid.*
+com.veritomyx.*
+com.verizon.journal.*
+com.verotel.*
+com.versal.*
+com.versioneye.*
+com.versionone.*
+com.vertabelo.gradle.*
+com.vertabelo.maven.*
+com.vertexvis.*
+com.vertica.jdbc.*
+com.vertica.spark.*
+com.vertigrated.*
+com.vertigrated.oss.*
+com.vertispan.gwtsupport.org.dmfs.*
+com.vertispan.j2cl.*
+com.vertispan.j2cl.archetypes.*
+com.vertispan.j2cl.external.*
+com.vertispan.javascript.*
+com.vertispan.jsinterop.*
+com.vertispan.nio.*
+com.vertispan.rpc.*
+com.vertispan.shortcut.*
+com.vertispan.tsdefs.*
+com.vertispan.turbine.*
+com.vertispan.webdriver.gwt.*
+com.ververica.*
+com.ververica.streamingledger.*
+com.ververve.*
+com.veryfi.*
+com.veryfi.android.*
+com.verygoodsecurity.*
+com.vesdk.*
+com.vesdk.videosdk.*
+com.veskogeorgiev.*
+com.vesoft.*
+com.vexdev.*
+com.vgaidarji.*
+com.vi-jane.cucumber.*
+com.viadeo.axonframework.*
+com.viae-it.maven.*
+com.viafoura.*
+com.viajobien.*
+com.viantinc.*
+com.viantinc.cachestore.*
+com.viantinc.voldemort.*
+com.viaoa.*
+com.viartemev.*
+com.viber.*
+com.vicrab.*
+com.victorivri.*
+com.victorlaerte.*
+com.victorrendina.*
+com.victorsavkin.grapes.*
+com.victorsima.*
+com.videoamp.*
+com.videoengager.*
+com.vietkite.adnetwork.*
+com.viewpagerindicator.*
+com.viewstreet.*
+com.vieztech.*
+com.vii.brillien.*
+com.viiyue.plugins.*
+com.vikingbrain.*
+com.vikingsen.*
+com.vikingsen.inject.*
+com.vikmad.*
+com.viliussutkus89.*
+com.viliussutkus89.licenseOnly.*
+com.vilt-group.minium.*
+com.vilynx.*
+com.vimalselvam.*
+com.vimdream.*
+com.vimdream.common.*
+com.vimeo.networking.*
+com.vimeo.stag.*
+com.vimhe.*
+com.vinaygaba.*
+com.vinaysshenoy.*
+com.vincejv.*
+com.vincentbrison.openlibraries.android.*
+com.vincenzoracca.*
+com.vincestyling.*
+com.vincestyling.asqliteplus.*
+com.vincomobile.fw.*
+com.vineetmanohar.*
+com.vinodborole.*
+com.vinumeris.*
+com.vip.pallas.*
+com.vip.saturn.*
+com.vip.vjtools.*
+com.vipulasri.*
+com.vipyinzhiwei.android.library.*
+com.virgilsecurity.*
+com.virgilsecurity.crypto.*
+com.virgilsecurity.pfs.*
+com.virgilsecurity.sdk.*
+com.viridiansoftware.*
+com.virjar.*
+com.virjar.sekiro.business.*
+com.virtlink.commons.*
+com.virtusa.gto.nyql.*
+com.virtusize.android.*
+com.virusbear.metrix.*
+com.virusbear.trace.*
+com.visenze.*
+com.visilabs.android.*
+com.vision4j.*
+com.visionarts.*
+com.viskan.*
+com.visual-tools.nubomedia.*
+com.visualci.imagecompare.*
+com.visualfiredev.*
+com.visulytic.*
+com.vitalize.*
+com.vitamineframework.*
+com.vitechteam.archtests.*
+com.vitexsoftware.netbeans.modules.php.*
+com.vitorsvieira.*
+com.vitorvillar.*
+com.vityuk.*
+com.vivi.*
+com.vividsolutions.*
+com.vivimice.*
+com.vizury.mobile.*
+com.vjh0107.barcode.*
+com.vk.*
+com.vk.androidsdk.*
+com.vk.api.*
+com.vk.knet.*
+com.vladimirlichonos.rxactions.*
+com.vladkopanev.*
+com.vladkrava.*
+com.vladmihalcea.*
+com.vladmihalcea.flexy-pool.*
+com.vladsch.boxed-json.*
+com.vladsch.boxed.json.*
+com.vladsch.flexmark.*
+com.vladsch.javafx-webview-debugger.*
+com.vladsch.kotlin-jdbc.*
+com.vladsch.plugin-test-util.*
+com.vladsch.plugin-util.*
+com.vladsch.reverse-regex.*
+com.vladsch.tree-iteration.*
+com.vliolios.*
+com.vlkan.*
+com.vlkan.hrrs.*
+com.vlkan.log4j2.*
+com.vlkan.rfos.*
+com.vmadalin.*
+com.vmlens.*
+com.vmos.*
+com.vmunier.*
+com.vmware.*
+com.vmware.antlr4-c3.*
+com.vmware.avi.sdk.*
+com.vmware.card-connectors.*
+com.vmware.dcm.*
+com.vmware.dcp.*
+com.vmware.devops.*
+com.vmware.jsonteng.*
+com.vmware.loginsightapi.*
+com.vmware.ovsdb.*
+com.vmware.photon.controller.*
+com.vmware.pscoe.*
+com.vmware.pscoe.archetypes.*
+com.vmware.pscoe.bsc.*
+com.vmware.pscoe.bsc.archetypes.*
+com.vmware.pscoe.build.*
+com.vmware.pscoe.cs.*
+com.vmware.pscoe.cs.archetypes.*
+com.vmware.pscoe.iac.*
+com.vmware.pscoe.library.*
+com.vmware.pscoe.maven.*
+com.vmware.pscoe.maven.plugins.*
+com.vmware.pscoe.npm.*
+com.vmware.pscoe.o11n.*
+com.vmware.pscoe.o11n.archetypes.*
+com.vmware.pscoe.polyglot.*
+com.vmware.pscoe.polyglot.archetypes.*
+com.vmware.pscoe.serverless.*
+com.vmware.pscoe.ts.types.*
+com.vmware.pscoe.vcd.*
+com.vmware.pscoe.vcd.archetypes.*
+com.vmware.pscoe.vra-ng.*
+com.vmware.pscoe.vra-ng.archetypes.*
+com.vmware.pscoe.vra.*
+com.vmware.pscoe.vra.archetypes.*
+com.vmware.pscoe.vrli.*
+com.vmware.pscoe.vrli.archetypes.*
+com.vmware.pscoe.vrops.*
+com.vmware.pscoe.vrops.archetypes.*
+com.vmware.saas.functional.test.*
+com.vmware.singleton.*
+com.vmware.test-operations.*
+com.vmware.vcloud.*
+com.vmware.xenon.*
+com.vnetpublishing.abcl.*
+com.vnetpublishing.java.*
+com.vnetpublishing.lisp.*
+com.vngrs.jsondroid.*
+com.vnomicscorp.*
+com.vocalabs.*
+com.vodafone.global.*
+com.vodori.*
+com.vogle.sbpayment.*
+com.vogosport.git.*
+com.voiweb.*
+com.vojajovanovic.*
+com.vokalinteractive.*
+com.vokalinteractive.widget.*
+com.volcengine.*
+com.volkhart.feedback.*
+com.volkhart.memory.*
+com.voltvoodoo.*
+com.vonage.*
+com.vonage.rtc.*
+com.vonchange.*
+com.vonchange.common.*
+com.voodoodyne.*
+com.voodoodyne.gstrap.*
+com.voodoodyne.gwizard.*
+com.voodoodyne.hattery.*
+com.voodoodyne.jackson.jsog.*
+com.voodoodyne.postguice.*
+com.voodoodyne.rollbar-logback.*
+com.voodoodyne.rollbar.*
+com.voodoodyne.shopify.*
+com.voodoodyne.tagonist.*
+com.voodoodyne.trivet.*
+com.voodoodyne.unsuck.*
+com.vorlonsoft.*
+com.vorstella.*
+com.vortexa.*
+com.vousutils.*
+com.voxeo.tropo.*
+com.voximplant.*
+com.vpaapi.*
+com.vplayed.*
+com.vplayed.player.*
+com.vpninspector.*
+com.vsee.*
+com.vseravno.solna.*
+com.vspglobal.ipa.*
+com.vsthost.rnd.*
+com.vtence.cli.*
+com.vtence.flintstone.*
+com.vtence.hamcrest.*
+com.vtence.kabinet.*
+com.vtence.konstruct.*
+com.vtence.mario.*
+com.vtence.molecule.*
+com.vtence.tape.*
+com.vtxsystems.*
+com.vungle.*
+com.vungle.android.*
+com.vuukle.android.*
+com.vvwyy.*
+com.vvwyy.cowpea.*
+com.vwkit.*
+com.vwo.*
+com.vwo.sdk.*
+com.vzaar.*
+com.vzornic.pgjsonb.*
+com.vzurauskas.nereides.*
+com.w2ji.vitaminsaber.*
+com.w2v4.*
+com.w3asel.*
+com.w3bstream.*
+com.wacai.*
+com.wada811.ax.*
+com.wada811.databindingktx.*
+com.wada811.dependencyproperty.*
+com.wada811.immutablependingintent.*
+com.wada811.lifecycledispose.*
+com.wada811.pubsubmessenger.*
+com.wada811.viewbindingktx.*
+com.wada811.viewlifecycleproperty.*
+com.wada811.viewmodelsavedstatektx.*
+com.wada811.viewsavedstatektx.*
+com.wadpam.*
+com.wadpam.gaelic.*
+com.wadpam.gimple.*
+com.wadpam.guja.*
+com.wadpam.oauth.*
+com.wadpam.opencomponents.*
+com.wadpam.openserver.*
+com.wadpam.survey.*
+com.wafflestudio.account.*
+com.waicool20.skrypton.*
+com.waigel.healthcard.*
+com.waigel.sgp22.asn1.*
+com.waigel.tolgee.*
+com.waioeka.*
+com.waioeka.graph.*
+com.waioeka.sbt.*
+com.waitmoon.ice.*
+com.wajahatkarim.*
+com.walberbeltrame.thoaded.*
+com.walding.*
+com.walinns.walinnsAndroid.*
+com.walinns.walinnsapi.*
+com.walksocket.*
+com.wallee.*
+com.wallee.resources.*
+com.walletconnect.*
+com.walletkit.*
+com.wallissoftware.*
+com.wallstft.*
+com.walmartlabs.*
+com.walmartlabs.appserver.*
+com.walmartlabs.bigben.*
+com.walmartlabs.concord.*
+com.walmartlabs.concord.docker.*
+com.walmartlabs.concord.it.*
+com.walmartlabs.concord.it.tasks.*
+com.walmartlabs.concord.k8s.*
+com.walmartlabs.concord.plugins.*
+com.walmartlabs.concord.plugins.basic.*
+com.walmartlabs.concord.runner.*
+com.walmartlabs.concord.runtime.*
+com.walmartlabs.concord.runtime.v1.*
+com.walmartlabs.concord.runtime.v2.*
+com.walmartlabs.concord.server.*
+com.walmartlabs.concord.server.plugins.*
+com.walmartlabs.concord.server.plugins.ansible.*
+com.walmartlabs.concord.server.plugins.noderoster.*
+com.walmartlabs.ern.*
+com.walmartlabs.netscaler.nitro.*
+com.walmartlabs.ollie.*
+com.walmartlabs.x12.*
+com.walnut-cloud.open.*
+com.walnutlabs.*
+com.walterjwhite.*
+com.walterjwhite.infrastructure.*
+com.walterjwhite.infrastructure.datastore.*
+com.walterjwhite.infrastructure.datastore.api.*
+com.walterjwhite.infrastructure.datastore.modules.*
+com.walterjwhite.infrastructure.dependencies.*
+com.walterjwhite.infrastructure.google-guice.*
+com.walterjwhite.infrastructure.google-guice.modules.*
+com.walterjwhite.java.*
+com.walterjwhite.java.aspects.*
+com.walterjwhite.java.browser.plugins.crawler.*
+com.walterjwhite.java.browser.plugins.pnc.modules.*
+com.walterjwhite.java.browser.plugins.prudential.modules.*
+com.walterjwhite.java.browser.plugins.vanguard.modules.*
+com.walterjwhite.java.browser.plugins.voya.modules.*
+com.walterjwhite.java.configuration.*
+com.walterjwhite.java.configuration.cli.*
+com.walterjwhite.java.dependencies.*
+com.walterjwhite.java.examples.*
+com.walterjwhite.java.infrastructure.*
+com.walterjwhite.java.infrastructure.datastore.*
+com.walterjwhite.java.infrastructure.datastore.api.*
+com.walterjwhite.java.infrastructure.datastore.modules.*
+com.walterjwhite.java.infrastructure.datastore.modules.jdbc-run.*
+com.walterjwhite.java.infrastructure.datastore.modules.jdbc-run.modules.*
+com.walterjwhite.java.infrastructure.datastore.modules.jdbc-run.modules.cli.*
+com.walterjwhite.java.infrastructure.datastore.modules.jdbc-run.modules.cli.providers.*
+com.walterjwhite.java.infrastructure.datastore.modules.jdbc-run.providers.*
+com.walterjwhite.java.infrastructure.datastore.providers.*
+com.walterjwhite.java.infrastructure.datastore.providers.jdo.*
+com.walterjwhite.java.infrastructure.datastore.providers.jdo.providers.*
+com.walterjwhite.java.infrastructure.datastore.providers.jpa.*
+com.walterjwhite.java.infrastructure.datastore.providers.jpa.modules.*
+com.walterjwhite.java.infrastructure.datastore.providers.jpa.providers.*
+com.walterjwhite.java.infrastructure.inject.*
+com.walterjwhite.java.infrastructure.inject.modules.*
+com.walterjwhite.java.infrastructure.inject.modules.cli.*
+com.walterjwhite.java.infrastructure.inject.modules.cli.providers.*
+com.walterjwhite.java.infrastructure.inject.modules.web.*
+com.walterjwhite.java.infrastructure.inject.modules.web.providers.*
+com.walterjwhite.java.infrastructure.inject.providers.*
+com.walterjwhite.java.infrastructure.metrics.*
+com.walterjwhite.java.infrastructure.metrics.modules.*
+com.walterjwhite.java.infrastructure.metrics.modules.elastic.*
+com.walterjwhite.java.infrastructure.metrics.modules.elastic.providers.*
+com.walterjwhite.java.infrastructure.metrics.modules.netflix-atlas.*
+com.walterjwhite.java.infrastructure.metrics.modules.netflix-atlas.providers.*
+com.walterjwhite.java.infrastructure.metrics.modules.prometheus.*
+com.walterjwhite.java.infrastructure.metrics.modules.prometheus.providers.*
+com.walterjwhite.java.infrastructure.property.*
+com.walterjwhite.java.infrastructure.property.modules.*
+com.walterjwhite.java.modules.*
+com.walterjwhite.java.modules.amazon.*
+com.walterjwhite.java.modules.amazon.modules.*
+com.walterjwhite.java.modules.authorization.*
+com.walterjwhite.java.modules.authorization.api.*
+com.walterjwhite.java.modules.browser.*
+com.walterjwhite.java.modules.browser.api.*
+com.walterjwhite.java.modules.browser.modules.*
+com.walterjwhite.java.modules.browser.modules.jbrowserdriver.*
+com.walterjwhite.java.modules.browser.modules.jbrowserdriver.providers.*
+com.walterjwhite.java.modules.browser.plugins.*
+com.walterjwhite.java.modules.browser.plugins.discover.*
+com.walterjwhite.java.modules.browser.plugins.discover.modules.*
+com.walterjwhite.java.modules.browser.plugins.discover.providers.*
+com.walterjwhite.java.modules.browser.plugins.pnc.*
+com.walterjwhite.java.modules.browser.plugins.pnc.providers.*
+com.walterjwhite.java.modules.browser.plugins.prudential.*
+com.walterjwhite.java.modules.browser.plugins.prudential.providers.*
+com.walterjwhite.java.modules.browser.plugins.vanguard.*
+com.walterjwhite.java.modules.browser.plugins.vanguard.providers.*
+com.walterjwhite.java.modules.browser.plugins.voya.*
+com.walterjwhite.java.modules.calendar.*
+com.walterjwhite.java.modules.calendar.api.*
+com.walterjwhite.java.modules.calendar.modules.*
+com.walterjwhite.java.modules.compression.*
+com.walterjwhite.java.modules.compression.api.*
+com.walterjwhite.java.modules.compression.modules.*
+com.walterjwhite.java.modules.compression.modules.xz.*
+com.walterjwhite.java.modules.compression.modules.xz.providers.*
+com.walterjwhite.java.modules.contact.*
+com.walterjwhite.java.modules.contact.api.*
+com.walterjwhite.java.modules.contact.modules.*
+com.walterjwhite.java.modules.csv.*
+com.walterjwhite.java.modules.csv.modules.*
+com.walterjwhite.java.modules.csv.modules.apache-commons-csv.*
+com.walterjwhite.java.modules.csv.modules.apache-commons-csv.providers.*
+com.walterjwhite.java.modules.csv.modules.apache-poi.*
+com.walterjwhite.java.modules.csv.modules.univocity-csv.*
+com.walterjwhite.java.modules.csv.plugins.*
+com.walterjwhite.java.modules.csv.plugins.index.*
+com.walterjwhite.java.modules.download.*
+com.walterjwhite.java.modules.download.api.*
+com.walterjwhite.java.modules.download.providers.*
+com.walterjwhite.java.modules.download.providers.commons-io.*
+com.walterjwhite.java.modules.download.providers.commons-io.providers.*
+com.walterjwhite.java.modules.email.*
+com.walterjwhite.java.modules.email.api.*
+com.walterjwhite.java.modules.email.modules.*
+com.walterjwhite.java.modules.email.modules.exchange.*
+com.walterjwhite.java.modules.email.modules.exchange.providers.*
+com.walterjwhite.java.modules.email.modules.javamail.*
+com.walterjwhite.java.modules.email.modules.javamail.providers.*
+com.walterjwhite.java.modules.email.modules.organization.*
+com.walterjwhite.java.modules.email.modules.organization.plugins.*
+com.walterjwhite.java.modules.email.modules.organzation.*
+com.walterjwhite.java.modules.email.modules.organzation.providers.*
+com.walterjwhite.java.modules.email.modules.template.*
+com.walterjwhite.java.modules.encryption.*
+com.walterjwhite.java.modules.encryption.providers.*
+com.walterjwhite.java.modules.feed.*
+com.walterjwhite.java.modules.feed.api.*
+com.walterjwhite.java.modules.file.*
+com.walterjwhite.java.modules.file.api.*
+com.walterjwhite.java.modules.file.modules.*
+com.walterjwhite.java.modules.file.modules.tar-directory-copier.*
+com.walterjwhite.java.modules.file.modules.tar-directory-copier.providers.*
+com.walterjwhite.java.modules.file.providers.*
+com.walterjwhite.java.modules.file.providers.local.*
+com.walterjwhite.java.modules.file.providers.local.providers.*
+com.walterjwhite.java.modules.financial.*
+com.walterjwhite.java.modules.financial.api.*
+com.walterjwhite.java.modules.identity.*
+com.walterjwhite.java.modules.identity.api.*
+com.walterjwhite.java.modules.identity.modules.*
+com.walterjwhite.java.modules.index.*
+com.walterjwhite.java.modules.index.modules.*
+com.walterjwhite.java.modules.index.modules.datastore.*
+com.walterjwhite.java.modules.index.modules.datastore.providers.*
+com.walterjwhite.java.modules.index.providers.*
+com.walterjwhite.java.modules.index.providers.elasticsearch.*
+com.walterjwhite.java.modules.index.providers.elasticsearch.providers.*
+com.walterjwhite.java.modules.ip.*
+com.walterjwhite.java.modules.ip.api.*
+com.walterjwhite.java.modules.linux-builder.*
+com.walterjwhite.java.modules.linux-builder.api.*
+com.walterjwhite.java.modules.linux-builder.modules.*
+com.walterjwhite.java.modules.linux-builder.modules.cli.*
+com.walterjwhite.java.modules.linux-builder.modules.cli.providers.*
+com.walterjwhite.java.modules.person.*
+com.walterjwhite.java.modules.person.api.*
+com.walterjwhite.java.modules.pipe.*
+com.walterjwhite.java.modules.pipe.modules.*
+com.walterjwhite.java.modules.planning.*
+com.walterjwhite.java.modules.planning.api.*
+com.walterjwhite.java.modules.planning.modules.*
+com.walterjwhite.java.modules.print.*
+com.walterjwhite.java.modules.print.api.*
+com.walterjwhite.java.modules.print.providers.*
+com.walterjwhite.java.modules.queue.*
+com.walterjwhite.java.modules.queue.api.*
+com.walterjwhite.java.modules.queue.modules.*
+com.walterjwhite.java.modules.queue.modules.event.*
+com.walterjwhite.java.modules.queue.modules.external.*
+com.walterjwhite.java.modules.queue.modules.external.providers.*
+com.walterjwhite.java.modules.queue.providers.*
+com.walterjwhite.java.modules.queue.providers.datastore.*
+com.walterjwhite.java.modules.queue.providers.datastore.providers.*
+com.walterjwhite.java.modules.remote.*
+com.walterjwhite.java.modules.remote.api.*
+com.walterjwhite.java.modules.remote.impl.*
+com.walterjwhite.java.modules.remote.impl.plugins.*
+com.walterjwhite.java.modules.remote.modules.*
+com.walterjwhite.java.modules.scm.*
+com.walterjwhite.java.modules.scm.api.*
+com.walterjwhite.java.modules.scm.providers.*
+com.walterjwhite.java.modules.scm.providers.git-cli.*
+com.walterjwhite.java.modules.scm.providers.git-cli.providers.*
+com.walterjwhite.java.modules.serialization.*
+com.walterjwhite.java.modules.serialization.api.*
+com.walterjwhite.java.modules.serialization.modules.*
+com.walterjwhite.java.modules.serialization.modules.jackson-databind.*
+com.walterjwhite.java.modules.serialization.modules.jackson-databind.providers.*
+com.walterjwhite.java.modules.serialization.modules.snakeyaml.*
+com.walterjwhite.java.modules.serialization.modules.snakeyaml.providers.*
+com.walterjwhite.java.modules.shell.*
+com.walterjwhite.java.modules.shell.api.*
+com.walterjwhite.java.modules.shell.providers.*
+com.walterjwhite.java.modules.ssh.*
+com.walterjwhite.java.modules.ssh.api.*
+com.walterjwhite.java.modules.ssh.providers.*
+com.walterjwhite.java.modules.template.*
+com.walterjwhite.java.modules.template.api.*
+com.walterjwhite.java.modules.template.providers.*
+com.walterjwhite.java.modules.web-service.*
+com.walterjwhite.java.modules.workflow.*
+com.walterjwhite.java.modules.workflow.api.*
+com.walterjwhite.java.modules.workflow.examples.*
+com.walterjwhite.modules.*
+com.walterjwhite.modules.compression.*
+com.walterjwhite.modules.compression.api.*
+com.walterjwhite.modules.compression.modules.*
+com.walterjwhite.modules.csv.*
+com.walterjwhite.modules.csv.modules.*
+com.walterjwhite.modules.encryption.*
+com.walterjwhite.modules.encryption.api.*
+com.walterjwhite.modules.encryption.modules.*
+com.walterjwhite.modules.file.*
+com.walterjwhite.modules.file.api.*
+com.walterjwhite.modules.file.modules.*
+com.walterjwhite.modules.file.providers.*
+com.walterjwhite.modules.queue.*
+com.walterjwhite.modules.queue.api.*
+com.walterjwhite.modules.queue.modules.*
+com.walterjwhite.modules.queue.modules.external.*
+com.walterjwhite.modules.queue.modules.external.providers.*
+com.walterjwhite.modules.serialization.*
+com.walterjwhite.modules.serialization.api.*
+com.walterjwhite.modules.serialization.modules.*
+com.walterjwhite.modules.ssh.*
+com.walterjwhite.modules.ssh.api.*
+com.waltznetworks.*
+com.wanari.*
+com.wandisco.*
+com.wandoulabs.akka.*
+com.wandoulabs.avro.*
+com.wandoulabs.jodis.*
+com.wandoulabs.math.*
+com.wandoulabs.nedis.*
+com.wandrell.*
+com.wandrell.archetype.*
+com.wandrell.archetypes.*
+com.wandrell.maven.*
+com.wandrell.maven.archetypes.*
+com.wandrell.maven.skins.*
+com.wandrell.tabletop.*
+com.wandrell.tabletop.dreadball.*
+com.wandrell.velocity.*
+com.wangcaitao.*
+com.wangenyong.*
+com.wangfengta.*
+com.wangguangwu.*
+com.wanghongfei.*
+com.wangjiangwen.*
+com.wangkh.moduler.*
+com.wangshanhai.dbdoc.*
+com.wangshanhai.formrules.*
+com.wangshanhai.guard.*
+com.wangshanhai.log.*
+com.wangshanhai.power.*
+com.wangshouyu.*
+com.wangyin.*
+com.wanolabs.kaya.*
+com.wantedly.*
+com.wappier.*
+com.wardziniak.*
+com.warmmen.*
+com.warnyul.android.fast-video-view.*
+com.warren-r.*
+com.warrenstrange.*
+com.waseefakhtar.*
+com.waseefakhtar.extendedplayerview.*
+com.waseemsabir.*
+com.washingtonpost.*
+com.washingtonpost.arc.ans.*
+com.washingtonpost.dropwizard.*
+com.washingtonpost.wordpress.*
+com.waspring.*
+com.waspring.framework.*
+com.waspring.wasdb.*
+com.waspring.wasindoor.*
+com.wassilak.*
+com.watchitlater.*
+com.watchrabbit.*
+com.wavecell.voice.*
+com.wavefront.*
+com.wavemaker.app.*
+com.wavemaker.app.build.*
+com.wavemaker.commons.*
+com.wavemaker.connector.build.*
+com.wavemaker.runtime.*
+com.wavemaker.runtime.connector.*
+com.wavemaker.studio.*
+com.wavemaker.tools.apidocs.*
+com.wavesenterprise.*
+com.wavesplatform.*
+com.wavesplatform.leveldb-jna.*
+com.wayfair.*
+com.waylau.*
+com.waylau.lite.*
+com.wbillingsley.*
+com.wcc-group.*
+com.wcdxg.edittextclear.*
+com.wchukai.*
+com.wcinformatics.tt.*
+com.wcinformatics.umls.server.*
+com.wcohen.*
+com.wda.sdbc.*
+com.wdtinc.*
+com.wdullaer.*
+com.wealdtech.*
+com.wealdtech.hawk.*
+com.wealoha.*
+com.wealthfront.*
+com.weareethic.community.*
+com.weather.*
+com.weather.android.*
+com.weatherlink.*
+com.weavechain.*
+com.weaverplatform.*
+com.web4enterprise.*
+com.webank.*
+com.webank.certtool.*
+com.webank.defibus.*
+com.webank.webase.*
+com.webank.wedatasphere.dss.*
+com.webank.wedatasphere.linkis.*
+com.webank.wedatasphere.schedulis.*
+com.webank.wedpr.*
+com.webank.weevent.*
+com.webarity.*
+com.webasyst.*
+com.webauthn4j.*
+com.webcerebrium.*
+com.webcohesion.enunciate.*
+com.webcohesion.ofx4j.*
+com.webencyclop.core.*
+com.webengage.*
+com.webex.*
+com.webex.connect.*
+com.webfirmframework.*
+com.webfleet.*
+com.webgeeker.*
+com.webgeoservices.woosmapgeofencing.*
+com.webguys.*
+com.webguys.ponzu.*
+com.webimageloader.*
+com.weblookandfeel.*
+com.weblyzard.api.*
+com.weblyzard.lib.string.*
+com.weblyzard.sparql.*
+com.webpagebytes.auth-gitkit.*
+com.webpagebytes.awsplugins.*
+com.webpagebytes.cms.*
+com.webpagebytes.plugins.*
+com.webpagebytes.wpbsample.*
+com.webrippers.*
+com.websitebeaver.*
+com.websudos.*
+com.webtide.hightide.*
+com.webtoonscorp.android.*
+com.webull.openapi.*
+com.weclassroom.chat.*
+com.weclassroom.commonutils.*
+com.weclassroom.documentlibrary.*
+com.weclassroom.liveclass.*
+com.weclassroom.livecore.*
+com.weclassroom.livestream.*
+com.weclassroom.liveui.*
+com.weclassroom.logger.*
+com.weclassroom.mediaplayerlib.*
+com.weclassroom.msgchannel.*
+com.weclassroom.scribble.*
+com.weclassroom.talmedialibrary.*
+com.weclassroom.weiduan.*
+com.wedasoft.*
+com.wedeploy.*
+com.wee0.*
+com.wee0.box.*
+com.weedow.*
+com.wefika.*
+com.wefika.gradle.*
+com.weghst.setaria.*
+com.wegtam.*
+com.weibo.*
+com.weicoder.*
+com.weicoder.extend.*
+com.weicoder.fork.*
+com.weicools.*
+com.weightwatchers.*
+com.weiglewilczek.bnd4sbt.*
+com.weiglewilczek.sbteclipse.*
+com.weiglewilczek.scala-lang-osgi.*
+com.weiglewilczek.scalamodules.*
+com.weiglewilczek.slf4s.*
+com.weirddev.*
+com.weisiliang.*
+com.weiwangcn.betterspinner.*
+com.welemski.*
+com.wellch4n.*
+com.wellfactored.*
+com.welltech.*
+com.wemakebetterapps.*
+com.wendyliga.*
+com.wenyu7980.*
+com.wenzani.*
+com.weoohh.*
+com.weown.*
+com.wepay.*
+com.wepay.kcbq.*
+com.wepay.riff.*
+com.wepay.waltz.*
+com.wepay.zktools.*
+com.werdpressed.partisan.*
+com.wesleyhome.*
+com.wesleyhome.aws.koin.*
+com.wesleyhome.johksoftware.*
+com.wesleyhome.johksoftware.resource.*
+com.wesleyhome.jpa.*
+com.wesleyhome.koin.*
+com.wesleyhome.test.*
+com.west.repo.*
+com.westerfeld.rewritehtml.*
+com.westy92.holiday-event-api.*
+com.wesuresoft.sdk.*
+com.wetjens.springframework.*
+com.wexalian.common.*
+com.wexalian.config.*
+com.wexalian.jtrakt.*
+com.wexalian.nullability.*
+com.wf2311.*
+com.wgtwo.*
+com.wgtwo.api.*
+com.wgtwo.api.grpc.*
+com.wgtwo.api.grpc.utils.*
+com.wgtwo.api.v0.*
+com.wgtwo.api.v0.grpc.*
+com.wgtwo.api.v1.*
+com.wgtwo.api.v1.grpc.*
+com.wgzhao.addax.*
+com.wgzhao.datax.*
+com.whaleal.*
+com.whaleal.icefrog.*
+com.whaleal.liguanfei.*
+com.whaleal.mars.*
+com.whalin.*
+com.what3words.*
+com.whatsapp.stringpacks.*
+com.whatspos.sdk.*
+com.whereismytransport.othertree.client.*
+com.whereismytransport.othertree.client.android.*
+com.whereismytransport.transportapisdk.*
+com.whiletrue.*
+com.whirlycott.*
+com.whirvis.*
+com.whisk.*
+com.whispir.*
+com.whiteclarkegroup.*
+com.whitehatsec.*
+com.whitepages.*
+com.whizzosoftware.*
+com.whlylc.*
+com.wholegrain-software.*
+com.whosly.*
+com.whosly.disclosure.*
+com.whosly.rapid.*
+com.whxinpai.*
+com.whxinpai.aliyun.*
+com.whyun.*
+com.wichell.*
+com.widen.*
+com.widen.oss.*
+com.widowcrawler.*
+com.wiebe-elsinga.android.library.*
+com.wiiisdom.*
+com.wijdemans.*
+com.wikia.*
+com.wildbit.java.*
+com.wilddiary.*
+com.wilddog.*
+com.wilddog.client.*
+com.wilddog.location.*
+com.wilddog.sms.*
+com.wilddog.wilddogim.*
+com.wiley.*
+com.will4it.wmframe.*
+com.willhains.*
+com.williammora.*
+com.williamww.*
+com.willowtreeapps.*
+com.willowtreeapps.android.maven.plugins.*
+com.willowtreeapps.assertk.*
+com.willowtreeapps.gradle.plugins.*
+com.willowtreeapps.hyperion.*
+com.willowtreeapps.maven.plugins.*
+com.willowtreeapps.opentest4k.*
+com.willowtreeapps.saguaro.*
+com.willwinder.*
+com.willwinder.lbry4j.*
+com.willwinder.robinhood4j.*
+com.willwinder.universalgcodesender.*
+com.wind-matrix.*
+com.windfalldata.*
+com.windhc.*
+com.windhoverlabs.*
+com.windowsazure.*
+com.windpanda.doc.*
+com.windpanda.jmapper-framework.*
+com.windpicker.*
+com.winged-tech.*
+com.winnerlook.*
+com.winor30.*
+com.winricklabs.*
+com.winterbe.*
+com.winterchen.*
+com.winterparadox.*
+com.winterwell.*
+com.wire.*
+com.wire.qa.*
+com.wire.zoom.*
+com.wirecash.*
+com.wirefreethought.geodb.*
+com.wireguard.android.*
+com.wirelust.bitbucket.client.*
+com.wirelust.sonar.plugins.bitbucket.*
+com.wiris.plugin.*
+com.wirktop.*
+com.wisecoders.*
+com.withabound.*
+com.withkash.*
+com.withplum.*
+com.withwiz.*
+com.wiwiwa.*
+com.wix.*
+com.wix.commons.*
+com.wix.fax.*
+com.wix.hoopoe.http.*
+com.wix.hoopoe.koboshi.*
+com.wix.openrest.*
+com.wix.pay.*
+com.wix.rest.*
+com.wix.restaurants.*
+com.wix.sms.*
+com.wixct.*
+com.wixpress.*
+com.wizarius.*
+com.wizecommerce.*
+com.wizenoze.*
+com.wizzardo.*
+com.wizzardo.tools.*
+com.wizzdi.*
+com.wjoel.*
+com.wkclz.util.*
+com.wkovacs64.*
+com.wl4g.*
+com.wmbest.barstool.*
+com.wmbest.gradle.*
+com.wmbest.widget.*
+com.wmp.*
+com.wmp.intellio.*
+com.wnafee.*
+com.woaizhuangbi.*
+com.wokdsem.kinject.*
+com.wolfninja.keystore.*
+com.wolftechnica.cloud.*
+com.wolpl.*
+com.wolpl.clikt-testkit.*
+com.wolt.arrow.detekt.*
+com.wolt.osm.*
+com.wombatnation.*
+com.womply.cassandradao.*
+com.womply.killbill.plugins.*
+com.wonderpush.*
+com.wooga.github.*
+com.wooga.gradle.*
+com.wooga.security.*
+com.wooga.snyk.*
+com.wooga.spock.extensions.*
+com.wooga.xcodebuild.*
+com.woorank.api.*
+com.woorea.*
+com.wootric.*
+com.woozooha.*
+com.wordnik.*
+com.wordnik.swagger.*
+com.wordpress.javaenterprise7.*
+com.wordpress.vijaychutty.*
+com.workable.dropwizard.*
+com.workable.honeybadger.*
+com.workday.*
+com.workday.warp.*
+com.workec.open.*
+com.workflowfm.*
+com.workingmouse.*
+com.workiva.*
+com.workos.*
+com.workoss.boot.*
+com.workplacesystems.queuj.*
+com.workplacesystems.utilsj.*
+com.workrefined.*
+com.worksap.*
+com.worksap.nlp.*
+com.worksap.timachine.*
+com.worksap.tools.*
+com.workshare.msnos.*
+com.worldline-solutions.*
+com.worldline.payments.*
+com.worldline.playground.*
+com.worldline.sips.*
+com.worldofbooks.*
+com.worldpay.*
+com.worldpay.access.*
+com.worldpay.api.client.*
+com.worldpay.api.commons.*
+com.worldpay.api.root.*
+com.worldsnas.*
+com.worldturner.medeia.*
+com.worthent.foundation.*
+com.wowostar.*
+com.woyouyigegushi.common-ls.*
+com.wrapp.floatlabelededittext.*
+com.wrbug.kv.*
+com.writingminds.*
+com.wrld3d.*
+com.wshlfx.uniboot.*
+com.wsojka.*
+com.wtanaka.*
+com.wttch.*
+com.wttch.plugin.*
+com.wttch.plugin.gradle.*
+com.wttch.wcbs.*
+com.wu-man.*
+com.wubaer.sghd.*
+com.wuchuheng.*
+com.wudaosoft.*
+com.wudgaby.platform.*
+com.wueasy.*
+com.wueasy.admin.*
+com.wuhdev.*
+com.wujunhao1024.*
+com.wultra.android.digitalonboarding.*
+com.wultra.android.mtokensdk.*
+com.wultra.android.passphrasemeter.*
+com.wultra.android.powerauth.*
+com.wultra.android.sslpinning.*
+com.wultra.security.*
+com.wunderbee.kompack.*
+com.wunderlist.*
+com.wunderlist.android-sliding-layer-lib.*
+com.wunderlist.slidinglayer.*
+com.wupaas.*
+com.wurenzhi.*
+com.wuriyanto.*
+com.wutka.*
+com.wuweibi.*
+com.wuwenze.*
+com.wuxudu.*
+com.wuyunonline.tracelog.*
+com.wuyushuo.*
+com.wuzhenpay.*
+com.wvkity.*
+com.ww.*
+com.wwpass.*
+com.wwt.jetflowlibrary.*
+com.wxdfun.*
+com.wxipad.wechat.*
+com.wxmlabs.*
+com.wxxsxx.*
+com.wybusy.*
+com.wywy.*
+com.wzili.*
+com.wzy.*
+com.x-breeze.powerdecomposer.*
+com.x-breeze.test.*
+com.x2iq.tools.*
+com.x2iq.tunneling.*
+com.x5dev.*
+com.x5e.*
+com.xaadin.*
+com.xamarin.testcloud.*
+com.xantoria.*
+com.xasync.*
+com.xavax.*
+com.xb-custom.*
+com.xbctechnologies.*
+com.xboxng.*
+com.xboxng.XNConfig.*
+com.xcbd-monitor.*
+com.xceptance.*
+com.xconns.peerdevicenet.*
+com.xdev-software.*
+com.xe.xecd.*
+com.xebia.*
+com.xebia.incubator.*
+com.xebia.karat.*
+com.xebialabs.cloud.*
+com.xebialabs.gradle.plugins.*
+com.xebialabs.overthere.*
+com.xebialabs.restito.*
+com.xebialabs.utils.*
+com.xeiam.*
+com.xeiam.xchange.*
+com.xeiam.xchart.*
+com.xellitix.commons.*
+com.xellitix.jenkins.*
+com.xendit.*
+com.xendit.xenissuing.*
+com.xenoamess.*
+com.xenoamess.asm.*
+com.xenoamess.cyan_potion.*
+com.xenoamess.docker.*
+com.xenoamess.fork.org.apache.commons.*
+com.xenoamess.metasploit.java-external-module.*
+com.xenoamess.p3c.*
+com.xenoamess.x8l.*
+com.xenomachina.*
+com.xeonyu.*
+com.xfers.*
+com.xfinity.*
+com.xfmeet.*
+com.xfvape.*
+com.xfvape.cors.*
+com.xfvape.swagger.*
+com.xfvape.uid.*
+com.xfyre.*
+com.xfyre.maven.plugins.*
+com.xgc1986.parallaxPagerTransformer.*
+com.xhinliang.*
+com.xhiteam.dxf.*
+com.xhiteam.xauth.*
+com.xiachufang.*
+com.xianlaocai.quant.*
+com.xiantrimble.*
+com.xiantrimble.combinatorics.*
+com.xiantrimble.maven.*
+com.xiaoazhai.*
+com.xiaoazhai.collectPay.*
+com.xiaoetong.android.sdk.*
+com.xiaohaoo.*
+com.xiaohaoo.dependencies.*
+com.xiaohaoo.gradle.*
+com.xiaohaoo.maven-publishing.*
+com.xiaohaoo.storage.*
+com.xiaohaoo.toolkit.*
+com.xiaojianzheng.*
+com.xiaoleilu.*
+com.xiaomi.billingclient.*
+com.xiaomi.duckling.*
+com.xiaomi.infra.*
+com.xiaomi.infra.galaxy.*
+com.xiaoyudeguang.*
+com.xiayk.template.*
+com.xieahui.springboot.*
+com.xiejr.actuator.*
+com.xiezuocat.*
+com.xiledsystems.*
+com.xilinx.rapidwright.*
+com.ximedes.*
+com.ximpleware.*
+com.xing.android.*
+com.xing.api.*
+com.xing.beetle.*
+com.xing.testing.*
+com.xingyuv.*
+com.xinliangxiang.*
+com.xiongyayun.*
+com.xiongyingqi.*
+com.xishankeji.*
+com.xishankeji.forks.*
+com.xixudi.*
+com.xjeffrose.*
+com.xk72.*
+com.xkcoding.*
+com.xkcoding.http.*
+com.xkcoding.json.*
+com.xkcoding.justauth.*
+com.xkcoding.nacos.*
+com.xkw.xop.*
+com.xlauch.*
+com.xliic.*
+com.xlongwei.logserver.*
+com.xlrit.gears.runtime.*
+com.xlrit.gears.runtime.cases.*
+com.xlrit.gears.scripts.*
+com.xlson.groovycsv.*
+com.xlvchao.clickhouse.*
+com.xlvecle.*
+com.xlythe.*
+com.xmadx.*
+com.xmlayout.*
+com.xmlcalabash.*
+com.xmllondon.*
+com.xncoding.*
+com.xnx3.*
+com.xnx3.cache.*
+com.xnx3.chatbot.*
+com.xnx3.doc.javadoc.*
+com.xnx3.elasticsearch.*
+com.xnx3.json.*
+com.xnx3.rabbitmq.*
+com.xnx3.swing.*
+com.xnx3.util.*
+com.xnx3.wangmarket.*
+com.xnx3.wangmarket.shop.*
+com.xnx3.wangmarket.wm.*
+com.xnx3.weixin.*
+com.xnx3.wm.autoPublish.*
+com.xnx3.wm.plugin.*
+com.xnx3.writecode.*
+com.xobotun.*
+com.xooa.*
+com.xored.maven.*
+com.xored.scalajs.*
+com.xored.vertx.*
+com.xorlev.grpc-jersey.*
+com.xpanxion.fighting-layout-bugs.*
+com.xpatterns.*
+com.xpatterns.spark.parquet.*
+com.xpcagey.*
+com.xpfriend.*
+com.xpressj.*
+com.xqbase.*
+com.xracoon.*
+com.xracoon.utils.*
+com.xresch.*
+com.xrosstools.*
+com.xsdacdn.*
+com.xsolla.*
+com.xsolla.android.*
+com.xspacesoft.kowalski7cc.*
+com.xt-i.*
+com.xtdb.*
+com.xtdb.labs.*
+com.xtivia.speedray.*
+com.xtivia.tools.*
+com.xuanner.*
+com.xuelangcloud.*
+com.xuelangyun.*
+com.xuie0000.*
+com.xulog.lib.*
+com.xumumi.*
+com.xundacloud.dubai.*
+com.xunpou.*
+com.xunpou.net.*
+com.xuxueli.*
+com.xwc1125.*
+com.xwc1125.chain5j.*
+com.xwl41.*
+com.xwlljj.rxexpressapp.*
+com.xwsos.*
+com.xwzhou.*
+com.xxcore.code.*
+com.xxelin.*
+com.xxlabaza.utils.*
+com.xxscloud.parent.*
+com.xxscloud.sdk.*
+com.xxscloud.strawberry.*
+com.xxxnell.*
+com.xyniac.*
+com.xyzla.*
+com.xyzwps.lib.*
+com.xzchaoo.*
+com.xzchaoo.asyncexecutor.*
+com.xzchaoo.batchprocessor.*
+com.xzchaoo.commons.*
+com.xzchaoo.filequeue.*
+com.xzchaoo.hashedworkerpool.*
+com.xzchaoo.hc.*
+com.xzchaoo.parent.*
+com.xzchaoo.springsupport.*
+com.xzchaoo.utils.*
+com.xzixi.*
+com.xzixi.algorithm.*
+com.xzixi.framework.*
+com.xzixi.self.portal.*
+com.xzixi.utils.*
+com.y-l-w.enterprise.*
+com.y1ph.*
+com.y3tu.*
+com.yagzanmanju.*
+com.yahacode.*
+com.yahoo.athenz.*
+com.yahoo.bard.*
+com.yahoo.behaviorgraph.*
+com.yahoo.bullet.*
+com.yahoo.container.maven.plugin.*
+com.yahoo.datasketches.*
+com.yahoo.egads.*
+com.yahoo.elide.*
+com.yahoo.gondola.*
+com.yahoo.gondola.containers.*
+com.yahoo.imapnio.*
+com.yahoo.labs.samoa.*
+com.yahoo.maha.*
+com.yahoo.mobile.client.android.util.rangeseekbar.*
+com.yahoo.oak.*
+com.yahoo.omid.*
+com.yahoo.oozie.*
+com.yahoo.parsec.*
+com.yahoo.platform.yui.*
+com.yahoo.pulsar.*
+com.yahoo.rdl.*
+com.yahoo.sherlock.*
+com.yahoo.smtpnio.*
+com.yahoo.sql4d.*
+com.yahoo.tagchowder.*
+com.yahoo.validatar.*
+com.yahoo.vespa.*
+com.yahoo.vespa.bundle-plugin.*
+com.yahoo.vespa.container-test-jars.*
+com.yahoo.vespa.hosted.*
+com.yahoo.vespa.jdisc_core.*
+com.yahoo.xpathproto.*
+com.yahoofinance-api.*
+com.yakaz.elasticsearch.plugins.*
+com.yakirchen.*
+com.yakivmospan.*
+com.yalantis.*
+com.yallachat.support.*
+com.yamanyar.*
+com.yamilovs.insomnia.*
+com.yaml-validator.*
+com.yammer.backups.*
+com.yammer.breakerbox.*
+com.yammer.collections.*
+com.yammer.collections.azure.*
+com.yammer.dropwizard.*
+com.yammer.dropwizard.testing.*
+com.yammer.metrics.*
+com.yammer.telemetry.*
+com.yammer.tenacity.*
+com.yan-yun.*
+com.yandex.ads.adapter.*
+com.yandex.ads.mediation.*
+com.yandex.android.*
+com.yandex.classifieds.*
+com.yandex.cloud.*
+com.yandex.div.*
+com.yandex.java.*
+com.yandex.pay.*
+com.yandex.varioqub.*
+com.yandex.yatagan.*
+com.yandex.ydb.*
+com.yandex.yoctodb.*
+com.yang-bo.*
+com.yang-bo.dsl.domains.akka.actor.*
+com.yang-bo.dsl.keywords.akka.*
+com.yang-bo.dsl.keywords.akka.actor.*
+com.yangpingapps.*
+com.yangxiaochen.*
+com.yangxiaochen.commons.*
+com.yangxiaochen.dlock.*
+com.yanhaopeng.*
+com.yanimetaxas.*
+com.yankaizhang.*
+com.yannbriancon.*
+com.yannmoisan.*
+com.yantonov.*
+com.yantranet.*
+com.yanxisir.*
+com.yanzhenjie.*
+com.yanzhenjie.alertdialog.*
+com.yanzhenjie.andserver.*
+com.yanzhenjie.apache.*
+com.yanzhenjie.nohttp.*
+com.yanzhenjie.permission.*
+com.yanzhenjie.recyclerview.*
+com.yanzhenjie.zbar.*
+com.yaoakeji.*
+com.yaoruozhou.*
+com.yarhrn.*
+com.yarsquidy.*
+com.yashoid.*
+com.yasserm.*
+com.yasudanetwork.struts2.*
+com.yasuoza.plugin.*
+com.yat3s.openai.*
+com.yatracker.*
+com.yayandroid.*
+com.yazantarifi.*
+com.ybrikman.ping.*
+com.ycframe.*
+com.ycloud.*
+com.ycourlee.oss.*
+com.ycourlee.tranquil.*
+com.yeaya.*
+com.yeepay.*
+com.yeepay.cashierandroid.*
+com.yeepay.yop.sdk.*
+com.yeetrack.selenium.*
+com.yegor256.*
+com.yegortimoshenko.*
+com.yehebl.*
+com.yeliheng.*
+com.yelp.android.*
+com.yelp.clientlib.*
+com.yelp.nrtsearch.*
+com.yepher.jsondoc.*
+com.yeskery.nut.*
+com.yesmail.*
+com.yesql4j.*
+com.yesup.oss.*
+com.yetaoii.*
+com.yetu.*
+com.yevdo.*
+com.yevgenyk.simplesoapclient.*
+com.yexperiment.*
+com.ygmodesto.modernfit.*
+com.yhyzgn.document.*
+com.yhyzgn.http.*
+com.yhyzgn.jakit.*
+com.yhyzgn.utils.*
+com.yhzdys.*
+com.yicenyun.casdoor.*
+com.yieldnull.*
+com.yifeistudio.*
+com.yiji.framework.*
+com.yijianguanzhu.iflytek.*
+com.yikuni.*
+com.yikuni.mc.*
+com.yilanwuyu.*
+com.yilers.*
+com.yilihjy.*
+com.yilnz.*
+com.yinxiang.*
+com.yinxiang.microservice.*
+com.yinxiang.utils.*
+com.yinzara.*
+com.yioks.core.*
+com.yiqiniu.easytrans.*
+com.yirendai.infra.*
+com.yiruibim.cairo.*
+com.yiruibim.cairo.starter.*
+com.yishuifengxiao.common.*
+com.yitongmed.*
+com.yiwise.*
+com.yiwowang.sdk.*
+com.yixan.java.core.*
+com.yixsoft.*
+com.yizhuoyan.*
+com.yjntc.*
+com.ykkblog.*
+com.ymock.*
+com.ymock.mock.*
+com.yo1000.*
+com.yoc.visx.sdk.*
+com.yoctopuce.android.*
+com.yoctopuce.archetype.*
+com.yoctopuce.java.*
+com.yodle.*
+com.yodle.griddle.*
+com.yodlee.*
+com.yodo1.*
+com.yodo1.analytics.*
+com.yodo1.common.*
+com.yodo1.live-ops.*
+com.yodo1.mas.*
+com.yodo1.mas.mediation.*
+com.yodo1.mas.mediation.adapters.*
+com.yodo1.mas.mediation.admob.adapters.*
+com.yodo1.mas.mediation.facebook.adapters.*
+com.yodo1.mas.mediation.fyber.adapters.*
+com.yodo1.mas.mediation.inmobi.adapters.*
+com.yodo1.mas.mediation.ironsource.adapters.*
+com.yodo1.mas.mediation.kidoz.adapters.*
+com.yodo1.mas.mediation.mintegral.adapters.*
+com.yodo1.mas.mediation.mytarget.adapters.*
+com.yodo1.mas.mediation.pangle.adapters.*
+com.yodo1.mas.mediation.unityads.adapters.*
+com.yodo1.mas.mediation.vungle.adapters.*
+com.yodo1.mas.mediation.yandex.adapters.*
+com.yodo1.poseidon.*
+com.yodo1.share.*
+com.yodo1.share.adapter.*
+com.yodo1.suit.advert.*
+com.yodo1.suit.analytics.*
+com.yodo1.suit.anti.*
+com.yodo1.suit.bridge.*
+com.yodo1.suit.pay.*
+com.yodo1.suit.plugin.*
+com.yodo1.suit.share.*
+com.yodo1.ua.*
+com.yofish.platform.*
+com.yogcloud.nacos.*
+com.yogcloud.tackfast.*
+com.yogeshpaliyal.*
+com.yogpc.*
+com.yoiul.nanobot.*
+com.yolinkmob.*
+com.yoloho.enhanced.*
+com.yoloho.enhanced.data.*
+com.yoloho.enhanced.parent.*
+com.yoloho.push.*
+com.yoloho.schedule.*
+com.yoloho.tair.*
+com.yomahub.*
+com.yongdui.*
+com.yonyou.agent.android.*
+com.yoohaemin.*
+com.yooiistudios.*
+com.yookue.mavenplugin.*
+com.yoozoo.protoconf.*
+com.yopeso.*
+com.yordex.*
+com.yoshikimoji.oss.*
+com.yoti.*
+com.yoti.mobile.android.*
+com.yoti.mobile.android.common.ui.*
+com.yoti.mobile.android.commons.ui.*
+com.yoti.mobile.android.core.*
+com.yoti.mobile.android.keys.*
+com.yoti.mobile.android.sdk.*
+com.yoti.mobile.mpp.*
+com.yoti.tags.*
+com.yotpo.*
+com.youbenzi.*
+com.youcruit.*
+com.youcruit.ams.api.client.*
+com.youcruit.com.cybozu.labs.*
+com.youcruit.textkernel.client.*
+com.youdatasum.*
+com.youdevise.*
+com.youengineering.*
+com.youhaosuda.*
+com.youkol.*
+com.youkol.support.kaptcha.*
+com.youkol.support.qpid.*
+com.youkol.support.scribejava.*
+com.youkol.support.shiro.*
+com.youkol.support.storage.*
+com.young-datafan.*
+com.youramaryllis.*
+com.yourmediashelf.fedora.*
+com.yourmediashelf.fedora.akubra.*
+com.yourmediashelf.fedora.client.*
+com.youset.l2cache.*
+com.youta8.*
+com.youta8.cloud.*
+com.youthlin.*
+com.youview.*
+com.youymi.*
+com.youzan.*
+com.youzan.mobile.*
+com.youzanyun.open.mobile.*
+com.yoyodeer.*
+com.yoyonewbie.android.lib.*
+com.yqpkj.*
+com.yqpkj.fdf.*
+com.yqpkj.fdf.archetype.*
+com.yrashk.*
+com.yscope.clp.*
+com.yscope.logging.*
+com.ysyao.*
+com.yuangancheng.*
+com.yuanheng100.*
+com.yuanhoujun.*
+com.yuansfer.*
+com.yuanzhixiang.bt.*
+com.yuanzhy.sqldog.*
+com.yubico.*
+com.yubico.bitcoin.*
+com.yubico.java.*
+com.yubico.yubikit.*
+com.yuchesc.*
+com.yucongming.*
+com.yuebaix.*
+com.yuehuanghun.*
+com.yugabyte.*
+com.yugabyte.spark.*
+com.yugankasharan.bernoulli.*
+com.yuhuizhao.*
+com.yukihirai0505.*
+com.yukihirai0505.default.*
+com.yullg.android.*
+com.yumimobi.ads.*
+com.yumimobi.ads.mediation.*
+com.yumimobi.ads.sdk.*
+com.yungnickyoung.minecraft.yungsapi.*
+com.yungouos.pay.*
+com.yunhetong.*
+com.yunify.*
+com.yunkuangao.*
+com.yunmel.syncretic.*
+com.yunpian.sdk.*
+com.yunyear.code.*
+com.yunzhanghu.openapi.*
+com.yupaits.*
+com.yupzip.json.*
+com.yuqianhao.*
+com.yurique.*
+com.yurplan.*
+com.yurybubnov.oss.*
+com.yusufaytas.*
+com.yusute.*
+com.yuvalshavit.*
+com.yuvimasory.*
+com.yuvimasory.tostring.*
+com.yuweix.*
+com.yuweix.boot.*
+com.yuxuan66.*
+com.yuyisummer.base.*
+com.yuyisummer.opensdk.*
+com.yuyisummer.widget.*
+com.yuzeh.*
+com.yworks.*
+com.yxlisv.*
+com.yxt.*
+com.yxt.opensdk.*
+com.yxt.opensdk.atool.*
+com.yxt.opensdk.atool.router.*
+com.yxt.opensdk.atool.subunit.*
+com.yxt.opensdk.library.*
+com.yxt.opensdk.library.library_photoviewer.*
+com.yxt.opensdk.library_http.*
+com.yxt.opensdk.library_live.*
+com.yxt.opensdk.library_native_sqlite.*
+com.yxt.opensdk.library_photoviewer.*
+com.yxt.sdk.atool.subunit.*
+com.yy.*
+com.yycdev.*
+com.yyjzy.*
+com.yyself.*
+com.yyter.web.*
+com.yzk18.*
+com.yzycoc.*
+com.z-mq.*
+com.zaber.*
+com.zachary-moore.*
+com.zachklipp.*
+com.zachklipp.compose-richtext.*
+com.zachklipp.compose-undo.*
+com.zachklipp.seqdiag.*
+com.zackehh.*
+com.zackjp.*
+com.zackku.*
+com.zackliston.taskmanager.*
+com.zainabed.spring.*
+com.zamna.*
+com.zamplia.*
+com.zanclus.*
+com.zanclus.codepalousa.*
+com.zanclus.vertx.*
+com.zandero.*
+com.zandero.ffpojo.*
+com.zaneli.*
+com.zanox.lib.rabbiteasy.*
+com.zanox.vertx.*
+com.zanox.vertx.mods.*
+com.zapic.sdk.android.*
+com.zappos.*
+com.zara4.api.*
+com.zaradai.*
+com.zarbosoft.*
+com.zarbosoft.rendaw.*
+com.zarinpal.*
+com.zaubersoftware.*
+com.zaubersoftware.commons.*
+com.zaubersoftware.commons.auth.*
+com.zaubersoftware.commons.image.*
+com.zaubersoftware.commons.message.*
+com.zaubersoftware.commons.persistence.*
+com.zaubersoftware.commons.repository.*
+com.zaubersoftware.commons.repository.impl.*
+com.zaubersoftware.commons.web.*
+com.zaubersoftware.gnip4j.*
+com.zaubersoftware.gnip4j.documentation.*
+com.zaubersoftware.gnip4j.mule.*
+com.zaubersoftware.leviathan.*
+com.zaubersoftware.maven.poms.*
+com.zaubersoftware.maven.skins.*
+com.zaubersoftware.taglibs.*
+com.zavakid.*
+com.zavakid.citrus.tool.*
+com.zavakid.commons.*
+com.zavakid.dependency.*
+com.zavakid.lean101.*
+com.zavakid.sessionstore.*
+com.zavtech.*
+com.zaxxer.*
+com.zayviusdigital.*
+com.zayviusdigital.artificialintelligence.*
+com.zbiljic.*
+com.zbj.zop.*
+com.zblservices.bigbluebank.*
+com.zblservices.doctorbatch.*
+com.zclibre.*
+com.zdawn.*
+com.zebrunner.*
+com.zegreatrob.jsmints.*
+com.zegreatrob.jsmints.plugins.jspackage.*
+com.zegreatrob.jsmints.plugins.minreact.*
+com.zegreatrob.jsmints.plugins.ncu.*
+com.zegreatrob.jsmints.plugins.wdiotest.*
+com.zegreatrob.jsmints.plugins.wrapper.*
+com.zegreatrob.plugins.jspackage.*
+com.zegreatrob.testmints.*
+com.zegreatrob.testmints.action-mint.*
+com.zegreatrob.testmints.logs.mint-logs.*
+com.zegreatrob.tools.*
+com.zegreatrob.tools.digger.*
+com.zegreatrob.tools.tagger.*
+com.zekdot.*
+com.zello.*
+com.zendeka.*
+com.zendesk.*
+com.zendesk.belvedere2.*
+com.zendesk.jazon.*
+com.zendesk.suas.*
+com.zendrive.sdk.android.*
+com.zenecture.*
+com.zengtengpeng.*
+com.zengularity.*
+com.zenika.*
+com.zenika.wicket.contrib.*
+com.zenjava.*
+com.zenjava.zen-resources.*
+com.zenklub.freudds.*
+com.zenlayer.*
+com.zenofx.maven.*
+com.zensols.*
+com.zensols.gui.*
+com.zensols.jrtf.*
+com.zensols.nlp.*
+com.zensols.sys.*
+com.zenuevo.pusher.*
+com.zenuevo.simkit.*
+com.zenvia.*
+com.zenvia.komposer.*
+com.zeoflow.*
+com.zeoflow.depot.*
+com.zeoflow.flowly.*
+com.zeoflow.material.elements.*
+com.zeoflow.memo.*
+com.zeoflow.startup.*
+com.zeotap.*
+com.zepben.*
+com.zepben.ci.*
+com.zepben.evolve.*
+com.zepben.ewb.*
+com.zepben.load.*
+com.zepben.logging.*
+com.zepben.maven.*
+com.zepben.protobuf.*
+com.zepben.weather.*
+com.zerobounce.*
+com.zerobounce.android.*
+com.zerobounce.in.android.*
+com.zerobounce.in.java.*
+com.zerobounce.java.*
+com.zeroc.*
+com.zerocracy.*
+com.zerodeplibs.*
+com.zerodhatech.kiteconnect.*
+com.zerofinance.*
+com.zeropush.*
+com.zerostech.*
+com.zerotoheroes.*
+com.zeugmasolutions.localehelper.*
+com.zftlive.android.library.*
+com.zhangaochong.*
+com.zhangxiuquan.*
+com.zhangzhuorui.framework.*
+com.zhangzlyuyx.*
+com.zhaofujun.automapper.*
+com.zhaofujun.nest.*
+com.zhaofutao.*
+com.zhaoxiaodan.flink.*
+com.zhaoyanblog.*
+com.zhazhapan.*
+com.zhengoole.galas.boot.*
+com.zhenzikj.*
+com.zhg2yqq.*
+com.zhibaocloud.*
+com.zhijl.common.*
+com.zhiplusyun.*
+com.zhituanbox.*
+com.zhituanbox.web.*
+com.zhixiangli.*
+com.zhizus.*
+com.zhizus.forest.thrift.*
+com.zhjl37.countdowntask.*
+com.zhjl37.dome.*
+com.zhjl37.gaugeview.*
+com.zhjl37.permission.*
+com.zhokhov.graphql.*
+com.zhongjiadata.tools.*
+com.zhonglunnet.*
+com.zhoujin7.*
+com.zhoukaifan.*
+com.zhoutao123.rpc.*
+com.zhouzhipeng.*
+com.zhouzifei.*
+com.zhoyq.*
+com.zhranklin.*
+com.zhu8fei.easy-test.*
+com.zhuanglide.*
+com.zhuozhengsoft.*
+com.zhusx.*
+com.zhuziplay.*
+com.zhyea.ar4j.core.*
+com.zhyea.ar4j.ext.*
+com.zhzc0x.bluetooth.*
+com.zhzc0x.cxhttp.*
+com.zicenter.*
+com.zigarn.kafka.connect.*
+com.ziggeo.*
+com.zigurs.karlis.utils.*
+com.zigurs.karlis.utils.search.*
+com.zilliqa.*
+com.zimesfield.*
+com.zimesfield.arkiva.*
+com.zimmem.*
+com.zimory.jpaunit.*
+com.zimory.ldapunit.*
+com.zimug.*
+com.zipfworks.*
+com.zippoy.*
+com.zipwhip.*
+com.ziqni.*
+com.zitlab.palmyra.*
+com.zivver.*
+com.zj0724.*
+com.zjiecode.*
+com.zkejid.constructor.*
+com.zkteco.*
+com.zleth.poi.*
+com.zliio.disposable.*
+com.zmannotes.*
+com.zmannotes.event.*
+com.zmannotes.stream.*
+com.zmarkan.*
+com.zmops.*
+com.zoepepper.*
+com.zoeyun.*
+com.zoho.*
+com.zoho.catalyst.*
+com.zoho.crm.*
+com.zoloz.android.build.*
+com.zoloz.api.sdk.*
+com.zonzonzon.*
+com.zoominfo.*
+com.zoomlion.*
+com.zoomulus.*
+com.zooxoos.*
+com.zopa.*
+com.zp4rker.*
+com.zsmartsystems.*
+com.zsmartsystems.zigbee.*
+com.zsoltfabok.*
+com.zsoltsafrany.*
+com.ztianzeng.apidoc.*
+com.zto.fire.*
+com.zuhlke.testing.*
+com.zulily.dropship.*
+com.zuora.sdk.*
+com.zuoxiaolong.*
+com.zusmart.*
+com.zuunr.*
+com.zuunr.restbed.*
+com.zuunr.util.*
+com.zvoykish.*
+com.zwendo.*
+com.zwenkai.*
+com.zwitserloot.*
+com.zx5435.*
+com.zxk175.*
+com.zxyinfo.*
+com.zxytech.jurest.*
+com.zxytech.ngast.*
+com.zybnet.*
+com.zycoo.*
+com.zyeeda.*
+com.zykalb.*
+com.zyplayer.*
+com.zzmoon.base.*
+commons-attributes.*
+commons-beanutils.*
+commons-betwixt.*
+commons-chain.*
+commons-cli.*
+commons-codec.*
+commons-collections.*
+commons-compress.*
+commons-configuration.*
+commons-daemon.*
+commons-dbcp.*
+commons-dbutils.*
+commons-digester.*
+commons-discovery.*
+commons-el.*
+commons-email.*
+commons-fileupload.*
+commons-grant.*
+commons-graph.*
+commons-http.*
+commons-httpclient.*
+commons-i18n.*
+commons-io.*
+commons-jelly.*
+commons-jexl.*
+commons-jux.*
+commons-jxpath.*
+commons-lang.*
+commons-latka.*
+commons-launcher.*
+commons-logging.*
+commons-math.*
+commons-messenger.*
+commons-modeler.*
+commons-naming.*
+commons-net.*
+commons-pool.*
+commons-primitives.*
+commons-resources.*
+commons-scxml.*
+commons-sql.*
+commons-test.*
+commons-threadpool.*
+commons-transaction.*
+commons-util.*
+commons-validator.*
+commons-vfs.*
+commons-xo.*
+community.flock.kotlinx.openapi.bindings.*
+community.likeminds.*
+community.solace.spring.cloud.*
+community.solace.spring.integration.*
+company.hnlz.*
+company.jap.*
+company.tap.*
+computer.hollis.*
+concurrent.*
+consulting.freiheitsgrade.patched.*
+consulting.inspired.*
+consulting.omnia.util.*
+consulting.pigott.wordpress.*
+continuum.*
+controlhaus.*
+cool.arch.infrastructure.*
+cool.arch.monadicexceptions.*
+cool.arch.patterns.*
+cool.arch.stateroom.*
+cool.cena.*
+cool.doudou.*
+cool.graph.*
+cool.happycoding.*
+cool.houge.pangu.*
+cool.lazy-cat.*
+cool.linco.common.*
+cool.mqtt.*
+cool.mtc.*
+cool.munsal.*
+cool.pandora.*
+cool.scx.*
+cool.solr.*
+cool.taomu.*
+cool.taomu.framework.*
+cool.taomu.software.fig.*
+cool.ty666.suite.*
+cool.william.frontend.*
+cool.zhouxin.*
+coop.intergal.*
+coop.plausible.nx.*
+coop.rchain.*
+cornerstone-connection.*
+cornerstone-datasources.*
+cornerstone-scheduler.*
+cornerstone-sockets.*
+cornerstone-store.*
+cornerstone-threads.*
+cos.*
+crimson.*
+cryptix.*
+cssparser.*
+cv.igrp.*
+cx.by.*
+cx.cad.keepachangelog.*
+cx.d1.*
+cz.abclinuxu.datoveschranky.*
+cz.active24.client.fred.*
+cz.advel.jbullet.*
+cz.afri.*
+cz.alry.*
+cz.alry.jcommander.*
+cz.applifting.*
+cz.auderis.*
+cz.augi.*
+cz.augi.gradle.wartremover.*
+cz.cdv.datex2.*
+cz.cesnet.cloud.*
+cz.cuni.mff.d3s.spl.*
+cz.cuni.mff.ufal.udpipe.*
+cz.cvut.fel.still.*
+cz.cvut.fit.jcop.*
+cz.cvut.fit.maven.*
+cz.cvut.kbss.jopa.*
+cz.cvut.kbss.jsonld.*
+cz.d1x.*
+cz.datadriven.utils.*
+cz.datalite.*
+cz.datalite.dlAresService.*
+cz.datalite.zk-dl.*
+cz.diribet.*
+cz.ecodef.*
+cz.encircled.*
+cz.etnetera.*
+cz.geek.*
+cz.gopay.*
+cz.greencode.*
+cz.greencode.phraseapp.*
+cz.habarta.typescript-generator.*
+cz.i24.*
+cz.i24.util.*
+cz.idealiste.*
+cz.jacktech.dbr.*
+cz.jcode.auto.value.*
+cz.jiripinkas.*
+cz.jirutka.maven.*
+cz.jirutka.rsql.*
+cz.jirutka.spring.*
+cz.jirutka.unidecode.*
+cz.jirutka.validator.*
+cz.jkozlovsky.*
+cz.kahle.maven.*
+cz.kinst.jakub.*
+cz.kinst.jakub.androidbase.*
+cz.krystofcejchan.*
+cz.mallat.uasparser.*
+cz.martlin.*
+cz.masci.commons.*
+cz.masci.pg.releaser.*
+cz.mmsparams.*
+cz.msebera.android.*
+cz.multiplatform.escpos4k.*
+cz.muni.*
+cz.muni.fi.mathml.*
+cz.muni.fi.mir.*
+cz.net21.flyway.ant.*
+cz.net21.ttulka.*
+cz.net21.ttulka.exec.*
+cz.net21.ttulka.io.*
+cz.net21.ttulka.recexp.*
+cz.net21.ttulka.thistledb.*
+cz.o2.proxima.*
+cz.o2.proxima.beam.*
+cz.polankam.security.acl.*
+cz.pumpitup.driver8.*
+cz.pumpitup.pn5.*
+cz.pumpitup.pn5.integrations.*
+cz.pumpitup.pn5.reporting.*
+cz.quanti.mailq.*
+cz.req.vax.*
+cz.sazel.sqldelight.*
+cz.scholz.*
+cz.seznam.euphoria.*
+cz.smarteon.*
+cz.softeu.*
+cz.softwarebuilders.*
+cz.srayayay.*
+cz.tvrzna.*
+cz.vutbr.fit.layout.*
+cz.wicketstuff.boss.*
+cz.wicketstuff.jgreen.*
+cz.xtf.*
+cz.zakjan.*
+d-haven-event.*
+d-haven-eventbus.*
+d-haven-mpool.*
+dalma.*
+dalms.*
+damagecontrol.*
+datasift.*
+date.iterator.automaton.*
+date.iterator.count.*
+date.iterator.tools.*
+date.yetao.maven.*
+dbunit.*
+de.0xab.*
+de.125m125.kt.*
+de.7fate.*
+de.a9d3.testing.*
+de.aaschmid.*
+de.aaschmid.gradle.plugins.*
+de.abda.*
+de.abelssoft.*
+de.acosix.alfresco.audit.*
+de.acosix.alfresco.keycloak.*
+de.acosix.alfresco.maven.*
+de.acosix.alfresco.mtsupport.*
+de.acosix.alfresco.rest.client.*
+de.acosix.alfresco.simplecontentstores-42.*
+de.acosix.alfresco.simplecontentstores-50.*
+de.acosix.alfresco.simplecontentstores.*
+de.acosix.alfresco.site.hierarchy.*
+de.acosix.alfresco.transform.*
+de.acosix.alfresco.utility.*
+de.acosix.alfresco.utility42.*
+de.acosix.docker.*
+de.acosix.maven.*
+de.active-group.*
+de.actonic.*
+de.adito.*
+de.adito.aditoweb.*
+de.adito.beans.*
+de.adito.maven.*
+de.adito.picoservice.*
+de.adito.plugin.*
+de.adito.propertly.*
+de.adito.util.*
+de.adorsys.*
+de.adorsys.amp.*
+de.adorsys.aspsp.*
+de.adorsys.bg.monitoring.*
+de.adorsys.cryptoutils.*
+de.adorsys.envutils.*
+de.adorsys.jmspojo.*
+de.adorsys.keycloak.*
+de.adorsys.keymanagement.*
+de.adorsys.ledgers.*
+de.adorsys.lock-persistence.*
+de.adorsys.morphia-encryption.*
+de.adorsys.multibanking.*
+de.adorsys.multibanking.docusafe.*
+de.adorsys.oauth.*
+de.adorsys.oauth2-pkce.*
+de.adorsys.opba.*
+de.adorsys.psd2.*
+de.adorsys.psd2.sandbox.*
+de.adorsys.pushit.*
+de.adorsys.smartanalytics.*
+de.adorsys.sts.*
+de.adorsys.tanserver.*
+de.adorsys.xs2a.adapter.*
+de.adorsys.xs2a.gateway.*
+de.adrianlange.*
+de.adrodoc55.mpl.*
+de.agentlab.*
+de.ageworks.*
+de.agiehl.bgg.*
+de.agilecoders.elasticsearch.logger.*
+de.agilecoders.logger.*
+de.agilecoders.maven.*
+de.agilecoders.webjars.*
+de.agilecoders.wicket.*
+de.agilecoders.wicket.mustache.*
+de.agilecoders.wicket.requirejs.*
+de.agilecoders.wicket.webjars.*
+de.ahus1.keycloak.dropwizard.*
+de.ahus1.prometheus.hystrix.*
+de.aipark.android.sdk.*
+de.aipark.api.*
+de.akii.commercetools.*
+de.akii.commercetools.api.customtypes.*
+de.akquinet.android.androlog.*
+de.akquinet.android.archetypes.*
+de.akquinet.android.marvin.*
+de.akquinet.android.rindirect.*
+de.akquinet.android.roboject.*
+de.akquinet.chameria.*
+de.akquinet.commons.imageio.*
+de.akquinet.gomobile.android.rindirect.*
+de.akquinet.innovation.play2.*
+de.akquinet.javascript.archetypes.*
+de.akquinet.jbosscc.*
+de.akquinet.jbosscc.guttenbase.*
+de.akquinet.jbosscc.latex.*
+de.akquinet.jquery.plugins.*
+de.aktey.akka.k8s.*
+de.aktey.akka.visualmailbox.*
+de.aktey.scanndal.*
+de.albionco.*
+de.alexanderwodarz.code.*
+de.aliceice.*
+de.aliceice.paper.*
+de.almostintelligent.*
+de.alpharogroup.*
+de.alsclo.*
+de.alx-development.*
+de.alxgrk.*
+de.ameto.*
+de.andreasgerhard.*
+de.andrena.tools.macker.*
+de.andrena.tools.nopackagecycles.*
+de.androbit.*
+de.androidpit.*
+de.aosd.clazzfish.*
+de.apaxo.test.*
+de.appelgriepsch.logback.*
+de.arbeitsagentur.opdt.*
+de.articdive.*
+de.aservo.*
+de.aservo.atlassian.*
+de.asideas.crowdsource.*
+de.assertagile.spockframework.extensions.*
+de.atb-bremen.*
+de.atextor.*
+de.athalis.coreasm.*
+de.athalis.protege.*
+de.audioattack.io.*
+de.audioattack.util.*
+de.audiophobe.*
+de.averbis.textanalysis.*
+de.awagen.kolibri.*
+de.b-studios.*
+de.baerinteractive.*
+de.barop.gwt.*
+de.bausdorf.simracing.*
+de.bechte.junit.*
+de.benediktmeurer.eui4j.*
+de.benediktmeurer.gwt-slf4j.*
+de.berlios.jsunit.*
+de.bessonov.*
+de.besting-it.*
+de.beyondjava.*
+de.beyondjava.angularFaces.*
+de.bigmichi1.*
+de.bild.backend.*
+de.bildschirmarbeiter.*
+de.bildschirmarbeiter.aem.*
+de.bildschirmarbeiter.aem.packages.*
+de.bildschirmarbeiter.aem.toolbox.*
+de.bildschirmarbeiter.application.*
+de.bildschirmarbeiter.asf.*
+de.bildschirmarbeiter.asf.toolbox.*
+de.bildschirmarbeiter.jbake.*
+de.binfalse.*
+de.bioforscher.singa.*
+de.biomedical-imaging.TraJ.*
+de.biomedical-imaging.edu.wlu.cs.levy.cg.*
+de.biomedical-imaging.ij.*
+de.biovoxxel.*
+de.bitgrip.archetypes.*
+de.bitgrip.ficum.*
+de.bitmarck.bms.*
+de.bixilon.*
+de.bixilon.javafx.*
+de.bluebiz.*
+de.bluebiz.bluelytics.*
+de.blueelk.*
+de.blume2000.boot.*
+de.bmarwell.*
+de.bmiag.tapir.*
+de.boehrsi.*
+de.boreddevblog.*
+de.borisskert.*
+de.borntohula.dropwizard.*
+de.bottlecaps.rr.*
+de.br.android.*
+de.braintags.*
+de.brands4friends.daleq.*
+de.breakpointsec.*
+de.brendamour.*
+de.breuco.*
+de.bright-side.bdbexport.*
+de.bright-side.beam.*
+de.bright-side.brightmarkdown.*
+de.bright-side.filesystemfacade.*
+de.bright-side.lgf.*
+de.bripkens.*
+de.brudaswen.kotlinx.coroutines.*
+de.brudaswen.kotlinx.serialization.*
+de.bund.bva.isyfact.*
+de.bund.bva.isyfact.benutzerverwaltung.*
+de.bwaldvogel.*
+de.bytefish.*
+de.bytefish.elasticutils.*
+de.bytefish.fcmjava.*
+de.bytefish.pgbulkinsert.*
+de.c-otto.*
+de.c-otto.java-conventions.*
+de.c1710.*
+de.cadoculus.javafx.*
+de.cakedown.*
+de.caluga.*
+de.caluga.morphium.*
+de.cap3.*
+de.captaingoldfish.*
+de.carne.*
+de.carne.common.*
+de.cau.cs.kieler.*
+de.cau.cs.kieler.klighd.*
+de.cau.cs.kieler.swt.mock.*
+de.cau.cs.se.*
+de.cau.cs.se.teetime.*
+de.centerdevice.*
+de.ceow.*
+de.cgoit.gradle.elasticsearch.*
+de.cgrotz.*
+de.chandre.admin-tools.*
+de.chandre.quartz.*
+de.chandre.velocity2.*
+de.charite.compbio.*
+de.charlex.billing.*
+de.charlex.compose.*
+de.charlex.settings.*
+de.chiflux.*
+de.chkal.backset.*
+de.chkal.maven.*
+de.chkal.mvc-toolbox.*
+de.chkal.prometheus.tomcat.*
+de.choffmeister.*
+de.chojo.sadu.*
+de.chrgroth.generic-typesystem.*
+de.chrgroth.json-store.*
+de.chrgroth.smartcron.*
+de.christianvogt.*
+de.christofreichardt.*
+de.christophkraemer.*
+de.chrlembeck.*
+de.cidaas.*
+de.cimt.talendcomp.*
+de.cinovo.*
+de.cinovo.cloudconductor.*
+de.cit-ec.ml.*
+de.cit-ec.scie.*
+de.cit-ec.tcs.*
+de.cit-ec.tcs.alignment.*
+de.ck35.maven.plugins.*
+de.ck35.metriccache.*
+de.ck35.metricstore.*
+de.ck35.monitoring.*
+de.cketti.fileprovider.*
+de.cketti.library.changelog.*
+de.cketti.mailto.*
+de.cketti.safecontentresolver.*
+de.cketti.share.*
+de.cketti.unicode.*
+de.clashsoft.*
+de.clemenskeppler.*
+de.clued-up.*
+de.clued-up.voicecontrols.*
+de.clusterfreak.*
+de.cmuche.*
+de.code-sourcery.maven.buildprofiler.*
+de.code-sourcery.versiontracker.*
+de.codeboje.*
+de.codecamp.messages.*
+de.codecamp.tracer.*
+de.codecamp.vaadin.*
+de.codecentric.*
+de.codecentric.ccunit.*
+de.codecentric.centerdevice.*
+de.codecentric.hikaku.*
+de.codecentric.mule.modules.*
+de.codecentric.reedelk.*
+de.codecentric.zucchini.*
+de.codelix.*
+de.codelix.commandapi.*
+de.codemakers.netbox.*
+de.codengine.*
+de.codepfleger.*
+de.codereddev.*
+de.codereddev.wordup.*
+de.coderspack.*
+de.codescape.bitvunit.*
+de.codeshelf.consoleui.*
+de.cologneintelligence.*
+de.comahe.i18n4k.*
+de.comhix.commons.*
+de.comhix.ktor-annotated-routing.*
+de.comhix.twitch.*
+de.commonlisp.*
+de.comroid.*
+de.confinitum.*
+de.congrace.*
+de.contentpass.*
+de.cooperate-project.*
+de.cooperate-project.maven.*
+de.cooperr.*
+de.copepod.*
+de.corruptedbytes.*
+de.cpg.oss.*
+de.cpg.oss.verita.*
+de.creativecouple.validation.*
+de.cronn.*
+de.cronn.jsxtransformer.*
+de.crowdcode.kissmda.*
+de.crowdcode.kissmda.app-examples.*
+de.crowdcode.kissmda.cartridges.*
+de.crowdcode.kissmda.core.*
+de.crowdcode.kissmda.maven.*
+de.crowdcode.kissmda.profiles.*
+de.cs-dev.ebus.*
+de.csgis.commons.*
+de.cubeisland.*
+de.cubeisland.engine.*
+de.cubeisland.maven.archetypes.*
+de.cubeisland.maven.plugins.*
+de.cubeisland.spoon.*
+de.cuioss.*
+de.cuioss.test.*
+de.customed.*
+de.cwkr.*
+de.cwkr.validation.*
+de.cyclon-softworx.*
+de.d-coding.*
+de.dagere.*
+de.dagere.kieker.*
+de.dagere.kopeme.*
+de.dagere.peass.*
+de.dailab.*
+de.dandit.*
+de.dani09.*
+de.danielbechler.*
+de.danielnaber.*
+de.darkatra.*
+de.darmstadt.tu.crossing.*
+de.dasphiller.extensions.*
+de.datasecs.*
+de.datexis.*
+de.davelee.*
+de.davelee.personalman.*
+de.davelee.trams.*
+de.davherrmann.immutable.*
+de.davidbilge.spring.*
+de.dbck.poc.*
+de.dbck.poc.multimod.*
+de.debuglevel.omnitracker-databasebinding.*
+de.deepamehta.*
+de.deepamehta.assemblies.*
+de.deepamehta.assemblies.features.*
+de.deepamehta.assemblies.server.*
+de.defmacro.*
+de.dehn.*
+de.dehn.logging.*
+de.deltaeight.*
+de.deltatree.pub.apis.*
+de.deltatree.tools.*
+de.dentrassi.asyncapi.*
+de.dentrassi.build.*
+de.dentrassi.camel.*
+de.dentrassi.camel.iec60870.*
+de.dentrassi.camel.milo.*
+de.dentrassi.crypto.*
+de.dentrassi.eclipse.neoscada.base.*
+de.dentrassi.eclipse.neoscada.chart.*
+de.dentrassi.eclipse.neoscada.core.*
+de.dentrassi.eclipse.neoscada.hmi.*
+de.dentrassi.eclipse.neoscada.ide.*
+de.dentrassi.eclipse.neoscada.protocols.*
+de.dentrassi.eclipse.neoscada.utils.*
+de.dentrassi.elasticsearch.*
+de.dentrassi.flow.*
+de.dentrassi.flow.p2.*
+de.dentrassi.iot.*
+de.dentrassi.kapua.*
+de.dentrassi.kapua.examples.*
+de.dentrassi.kura.*
+de.dentrassi.kura.addons.*
+de.dentrassi.kura.addons.drools.examples.*
+de.dentrassi.kura.addons.repackage.*
+de.dentrassi.kura.amqp.*
+de.dentrassi.maven.*
+de.dentrassi.osgi.*
+de.dentrassi.varlink.*
+de.dentrassi.varlink.bindings.*
+de.dentrassi.varlink.idl.*
+de.derivo.graph-app.*
+de.derivo.graph-app.dummy.*
+de.destrukt.*
+de.dev-eth0.*
+de.dev-eth0.dummycreator.*
+de.dev-eth0.spring-boot.httpclient.*
+de.devbliss.apitester.*
+de.devbliss.paulparser.*
+de.devhq.*
+de.devland.esperandro.*
+de.devland.recruiting.*
+de.devmob.android.apprater.*
+de.devmob.android.customfont.*
+de.devmob.android.logger.*
+de.devoxx4kids.*
+de.devpeak.ultra.*
+de.devsurf.components.*
+de.devsurf.components.converter.*
+de.devsurf.injection.guice.*
+de.devsurf.injection.guice.aop.*
+de.devsurf.injection.guice.integrations.*
+de.devsurf.injection.guice.scanner.*
+de.devsurf.maven.*
+de.devsurf.tools.*
+de.dfki.cos.basys.*
+de.dfki.cos.basys.aas.*
+de.dfki.cos.basys.aas.registry.*
+de.dfki.cos.basys.common.*
+de.dfki.cos.basys.common.karaf.*
+de.dfki.cos.basys.controlcomponent.*
+de.dfki.cos.basys.platform.*
+de.dfki.cos.basys.platform.karaf.*
+de.dfki.cos.basys.platform.karaf.features.*
+de.dfki.cos.basys.platform.model.*
+de.dfki.cos.basys.platform.osgi.*
+de.dfki.cos.basys.platform.runtime.*
+de.dfki.cos.basys.platform.wrapper-bundle-settings.*
+de.dfki.cos.basys.pom.*
+de.dfki.mary.*
+de.digitalcollections.*
+de.digitalcollections.commons.*
+de.digitalcollections.core.*
+de.digitalcollections.cudami.*
+de.digitalcollections.flusswerk.*
+de.digitalcollections.iiif.*
+de.digitalcollections.imageio.*
+de.digitalcollections.lobid.*
+de.digitalcollections.model.*
+de.digitalcollections.search.*
+de.digitalcollections.workflow.*
+de.digitalfrontiers.*
+de.dimaki.*
+de.dimensionv.*
+de.dkiefner.*
+de.dlr.gitlab.fame.*
+de.dlr.gsoc.mcds.*
+de.dm.auth.*
+de.dm.infrastructure.*
+de.dm.mail2blog.*
+de.dm.retrylib.*
+de.dnb.*
+de.docutain.*
+de.domjos.customwidgets.*
+de.douglas.maven.plugin.*
+de.dplatz.*
+de.dplatz.padersprinter.*
+de.dr1fter.*
+de.drbunsen.common.*
+de.dreambeam.*
+de.drippinger.fakegen.*
+de.drippinger.gatling.*
+de.drni.bananasplit.*
+de.duesenklipper.maven.*
+de.dutches.roomex.*
+de.dynamicfiles.projects.gradle.plugins.*
+de.dynamicfiles.projects.minecraft.*
+de.dynamicfiles.projects.testing.*
+de.eacg.*
+de.ebf.*
+de.ecclesia.kipeto.*
+de.edgesoft.*
+de.ehex.foss.*
+de.eismaenners.*
+de.eldoria.jacksonbukkit.*
+de.eldoria.util.*
+de.electronicpeter.*
+de.element34.*
+de.eleon.*
+de.elnarion.asciidoc.*
+de.elnarion.jndi.*
+de.elnarion.maven.*
+de.elnarion.util.*
+de.elomagic.*
+de.empulse.eclipselink.*
+de.endrullis.draggabletabs.*
+de.energiequant.common.*
+de.enerko.*
+de.enerko.commons.*
+de.enlightened.*
+de.entera.*
+de.enterprise-starters.*
+de.entrecode.*
+de.envisia.*
+de.envisia.ipp.*
+de.envisia.reactivestreams.*
+de.eonas.portal.*
+de.eonas.portal.demo.*
+de.eonas.portal.demo.portlets.*
+de.eonas.portal.parentpoms.*
+de.eosts.*
+de.eps-dev.*
+de.erdlet.*
+de.erdlet.archetypes.*
+de.erdlet.jcrud.*
+de.erichseifert.gral.*
+de.erichseifert.vectorgraphics2d.*
+de.escalon.hypermedia.*
+de.escalon.jaxb2.*
+de.esoco.*
+de.evosec.*
+de.ewmksoft.*
+de.exalta.*
+de.extra-standard.*
+de.extra-standard.procedures.*
+de.exxcellent.*
+de.fabmax.*
+de.fabmax.kool.*
+de.fau.cs.osr.*
+de.fau.cs.osr.hddiff.*
+de.fau.cs.osr.maven.plugins.*
+de.fau.cs.osr.ptk.*
+de.fau.cs.osr.utils.*
+de.fegbers.*
+de.fegbers.spring.*
+de.feldm.*
+de.felixschulze.*
+de.felixschulze.android.test.*
+de.felixschulze.gradle.*
+de.felixschulze.maven.plugins.xcode.*
+de.felixschulze.teamcity.*
+de.felixsfd.*
+de.femtopedia.studip.*
+de.fenvariel.*
+de.ferderer.*
+de.fhg.aisec.ids.*
+de.fhg.fokus.nubomedia.*
+de.fhg.igd.*
+de.firemage.autograder.*
+de.fjobilabs.botometer.*
+de.flapdoodle.*
+de.flapdoodle.embed.*
+de.flapdoodle.embedmongo.*
+de.flapdoodle.graph.*
+de.flapdoodle.guava.*
+de.flapdoodle.java8.*
+de.flapdoodle.measure.*
+de.flapdoodle.mongoom.*
+de.flapdoodle.pattern.*
+de.flapdoodle.reverse.*
+de.flapdoodle.testdoc.*
+de.flapdoodle.transition.*
+de.flapdoodle.wicket.*
+de.flapdoodle.wicket6.*
+de.flapdoodle.wicket7-java8.*
+de.flapdoodle.wicket7.*
+de.flashheart.*
+de.flashpixx.*
+de.flexguse.util.junit.*
+de.florian-moehle.*
+de.floydkretschmar.*
+de.fluxparticle.*
+de.fmaul.*
+de.fmui.osb.broker.*
+de.focus-shift.*
+de.focus-shift.lexoffice.*
+de.focus-shift.urlaubsverwaltung.extension.api.*
+de.foellix.*
+de.foryasee.*
+de.fosd.typechef.*
+de.frachtwerk.*
+de.fraunhofer.aisec.*
+de.fraunhofer.aisec.ids.*
+de.fraunhofer.iem.*
+de.fraunhofer.iese.ind2uce.*
+de.fraunhofer.iosb.ilt.*
+de.fraunhofer.iosb.ilt.FROST-Server.*
+de.fraunhofer.iosb.ilt.faaast.*
+de.fraunhofer.iosb.ilt.faaast.service.*
+de.fraunhofer.iosb.io.moquette.*
+de.fraunhofer.sit.sse.flowdroid.*
+de.fraunhofer.sit.sse.vusc.*
+de.frontsy.*
+de.frozenice.*
+de.fruiture.cor.*
+de.fspengler.hudson.plugin.*
+de.fspengler.hudson.pview.*
+de.fu-berlin.mi.hcc.questionnaires.*
+de.fuberlin.wiwiss.silk.*
+de.fumix.*
+de.funfried.libraries.*
+de.funfried.netbeans.plugins.*
+de.fx-world.*
+de.fxlae.*
+de.fxnn.*
+de.g3s1.oss.cron.*
+de.gal-digital.*
+de.galan.*
+de.galan.packtag.*
+de.galimov.*
+de.garrus.maven.*
+de.gbv.reposis.*
+de.gccc.play.*
+de.gccc.sbt.*
+de.gcoding.*
+de.gdata.*
+de.geekonaut.*
+de.gematik.*
+de.gematik.api.*
+de.gematik.epa.*
+de.gematik.idp.*
+de.gematik.idp.aforeporter.*
+de.gematik.pki.*
+de.gematik.pki.gemlibpki.*
+de.gematik.refv.*
+de.gematik.refv.commons.*
+de.gematik.refv.valmodule.*
+de.gematik.test.*
+de.gematik.test.tiger.*
+de.gematik.ti.*
+de.gematik.ti.epa.*
+de.gematik.ti.epa.android.*
+de.generia.tools.apitools.generator.*
+de.generia.tools.model.api.*
+de.geolykt.starloader.*
+de.gerdi-project.*
+de.gerdi-project.store.*
+de.gesellix.*
+de.gessnerfl.logback.*
+de.gesundkrank.fzf4j.*
+de.gesundkrank.jskills.*
+de.gmuth.*
+de.goddchen.android.*
+de.gofabian.*
+de.gofabian.jmigrate.*
+de.golfgl.gdxcontrollerutils.*
+de.golfgl.gdxgameanalytics.*
+de.golfgl.gdxgamesvcs.*
+de.golfgl.gdxpushmessages.*
+de.grammarcraft.*
+de.graphml.writer.*
+de.graulichs.*
+de.greenrobot.*
+de.griefed.*
+de.griefed.serverpackcreator.*
+de.grobmeier.*
+de.grobmeier.json.*
+de.grundid.*
+de.grundid.opendatalab.*
+de.grundid.osmtools.*
+de.gsi.*
+de.gsi.acc.*
+de.gsi.chart.*
+de.gsi.dataset.*
+de.gsi.generate.*
+de.gsi.math.*
+de.gsi.report.*
+de.guerda.colormatcher.*
+de.gurkenlabs.*
+de.gwdg.metadataqa.*
+de.h2b.java.lib.*
+de.h2b.java.lib.pa-toolbox.*
+de.h2b.scala.lib.*
+de.h2b.scala.lib.math.*
+de.h2b.scala.lib.pa-toolbox.*
+de.h2b.scala.lib.phys.*
+de.halcony.*
+de.halfbit.*
+de.hamburger-software.util.*
+de.hammwerk.*
+de.hamstersimulator.objectsfirst.*
+de.hanbei.*
+de.hannesstruss.*
+de.hannesstruss.cheesewire.*
+de.hannesstruss.conductor-dialogs.*
+de.hannesstruss.conductor-resources.*
+de.hannesstruss.rxcache.*
+de.hannesstruss.schmutils.*
+de.hannesstruss.unearthed.*
+de.hannesstruss.windfish.*
+de.hansche.*
+de.hasait.*
+de.hasait.cipa.*
+de.hasait.genesis.*
+de.hasait.majala.*
+de.hasait.sprinkler.*
+de.hasait.tanks.*
+de.hashcode.*
+de.hatoka.neuralnetwork.*
+de.haumacher.*
+de.haumacher.msgbuf.*
+de.hbt.propertyname.*
+de.hdi.*
+de.hdi.cfenv.*
+de.hdodenhof.*
+de.hegmanns.*
+de.heikoseeberger.*
+de.helmbold.*
+de.helwich.junit.*
+de.hendrik-janssen.*
+de.hepisec.taglib.cms.*
+de.hepisec.validation.*
+de.herberlin.translate.*
+de.hexaoxi.*
+de.hglabor.*
+de.hglabor.utils.*
+de.hhu.stups.*
+de.hiiw.oath.*
+de.hilling.graylog.*
+de.hilling.junit.cdi.*
+de.hilling.lang.annotations.*
+de.hilling.lang.metamodel.*
+de.hilling.maven.release.*
+de.hipphampel.*
+de.hipphampel.eval.*
+de.hipphampel.validation.*
+de.hirola.*
+de.holisticon.*
+de.holisticon.annotationprocessortoolkit.*
+de.holisticon.archetypes.*
+de.holisticon.dependencies.*
+de.holisticon.maven.*
+de.holisticon.toolbox.*
+de.holisticon.util.tracee.*
+de.holisticon.util.tracee.backend.*
+de.holisticon.util.tracee.examples.*
+de.holisticon.util.tracee.inbound.*
+de.holisticon.util.tracee.outbound.*
+de.hoomit.projects.*
+de.horstgernhardt.*
+de.hotkeyyy.*
+de.hpi.isg.*
+de.hpi.kddm.*
+de.hs-heilbronn.mi.*
+de.hshannover.f4.trust.*
+de.hu-berlin.german.korpling.annis.*
+de.hu-berlin.wbi.*
+de.hu-berlin.wbi.cuneiform.*
+de.hu-berlin.wbi.hiway.*
+de.hu_berlin.german.korpling.saltnpepper.*
+de.humanfork.asciidoctorj.bootconfig2adoc.*
+de.humanfork.hibernateextension.*
+de.humanfork.junit.statefullextension.*
+de.humanfork.springdatajpaextension.*
+de.humanfork.springwebextension.*
+de.huxhorn.gradle.*
+de.huxhorn.lilith.*
+de.huxhorn.sulky.*
+de.i8k.*
+de.ibapl.fhz4j.*
+de.ibapl.jnhw.*
+de.ibapl.jnhw.syscall.*
+de.ibapl.onewire4j.*
+de.ibapl.spsw.*
+de.icongmbh.oss.maven.plugins.*
+de.id4i.api.*
+de.idealo.kafka.*
+de.idealo.logback.*
+de.idealo.spring.*
+de.idealo.test.*
+de.idealo.whitelabels.*
+de.idos.updates.*
+de.idyl.*
+de.ihrigb.commons.*
+de.ihrigb.fwla.*
+de.iip-ecosphere.platform.*
+de.iip-ecosphere.platform.external.si.matjazcerkvenik.*
+de.iip-ecosphere.platform.external.si.matjazcerkvenik.simplelogger.*
+de.iip-ecosphere.platform.org.eclipse.basyx.*
+de.ikor.sip.foundation.*
+de.imcq.*
+de.incentergy.geometry.*
+de.incentergy.iso11783.part10.*
+de.incentergy.openui5.*
+de.incentergy.test.*
+de.inetsoftware.*
+de.inetsofware.*
+de.informaticum.*
+de.informaticum.xjc.*
+de.ingogriebsch.hateoas.*
+de.ingogriebsch.maven.*
+de.innfactory.*
+de.innus.util.*
+de.inoio.kubeless.*
+de.inoxio.*
+de.intarsys.nativec.*
+de.intarsys.opensource.*
+de.intarsys.runtime.*
+de.intarsys.security.smartcard.io.*
+de.intension.*
+de.invation.code.*
+de.ipb-halle.*
+de.ipk-gatersleben.*
+de.ippen-digital.*
+de.irissmann.*
+de.is24.*
+de.is24.common.*
+de.is24.hystrix.*
+de.is24.maven.enforcer.rules.*
+de.is24.mavenplugins.*
+de.is24.spring.*
+de.is24.util.*
+de.isas.mztab.*
+de.isc-software.maven.*
+de.it-happens.commons.*
+de.it-tw.*
+de.itagile.*
+de.iterable.*
+de.itsvs.*
+de.iwelt.*
+de.ixilon.*
+de.jacks-it-lab.*
+de.jaggl.sqlbuilder.*
+de.jaide.*
+de.jakobjarosch.dropwizard.*
+de.jakobjarosch.rethinkdb.*
+de.jakop.lotus.*
+de.jakop.validation.*
+de.jamba.hudson.plugin.wsclean.*
+de.jangassen.*
+de.jannikarndt.*
+de.japrost.*
+de.japrost.amaot.*
+de.japrost.excerpt.*
+de.japrost.jabudget.*
+de.japrost.staproma.*
+de.jarnbjo.*
+de.jarosz.sparkle.*
+de.java2html.*
+de.javacook.*
+de.javagl.*
+de.javakaffee.*
+de.javakaffee.msm.*
+de.javakaffee.net.vz.play.statsd.*
+de.javatux.*
+de.javatux.jfortune.*
+de.javawi.jstun.*
+de.jball.*
+de.jbellmann.junit.*
+de.jbellmann.maven.plugins.*
+de.jbellmann.rwds.*
+de.jclohmann.*
+de.jcup.asp.*
+de.jcup.eclipse.commons.*
+de.jcup.sarif.java.*
+de.jensd.*
+de.jensklingenberg.*
+de.jensklingenberg.cabret.*
+de.jensklingenberg.kotlinmaterialui.*
+de.jensklingenberg.ktorfit.*
+de.jfachwert.*
+de.jfancy.*
+de.jflex.*
+de.jgoldhammer.*
+de.jiac.micro.*
+de.jiac.micro.extensions.*
+de.jiac.micro.platforms.*
+de.jiac.micro.platforms.cdc.*
+de.jiac.micro.platforms.cldc.*
+de.jiac.micro.platforms.java6.*
+de.jiac.micro.tools.*
+de.jjohannes.*
+de.jkeylockmanager.*
+de.jmens.*
+de.jodamob.android.*
+de.jodamob.gradle.*
+de.jodamob.junit5.*
+de.jodamob.kotlin.*
+de.joerghoh.cq5.healthcheck.*
+de.johoop.*
+de.jollyday.*
+de.jonato.*
+de.joshuagleitze.*
+de.joshuaschnabel.*
+de.jost-net.*
+de.jpdigital.*
+de.jplag.*
+de.jplanets.*
+de.jplanets.junit.*
+de.jplanets.logging.*
+de.jplanets.maven.*
+de.jplanets.utils.fileutils.*
+de.jsone-studios.*
+de.jsyn.*
+de.julielab.*
+de.jungblut.common.*
+de.jungblut.glove.*
+de.jungblut.jrpt.*
+de.jungblut.math.*
+de.jungblut.ml.*
+de.juplo.*
+de.justjanne.*
+de.justjanne.libquassel.*
+de.jutzig.*
+de.jvstvshd.hitmc.*
+de.jvstvshd.velocitypunishment.*
+de.kaffeekrone.*
+de.kah2.zodiac.*
+de.kaleidox.*
+de.kandid.*
+de.katerkamp.szoo.*
+de.kaufhof.*
+de.kaufhof.ets.*
+de.keawe.*
+de.keawe.metrics.*
+de.kevcodez.amazon.*
+de.kevcodez.pubg.*
+de.keyboardsurfer.android.widget.*
+de.kgrupp.*
+de.kherud.*
+de.killaitis.*
+de.kiridevs.*
+de.kleinkop.*
+de.klg.utils.jbarcode.*
+de.klg71.keycloakmigration.*
+de.klosebrothers.*
+de.klosebrothers.hue.*
+de.knightsoft-net.*
+de.knoppiks.*
+de.knutwalker.*
+de.kodestruktor.grief.*
+de.kontext-e.jqassistant.plugin.*
+de.kopis.glacier.*
+de.korne127.circularjsonserialiser.*
+de.kosit.*
+de.kosmos-lab.*
+de.kosmos-lab.platform.*
+de.kotlincook.textmining.*
+de.kriegergilde.*
+de.krsc.jsonpath.*
+de.kune.*
+de.kuriositaet.*
+de.kysy.*
+de.l3s.boilerpipe.*
+de.l3s.icrawl.*
+de.labathome.*
+de.laetsch-it.jobscheduler.*
+de.laeubisoft.*
+de.lampware.*
+de.lampware.racing.*
+de.lancom.systems.defer.*
+de.lancom.systems.stomp.*
+de.larmic.*
+de.larmic.butterfaces.*
+de.larmic.maven.plugins.*
+de.lars-sh.*
+de.larsgrefer.sass.*
+de.larsgrefer.sense-hat.*
+de.leanovate.*
+de.leanovate.cucumber.*
+de.leanovate.doby.*
+de.leanovate.play-mockws.*
+de.leanovate.pragmatic.*
+de.leanovate.router.*
+de.leanovate.swaggercheck.*
+de.leanovate.toehold.*
+de.learnlib.*
+de.learnlib.archetypes.*
+de.learnlib.distribution.*
+de.learnlib.testsupport.*
+de.lebeig.dev.*
+de.lenabrueder.*
+de.lgohlke.*
+de.lgohlke.com.github.webdriverextensions.*
+de.lgohlke.mojo.*
+de.lgohlke.selenium.*
+de.lhns.*
+de.lhorn.*
+de.li2b2.facade.*
+de.li2b2.shrine.*
+de.li2b2.shrine.node.*
+de.libal-tech.*
+de.lightful.maven.drools.*
+de.lightful.maven.drools.plugin.*
+de.lightful.maven.drools.plugin.dependency-management.*
+de.lightful.maven.drools.plugin.its.test-artifacts.*
+de.lightful.maven.drools.poms.*
+de.lightful.maven.plugins.*
+de.lightful.maven.testing.*
+de.lightful.poms.*
+de.linusdev.*
+de.linuxusers.levenshtein.*
+de.lkv-nrw.*
+de.lmu.ifi.dbs.elki.*
+de.lmu.ifi.dbs.jfeaturelib.*
+de.lmu.ifi.dbs.utilities.*
+de.lokago.*
+de.lolhens.*
+de.lyca.xslt.*
+de.m3y.gatling.knox.*
+de.m3y.hadoop.hdfs.hfsa.*
+de.m3y.kformat.*
+de.m3y.libmobi.*
+de.m3y.maven.*
+de.m3y.oozie.prometheus.*
+de.m3y.prometheus.assertj.*
+de.m3y.prometheus.client.*
+de.m3y.prometheus.exporter.fsimage.*
+de.m3y.prometheus.exporter.knox.*
+de.malkusch.*
+de.malkusch.amazon.product-advertising-api.*
+de.malkusch.km200.*
+de.malkusch.localized.*
+de.malkusch.niu.*
+de.malkusch.parent.*
+de.malkusch.soap-client-cache.*
+de.malkusch.spring-lib.*
+de.malkusch.tuya.*
+de.malkusch.validation.*
+de.malkusch.whois-server-list.*
+de.malkusch.whois-server-list.api.v0.*
+de.malkusch.whois-server-list.api.v1.*
+de.maltebehrendt.uppt.*
+de.mannodermaus.*
+de.mannodermaus.android-junit5.*
+de.mannodermaus.gradle.plugins.*
+de.mannodermaus.junit5.*
+de.mannodermaus.retrofit2.*
+de.manuzid.*
+de.marcelsauer.*
+de.marcoaust.prometheus.*
+de.marcreichelt.*
+de.marhali.*
+de.martin-senne.*
+de.martinpallmann.*
+de.martinpallmann.gchat.*
+de.martinreinhardt-online.*
+de.martinspielmann.haveibeenpwned4j.*
+de.martinspielmann.nmapxmlparser.*
+de.martinspielmann.wicket.*
+de.matrixweb.*
+de.matrixweb.hazelcast.*
+de.matrixweb.json-config.*
+de.matrixweb.maven.plugins.relocator.*
+de.matrixweb.ne.*
+de.matrixweb.nodejs.*
+de.matrixweb.osgi.*
+de.matrixweb.osgi.wrapped.*
+de.matrixweb.smaller-config.*
+de.matrixweb.smaller.*
+de.matrixweb.vfs.*
+de.matthiasfisch.*
+de.maxbossing.*
+de.maximilianbrandau.*
+de.maxr1998.*
+de.measite.jusyslog.*
+de.measite.minidns.*
+de.mediathekview.*
+de.megaera.*
+de.mehtrick.*
+de.melnichuk.*
+de.menodata.*
+de.metalcon.utils.*
+de.mgmechanics.albonubes.*
+de.mgmechanics.jdecisiontablelib.*
+de.mgmechanics.myflipflops.*
+de.mhoffrogge.*
+de.mhoffrogge.attached.*
+de.mhoffrogge.jna.*
+de.mhoffrogge.maven.*
+de.mhoffrogge.openjdk.*
+de.mhus.apache.karaf.tooling.*
+de.mhus.app.*
+de.mhus.app.reactive.*
+de.mhus.app.vault.*
+de.mhus.cherry.*
+de.mhus.cherry.reactive.*
+de.mhus.cherry.vault.*
+de.mhus.conductor.*
+de.mhus.crypt.*
+de.mhus.db.*
+de.mhus.inka.*
+de.mhus.jms.*
+de.mhus.karaf.*
+de.mhus.lib.*
+de.mhus.mvn.plugin.*
+de.mhus.osgi.*
+de.mhus.osgi.ports.*
+de.mhus.osgi.tutorial.*
+de.mhus.ports.*
+de.mhus.ports.karaf.tooling.*
+de.mhus.ports.vaadin.addon.*
+de.mhus.ports.vaadin.addons.*
+de.mhus.rest.*
+de.mhus.sling.vaadin.*
+de.mhus.vaadin.*
+de.mibos.*
+de.micromata.jak.*
+de.micromata.merlin.*
+de.micromata.mgc.*
+de.micromata.paypal.*
+de.micromata.tpsb.*
+de.microtema.*
+de.mindpipe.android.*
+de.miraculixx.*
+de.mirkosertic.*
+de.mirkosertic.bytecoder.*
+de.mirkosertic.cdicron.*
+de.mirkosertic.mavensonarsputnik.*
+de.mirkosertic.sonardelta.*
+de.mkammerer.*
+de.mkammerer.aleksa.*
+de.mkammerer.easy-krypto.*
+de.mkammerer.snowflake-id.*
+de.mkammerer.wiremock-junit5.*
+de.mklinger.commons.*
+de.mklinger.jgroups.*
+de.mklinger.maven.*
+de.mklinger.micro.*
+de.mklinger.qetcher.*
+de.mklinger.tomcat.*
+de.mkristian.gwt.*
+de.mlit.pdqueue.*
+de.mlo-dev.*
+de.mnl.osgi.*
+de.mobanisto.*
+de.mobiuscode.*
+de.mobiuscode.nameof.*
+de.mobiworx.urlifier.*
+de.monochromata.anaphors.*
+de.monochromata.ast.*
+de.monochromata.contract.*
+de.monochromata.cucumber.*
+de.monochromata.poms.*
+de.monticore.*
+de.monticore.commons.*
+de.monticore.mojo.*
+de.mpg.mpi-inf.*
+de.mpg.mpi-inf.ambiversenlu.*
+de.mr-pine.utils.*
+de.mrmaffen.*
+de.muehlencord.*
+de.muenchen.itm.*
+de.muenchen.oss.*
+de.muenchen.oss.ad2image.*
+de.muenchen.oss.appswitcher.*
+de.muenchen.oss.digiwf.*
+de.mukis.*
+de.muntjak.*
+de.musichin.fireko.*
+de.musichin.ktlint.reporter.*
+de.musichin.reactivelivedata.*
+de.musterbukkit.replaysystem.main.*
+de.mvbonline.*
+de.mvitz.*
+de.mwvb.*
+de.mxgu.*
+de.mynttt.*
+de.mytoys.maven.plugins.*
+de.naturzukunft.*
+de.naturzukunft.rdf.rdf4j-vocabulary.*
+de.naturzukunft.rdf.solid.*
+de.naturzukunft.rdf4j.*
+de.nehlmeier.common.*
+de.neonew.*
+de.neosearch.*
+de.netid.mobile.*
+de.neuland-bfi.*
+de.newsarea.homecockpit.*
+de.nidomiro.*
+de.nierbeck.*
+de.nierbeck.cassandra.*
+de.nierbeck.floating.data.*
+de.nikem.jebu.*
+de.nikem.nest.*
+de.niklasfi.aocr.*
+de.nilsdruyen.snappy.*
+de.no.number23.*
+de.notizwerk.*
+de.novanic.gwteventservice.*
+de.novanic.gwteventservice.demo.*
+de.novanic.gwteventservice.demo.conversation.*
+de.novanic.gwteventservice.demo.hellogwteventservice.*
+de.ntcomputer.*
+de.nycode.*
+de.oberdorf-itc.*
+de.objekt-kontor.*
+de.obqo.decycle.*
+de.obqo.gradle.*
+de.ocarthon.*
+de.odrotbohm.playground.*
+de.odysseus.juel.*
+de.odysseus.staxon.*
+de.ofterdinger.*
+de.ofterdinger.maven.plugins.*
+de.ofterdinger.parents.*
+de.oglimmer.utils.*
+de.ohmesoftware.*
+de.oliverlietz.*
+de.oliverwetterau.neo4j.*
+de.omanz.*
+de.onecode.*
+de.ontologizer.*
+de.opal-project.*
+de.openea.*
+de.openkeyword.*
+de.openknowledge.authentication.*
+de.orat.netbeans.*
+de.oscillation.gwt.*
+de.oscillation.kismet.*
+de.oscillation.maven.*
+de.osshangar.*
+de.otto.*
+de.otto.edison.*
+de.otto.eventsourcing.*
+de.otto.microservice.*
+de.otto.oauthtokenfilter.*
+de.otto.pact-jvm.*
+de.otto.rx-composer.*
+de.otto.sluggify.*
+de.otto.synapse.*
+de.ottonow.*
+de.ovgu.dke.glue.*
+de.ovgu.dke.mocca.*
+de.paderborn.uni.*
+de.paktosan.*
+de.pal-software.tools.*
+de.paul-woitaschek.slimber.*
+de.pawlidi.*
+de.paymill.*
+de.pco.*
+de.pdark.*
+de.peetzen.dropwizard.*
+de.peetzen.dropwizard.metrics.*
+de.peilicke.sascha.*
+de.pentabyte.*
+de.pentabyte.tools.*
+de.perdian.*
+de.perdian.apps.beandumper.*
+de.perdian.apps.dashboard.*
+de.perdian.apps.devlauncher.*
+de.perdian.commons.*
+de.perdian.flightsearch.*
+de.perdian.maven.plugins.*
+de.perdoctus.fx.*
+de.petendi.*
+de.pfabulist.*
+de.pfabulist.bigchin.*
+de.pfabulist.kleinod.*
+de.pfabulist.lindwurm.*
+de.pfabulist.loracle.*
+de.pfabulist.roast.*
+de.pfaffenrodt.*
+de.pheasn.*
+de.philippkatz.maven.plugins.*
+de.philippkatz.swing.property.*
+de.phip1611.*
+de.phpmonkeys.*
+de.pi3g.pi.*
+de.picturesafe.search.*
+de.pieroavola.shortkt.*
+de.piratech.*
+de.pitkley.*
+de.pitkley.jmccs.*
+de.pixel.mcc.*
+de.planlibre.*
+de.plushnikov.*
+de.plushnikov.intellij.*
+de.plushnikov.lombok-intellij-plugin.*
+de.plushnikov.maven.plugin.*
+de.plushnikov.xjc.*
+de.pniehus.scribblerlib.*
+de.poiu.apron.*
+de.poiu.coat.*
+de.poiu.fez.*
+de.poiu.kilt.*
+de.poiu.llc.*
+de.poiu.metrics.*
+de.powerstat.phplib.*
+de.powerstat.validation.*
+de.ppi.*
+de.ppi.dbunit.datasetbuilder.*
+de.ppi.oss.*
+de.ppi.oss.kzulip.*
+de.prauscher.*
+de.predic8.*
+de.pribluda.android.*
+de.pro-vision.devops.jenkins.*
+de.pro-vision.maven.*
+de.pro-vision.maven.spring.*
+de.protubero.*
+de.proxietv.*
+de.psdev.*
+de.psdev.formvalidations.*
+de.psdev.licensesdialog.*
+de.psdev.slf4j-android-logger.*
+de.pseudonymisierung.*
+de.psi.pjf.fx.layout.*
+de.qaware.cloud.cost.*
+de.qaware.gradle.plugin.*
+de.qaware.heimdall.*
+de.qaware.jasypt.*
+de.qaware.majx.*
+de.qaware.maven.*
+de.qaware.seu.as.code.*
+de.qaware.tools.collection-cacheable-for-spring.*
+de.qaware.tools.openapi-generator-for-spring.*
+de.qaware.tools.sonarqube-build-breaker.*
+de.qaware.xff.*
+de.quaddy-services.mule.maven.*
+de.quaddyservices.mvn.plugin.unused.*
+de.quantummaid.*
+de.quantummaid.eventmaid.*
+de.quantummaid.graalvmlambdaruntime.*
+de.quantummaid.httpmaid.*
+de.quantummaid.httpmaid.examples.*
+de.quantummaid.httpmaid.integrations.*
+de.quantummaid.httpmaid.tests.*
+de.quantummaid.injectmaid.*
+de.quantummaid.injectmaid.integrations.*
+de.quantummaid.mapmaid.*
+de.quantummaid.mapmaid.integrations.*
+de.quantummaid.messagemaid.*
+de.quantummaid.quantummaid.*
+de.quantummaid.quantummaid.integrations.*
+de.quantummaid.quantummaid.packagings.*
+de.quantummaid.reflectmaid.*
+de.quantummaid.testmaid.*
+de.quantummaid.testmaid.integrations.*
+de.quantummaid.tutorials.*
+de.quantummaid.tutorials.archetypes.*
+de.quantummaid.tutorials.aws-lambda.*
+de.quantummaid.tutorials.basic-tutorial.*
+de.quantummaid.tutorials.websockets-kotlin.*
+de.quantummaid.usecasemaid.*
+de.quinscape.*
+de.quinscape.domainql.*
+de.quippy.*
+de.quipsy.cli.*
+de.quist.apps.maps.*
+de.qytera.*
+de.rakuten.*
+de.ralfebert.*
+de.raphaelebner.*
+de.raptaml.*
+de.raysha.lib.*
+de.raysha.lib.net.*
+de.raysha.lib.telegram.*
+de.redsix.*
+de.redsix.dmn-check.gradle-plugin.*
+de.regnis.q.sequence.*
+de.renebergelt.*
+de.renebergelt.juitest.*
+de.renebergelt.maven.plugins.*
+de.resol.*
+de.retest.*
+de.rhauswald.guice.hessian.hessian-guice.*
+de.rhauswald.security.idor.*
+de.rhocas.featuregen.*
+de.rhocas.lijense.*
+de.rhocas.rapit.*
+de.richardliebscher.mdf4j.*
+de.richtercloud.*
+de.rieckpil.archetypes.*
+de.rmgk.*
+de.rmgk.slips.*
+de.roamingthings.*
+de.robertmetzger.*
+de.rocketinternet.*
+de.ronnyfriedland.maven.*
+de.root1.*
+de.roskenet.*
+de.rototor.jeuclid.*
+de.rototor.pdfbox.*
+de.rototor.snuggletex.*
+de.rpgframework.*
+de.rpjosh.*
+de.rtner.*
+de.rub.nds.*
+de.rub.nds.tls.*
+de.rub.nds.tls.attacker.*
+de.rub.nds.tls.breaker.*
+de.rub.nds.tls.dockerlib.*
+de.rub.nds.tls.scanner.*
+de.rub.nds.tlsattacker.*
+de.rub.nds.tlsscanner.*
+de.ruedigermoeller.*
+de.rwth.i2.*
+de.rwth.swc.coffee4j.*
+de.saly.*
+de.sambalmueslie.*
+de.samply.*
+de.sandec.*
+de.sandkastenliga.*
+de.sandroboehme.*
+de.sandroboehme.lesscss.*
+de.sandstorm.configdocgen.*
+de.saumya.mojo.*
+de.saxsys.*
+de.saxsys.synchronizefx.*
+de.sayayi.gradle.*
+de.sayayi.lib.*
+de.schauderhaft.degraph.*
+de.schegge.*
+de.schegge.test.*
+de.schildbach.wallet.*
+de.schipplock.apps.*
+de.schipplock.archetypes.*
+de.schipplock.gui.*
+de.schipplock.gui.swing.*
+de.schipplock.gui.swing.dialogs.*
+de.schipplock.settings.*
+de.schipplock.web.tepsf.*
+de.schlegel11.*
+de.schlichtherle.*
+de.schlichtherle.glassfish.*
+de.schlichtherle.io.*
+de.schlichtherle.kosit-validator.*
+de.schlichtherle.neuron-di.*
+de.schlichtherle.truecommons.*
+de.schlichtherle.truelicense.*
+de.schlichtherle.truezip.*
+de.schmizzolin.*
+de.schmizzolin.maven.poms.*
+de.schrieveslaach.nlpf.*
+de.schroenser.*
+de.schroenser.discord-bot.*
+de.schroenser.usb.*
+de.sciss.*
+de.scravy.*
+de.scrum-master.*
+de.scrum-master.org.javassist.*
+de.scrum-master.test.*
+de.sdun-zehmke.*
+de.sebastianhesse.cdk-constructs.*
+de.sebastianhesse.examples.*
+de.sebbraun.helpers.*
+de.seitenbau.serviceportal.*
+de.sekmi.histream.*
+de.sekmi.histream.maven.*
+de.sematre.dsbmobile.*
+de.sematre.fastreflection.*
+de.sematre.mathparser.*
+de.sematre.tg.*
+de.sero-systems.*
+de.serviceflow.*
+de.serviceflow.frankenstein.*
+de.serviceflow.frankenstein.plugin.*
+de.serviceflow.frankenstein.plugin.jogamp.*
+de.serviceflow.frankenstein.plugin.opencv.*
+de.sfb876.*
+de.sfuhrm.*
+de.sg-o.app.*
+de.sg-o.lib.*
+de.shadowhunt.*
+de.shadowhunt.maven.plugins.*
+de.shadowhunt.sonar.plugins.*
+de.sharpmind.*
+de.sharpmind.ktor.*
+de.siegmar.*
+de.silpion.opencms.maven.plugins.*
+de.simpleworks.staf.*
+de.sjwimmer.ta4j-charting.*
+de.skiptag.*
+de.skiptag.roadrunner.*
+de.skiptag.roadrunner.examples.*
+de.skuzzle.*
+de.skuzzle.enforcer.*
+de.skuzzle.inject.*
+de.skuzzle.slf4j.*
+de.skuzzle.springboot.test.*
+de.skuzzle.test.*
+de.skuzzle.tinyplugz.*
+de.slackspace.*
+de.sldk.*
+de.slevermann.*
+de.slothsoft.challenger.*
+de.slothsoft.charts.*
+de.slothsoft.random.*
+de.slub-dresden.*
+de.smartics.maven.plugin.*
+de.smartics.rules.*
+de.smartsquare.*
+de.softwareforge.*
+de.softwareforge.airship.*
+de.softwareforge.mojo.*
+de.softwareforge.testing.*
+de.softwareforge.tools.*
+de.solugo.gradle.test.*
+de.sonallux.spotify.*
+de.sonia.annotation.*
+de.sonia.commons.*
+de.sonia.maven.*
+de.sonia.portal.*
+de.sonia.portal.system.*
+de.sordul.*
+de.sormuras.*
+de.sormuras.bach.*
+de.sormuras.junit-platform-isolator.*
+de.sormuras.junit.*
+de.sormuras.mainrunner.*
+de.spaceteams.*
+de.spinscale.*
+de.spinscale.dropwizard.*
+de.spinscale.elasticsearch.plugin.*
+de.spinscale.elasticsearch.plugin.ingest.*
+de.spinscale.javalin.*
+de.spinscale.quarkus.*
+de.spqr-info.*
+de.spraener.nxtgen.*
+de.spricom.dessert.*
+de.srsoftware.*
+de.srtobi.*
+de.sstoehr.*
+de.staatsbibliothek-berlin.hsp.*
+de.starwit.*
+de.starwit.apacheds.*
+de.stefanteitge.*
+de.steffen-rumpf.*
+de.steffendingel.*
+de.stereotypez.*
+de.stklcode.jvault.*
+de.stklcode.pubtrans.*
+de.struller-baumann.*
+de.stuermer-benjamin.*
+de.surfice.*
+de.suur.jarmi.*
+de.sven-jacobs.*
+de.sven-torben.cqrest.*
+de.sven-torben.hystrix-jee.*
+de.sven-torben.wildfly.swarm.fractions.*
+de.svenkubiak.*
+de.svws-nrw.*
+de.svws-nrw.ext.*
+de.sweetcode.*
+de.swiesend.*
+de.swingbe.ifleet.*
+de.swm.*
+de.syquel.maven.reactorstate.*
+de.taimos.*
+de.taimos.ldjson.*
+de.taimos.semi.*
+de.team-holycow.*
+de.team33.libs.*
+de.team33.patterns.*
+de.team33.sphinx.*
+de.tebros.*
+de.tebros.inputcontrol.*
+de.teiesti.postie.*
+de.teiesti.proxy.*
+de.telekom.phonenumber.*
+de.telekom.smartcredentials.*
+de.telekom.test.*
+de.teragam.*
+de.terrestris.*
+de.tesis.dynaware.*
+de.tfh-berlin.knabe.*
+de.thalia.boot.trace.*
+de.thalia.junit.*
+de.thatscalaguy.*
+de.the-library-code.dspace.*
+de.theappguys.*
+de.theess.juxy.*
+de.theitshop.*
+de.thetaphi.*
+de.thewhiteshadow.*
+de.theyphania.*
+de.thksystems.*
+de.thm.mni.ii.*
+de.thm.mni.mote.*
+de.thomas-oster.*
+de.thomasasel.*
+de.thomaskrille.*
+de.thomaskrille.dropwizard.*
+de.timroes.*
+de.timroes.android.*
+de.timroes.gradle.*
+de.tisoft.rsyntaxtextarea.*
+de.tk.opensource.*
+de.tkunkel.oss.*
+de.toberkoe.*
+de.tobj.http.simplerequest.*
+de.tobj.junit.*
+de.tobj.nma.*
+de.tobj.twitch.*
+de.tolina.common.validation.*
+de.tolina.maven.plugins.*
+de.tomgrill.gdxdialogs.*
+de.tomgrill.gdxfacebook.*
+de.topobyte.*
+de.torqdev.*
+de.tototec.*
+de.trbnb.*
+de.tri-engineering.atlassian.plugins.*
+de.triology.cb.*
+de.triology.recaptchav2-java.*
+de.triology.test-data-loader.*
+de.triology.versionName.*
+de.trust-nickol.*
+de.trustable.*
+de.trustable.ca3s.*
+de.trustable.ca3s.acmeproxy.*
+de.trustable.ca3s.core.*
+de.trustable.cmp.client.*
+de.trustable.scep.client.*
+de.tschuehly.*
+de.tschumacher.*
+de.tsystems.mms.apm.*
+de.tu-darmstadt.stg.*
+de.tu-dresden.inf.lat.*
+de.tu-dresden.inf.lat.born.*
+de.tu-dresden.inf.lat.fcalib.*
+de.tu-dresden.inf.lat.gel.*
+de.tu-dresden.inf.lat.jcel.*
+de.tu-dresden.inf.lat.jproblog.*
+de.tu-dresden.inf.lat.jsexp.*
+de.tu-dresden.inf.lat.tabula.*
+de.tu-dresden.inf.lat.tabulas.*
+de.tu-dresden.inf.lat.uel.*
+de.tu-dresden.inf.lat.util.*
+de.tu-dresden.inf.lat.wikihtml.*
+de.tu_dortmund.cs.ls14.*
+de.tud.sse.*
+de.tudarmstadt.langtech.substituter.twsi.*
+de.tudarmstadt.ukp.dkpro.argumentation.*
+de.tudarmstadt.ukp.dkpro.argumentation.io.*
+de.tudarmstadt.ukp.dkpro.argumentation.misc.*
+de.tudarmstadt.ukp.dkpro.argumentation.preprocessing.*
+de.tudarmstadt.ukp.dkpro.argumentation.types.*
+de.tudarmstadt.ukp.dkpro.bigdata.*
+de.tudarmstadt.ukp.dkpro.core.*
+de.tudarmstadt.ukp.dkpro.keyphrases.*
+de.tudarmstadt.ukp.dkpro.lab.*
+de.tudarmstadt.ukp.dkpro.statistics.*
+de.tudarmstadt.ukp.dkpro.tc.*
+de.tudarmstadt.ukp.jwktl.*
+de.tudarmstadt.ukp.shibhttpclient.*
+de.tudarmstadt.ukp.wikipedia.*
+de.tudresden.inf.lat.jsexp.*
+de.tuebingen.uni.sfs.germanet.*
+de.tum.cit.ase.*
+de.tum.ei.lkn.eces.*
+de.tum.in.*
+de.tum.in.ase.*
+de.tum.in.ase.athene.*
+de.turnertech.*
+de.turtle-exception.fancyformat.*
+de.twentyeleven.bundled.*
+de.twentyeleven.skysail.*
+de.twentyeleven.unitprofile.*
+de.twentyeleven.unitprofiler.*
+de.tynne.*
+de.u-mass.*
+de.ubleipzig.*
+de.ufinke.*
+de.ummels.*
+de.undercouch.*
+de.undercouch.download.*
+de.unentscheidbar.*
+de.uni-bremen.informatik.st.*
+de.uni-freiburg.informatik.ultimate.*
+de.uni-hamburg.traces.*
+de.uni-heidelberg.ziti.sus.*
+de.uni-hildesheim.sse.spassMeter.*
+de.uni-leipzig.dbs.pprl.*
+de.uni-mainz.informatik.pl.*
+de.uni-mannheim.informatik.dws.*
+de.uni-mannheim.informatik.dws.dwslab.*
+de.uni-mannheim.informatik.dws.melt.*
+de.uni-mannheim.informatik.dws.winter.*
+de.uni-mannheim.rz.krum.*
+de.uni-muenster.*
+de.uni-passau.fim.seibt.*
+de.uni-potsdam.hpi.jerasure.*
+de.uni-rostock.sbi.*
+de.uni-trier.recap.*
+de.uni-trier.wi2.*
+de.uni-wuerzburg.coboslab.*
+de.uni.freiburg.iig.telematik.*
+de.uni_bremen.agra.fomeja.*
+de.uni_jena.cs.fusion.*
+de.uni_leipzig.asv.toolbox.*
+de.unibonn.iai.eis.*
+de.unidue.ltl.evaluation.*
+de.unidue.ltl.flextag.*
+de.uniks.*
+de.uniqueck.asciidoctorj.extensions.*
+de.unistuttgart.ims.*
+de.unistuttgart.ims.creta.*
+de.unistuttgart.ims.uima.io.*
+de.unistuttgart.isa.*
+de.uniwue.dmir.heatmap.*
+de.unknownreality.*
+de.unkrig.*
+de.unkrig.autoauth.*
+de.unkrig.checkstyle.*
+de.unkrig.commons.*
+de.unkrig.jdisasm.*
+de.unkrig.json-patch.*
+de.unkrig.lfr.*
+de.unkrig.txt2html.*
+de.unkrig.yaml-patch.*
+de.unkrig.zz.*
+de.unruh.*
+de.upb.cs.swt.*
+de.upb.cs.swt.delphi.*
+de.upb.cs.uc4.*
+de.valtech.aecu.*
+de.valtech.avs.*
+de.vandermeer.*
+de.vatrasoft.vatralib.*
+de.vdv.*
+de.verygame.surface.*
+de.verygame.xue.*
+de.viaboxx.*
+de.viaboxx.markdown.*
+de.viadee.*
+de.viadee.bpm.camunda.*
+de.viadee.camunda.*
+de.viadee.xai.anchor.*
+de.vinado.boot.*
+de.vinado.lib.*
+de.vinado.library.*
+de.vinado.spring.*
+de.voidnode.trading4j.*
+de.voize.*
+de.vorb.*
+de.vorb.sokrates.*
+de.w3is.*
+de.waldheinz.*
+de.wayofquality.blended.*
+de.wayofquality.blended.samples.*
+de.wcht.cc-xjc.*
+de.webducer.android.*
+de.welt.*
+de.weltraumschaf.*
+de.weltraumschaf.commons.*
+de.weltraumschaf.organization.*
+de.wenzlaff.blockchain.*
+de.wenzlaff.command.maven.plugin.*
+de.wenzlaff.dump1090.*
+de.wenzlaff.lebenskalender.*
+de.wenzlaff.linkchecker.*
+de.wenzlaff.phonebook.*
+de.wenzlaff.rest.beispiel.*
+de.wenzlaff.twbibel.*
+de.wenzlaff.twflug.*
+de.wenzlaff.twhackssh.*
+de.wenzlaff.twmindmapgenerator.*
+de.wenzlaff.twqualpass.*
+de.westemeyer.*
+de.westnordost.*
+de.whisperedshouts.*
+de.whitefrog.*
+de.wicketbuch.extensions.*
+de.wicketbuch.extensions.animatedajaxcontainer.*
+de.willscher.*
+de.wlami.*
+de.wuespace.telestion.*
+de.xam.*
+de.xam.j2cl.*
+de.xn--ho-hia.javapoet.*
+de.xn--ho-hia.maven.*
+de.xn--ho-hia.maven.boms.*
+de.xn--ho-hia.maven.parents.*
+de.xn--ho-hia.memoization.*
+de.xn--ho-hia.quality.*
+de.xn--ho-hia.storage_units.*
+de.xn--ho-hia.utils.fiscal_year.*
+de.xn--ho-hia.utils.storage_units.*
+de.xn--ho-hia.utils.types.*
+de.xwic.appkit.*
+de.xwic.cube.*
+de.xwic.etlgine.*
+de.xwic.jwic.*
+de.xypron.jcobyla.*
+de.xypron.statistics.*
+de.xypron.ui.*
+de.yanwittmann.*
+de.yourinspiration.*
+de.zalando.*
+de.zazaz.iot.bosch.indego.*
+de.zebrajaeger.*
+de.zedlitz.*
+de.zeigermann.xml.*
+decorutils.*
+default.*
+dentaku.*
+design.aem.*
+design.andromedacompose.*
+design.andromedacompose.icons.*
+design.andromedacompose.illustrations.*
+design.contract.*
+design.donkey.*
+design.hamu.*
+design.unstructured.*
+dev.3-3.*
+dev.abd3lraouf.ruler.*
+dev.acdcjunior.*
+dev.adamko.kotka.*
+dev.adamko.kxstsgen.*
+dev.aemvite.*
+dev.aetherite.*
+dev.aga.*
+dev.aga.sqlite.*
+dev.aherscu.qa.*
+dev.ahmedmourad.bundlizer.*
+dev.ahmedmourad.nocopy.*
+dev.ahmedmourad.nocopy.nocopy-gradle-plugin.*
+dev.ai4j.*
+dev.ainoha.framework.*
+dev.akif.*
+dev.akkinoc.spring.boot.*
+dev.akkinoc.util.*
+dev.alangomes.*
+dev.alexbeggs.mobius-timetravel.*
+dev.alexengrig.*
+dev.alphaserpentis.*
+dev.alshakib.dtext.*
+dev.alshakib.ext.*
+dev.alshakib.log.*
+dev.alshakib.rvcompat.*
+dev.alshakib.tasker.*
+dev.alshakib.tide.*
+dev.amaro.*
+dev.amaro.navigation.*
+dev.amp.*
+dev.andrewbailey.difference.*
+dev.angerm.ag_server.*
+dev.angerm.grpc.prometheus.*
+dev.antonius.*
+dev.antonius.microscope.*
+dev.anvith.blackbox.*
+dev.aoiroaoino.*
+dev.appkr.*
+dev.applibgroup.*
+dev.arbjerg.*
+dev.arbjerg.lavalink.*
+dev.argon.*
+dev.arildo.*
+dev.arpan.*
+dev.array21.*
+dev.arunkumar.*
+dev.arunkumar.compass.*
+dev.aspectj.*
+dev.aspirasoft.apis.*
+dev.assemblage.*
+dev.atchison.*
+dev.atchison.mariaDB4j.*
+dev.atedeg.*
+dev.atedeg.mdm.*
+dev.atomy.*
+dev.atsushieno.*
+dev.aungkyawpaing.burtha.*
+dev.aungkyawpaing.mmphonenumber.*
+dev.auth3.identity.*
+dev.autometrics.bindings.*
+dev.b37.libs.*
+dev.b3nedikt.applocale.*
+dev.b3nedikt.calligraphy.*
+dev.b3nedikt.restring.*
+dev.b3nedikt.reword.*
+dev.b3nedikt.viewpump.*
+dev.badbird.*
+dev.baecher.multipart.*
+dev.bandb.graphview.*
+dev.bantu.*
+dev.bantu.api.*
+dev.bargen.*
+dev.batect.docker.*
+dev.beneath.*
+dev.benedikt.compression.*
+dev.benedikt.localize.*
+dev.benedikt.math.*
+dev.betanzos.*
+dev.bf2.ffm.*
+dev.bgahagan.*
+dev.binis.*
+dev.birju.*
+dev.bitbite.*
+dev.blanke.maven.plugins.*
+dev.blanke.webpush.*
+dev.blanke.webpush.jwt.*
+dev.blitzcraft.*
+dev.bloedarend.*
+dev.bloodstone.*
+dev.bluefalcon.*
+dev.bluepitaya.*
+dev.bmcreations.*
+dev.boby.elmo.*
+dev.bodewig.db2ascii.*
+dev.bodewig.sql-resultset-interfaces.*
+dev.bombinating.*
+dev.bomu.*
+dev.born.*
+dev.brachtendorf.*
+dev.bradhandy.testing.*
+dev.bright.codified.*
+dev.buildtool.*
+dev.burnoo.*
+dev.cdevents.*
+dev.cdevents.sdk-java.*
+dev.cel.*
+dev.cerbos.*
+dev.cereza.*
+dev.cerus.*
+dev.cerus.advance.*
+dev.cerus.maps.*
+dev.cgomez.*
+dev.cgomez.oldkase.*
+dev.cgomez.testrecordinterceptor.*
+dev.chauvin.*
+dev.cheem.projects.*
+dev.cheleb.*
+dev.chopsticks.*
+dev.chrisbanes.*
+dev.chrisbanes.accompanist.*
+dev.chrisbanes.circuit.*
+dev.chrisbanes.compose.*
+dev.chrisbanes.insetter.*
+dev.chrisbanes.material3.*
+dev.chrisbanes.paparazzi.*
+dev.chrisbanes.snapper.*
+dev.chriskrueger.*
+dev.christianbroomfield.*
+dev.chromie.*
+dev.cirras.*
+dev.claudio.*
+dev.code-n-roll.gatling.*
+dev.codeflush.*
+dev.codesoapbox.*
+dev.cognio.andromeda.*
+dev.coldhands.jersey.properties.*
+dev.comfast.*
+dev.continuously.*
+dev.continuously.libretto.*
+dev.cookiecode.*
+dev.costas.*
+dev.crashteam.*
+dev.crashteam.maven.plugins.*
+dev.cubxity.plugins.*
+dev.dacbiet.*
+dev.datlag.flower-core.*
+dev.datlag.flower-ktorfit.*
+dev.datlag.flower-retrofit.*
+dev.datlag.jsunpacker.*
+dev.davidvarela.bottomnavscaffold.*
+dev.dejvokep.*
+dev.denux.*
+dev.denwav.hypo.*
+dev.derklaro.aerogel.*
+dev.derklaro.reflexion.*
+dev.derklaro.spiget.*
+dev.dewy.*
+dev.dhruv.*
+dev.dialector.*
+dev.diceroll.*
+dev.dimlight.*
+dev.dirs.*
+dev.ditsche.*
+dev.dmgiangi.*
+dev.doamaral.*
+dev.dominion.ecs.*
+dev.dovydasvenckus.*
+dev.drewhamilton.androidtime.*
+dev.drewhamilton.extracare.*
+dev.drewhamilton.inlinedimens.*
+dev.drewhamilton.poko.*
+dev.drewhamilton.rxpreferences.*
+dev.drewhamilton.skylight.*
+dev.drewhamilton.skylight.android.*
+dev.drewhamilton.skylight.android.brand.*
+dev.dsf.*
+dev.elide.*
+dev.elide.tools.*
+dev.elide.tools.kotlin.plugin.*
+dev.enro.*
+dev.entao.app.*
+dev.entao.web.*
+dev.equo.ide.*
+dev.erikchristensen.javamath2kmp.*
+dev.errant.*
+dev.eruizc.*
+dev.esnault.wanakana.*
+dev.espi.*
+dev.evo.elasticart.*
+dev.evo.elasticmagic.*
+dev.evo.kafka-connect-rest-client.*
+dev.evo.kafka-es.*
+dev.evo.persistent.*
+dev.evo.prometheus.*
+dev.evowizz.common.*
+dev.ewert.*
+dev.eyrond.paperkt.*
+dev.failgood.*
+dev.failsafe.*
+dev.fakir.*
+dev.falhad.*
+dev.fastball.*
+dev.fastbot.bot.*
+dev.feast.*
+dev.felnull.*
+dev.felnull.fnjl.*
+dev.filechampion.*
+dev.fitko.fitconnect.*
+dev.fitko.fitconnect.sdk.*
+dev.flower.*
+dev.folomeev.kotgl.*
+dev.fomenko.*
+dev.foo4bar.*
+dev.forcetower.unes.*
+dev.forkhandles.*
+dev.forst.*
+dev.fpinbo.*
+dev.franckyi.*
+dev.franckyi.kbuttplug.*
+dev.fritz2.*
+dev.fuelyour.*
+dev.fuxing.*
+dev.fuzzit.javafuzz.*
+dev.g4s.*
+dev.galasa.*
+dev.galasa.githash.*
+dev.galasa.obr.*
+dev.galasa.testcatalog.*
+dev.galasa.tests.*
+dev.ggok.zerodep.*
+dev.gitlive.*
+dev.gradleplugins.*
+dev.gradleplugins.documentation.api-reference.*
+dev.gradleplugins.documentation.dsl-reference.*
+dev.gradleplugins.documentation.github-pages-publish.*
+dev.gradleplugins.documentation.github-pages-site.*
+dev.gradleplugins.documentation.javadoc-render.*
+dev.gradleplugins.documentation.jbake-render.*
+dev.gradleplugins.documentation.site.*
+dev.gradleplugins.gradle-plugin-base.*
+dev.gradleplugins.gradle-plugin-development.*
+dev.gradleplugins.gradle-plugin-functional-test.*
+dev.gradleplugins.gradle-plugin-testing-base.*
+dev.gradleplugins.gradle-plugin-unit-test.*
+dev.gradleplugins.groovy-gradle-plugin.*
+dev.gradleplugins.java-gradle-plugin.*
+dev.graffa.*
+dev.gregorius.library.*
+dev.grmek.maven.*
+dev.gruncan.s4j.*
+dev.guardrail.*
+dev.guillaumebogard.*
+dev.gustavoavila.*
+dev.h4kt.xposed.*
+dev.haeusler.*
+dev.haeusler.geojson-kotlin.*
+dev.harrel.*
+dev.haven.*
+dev.hcf.ball.*
+dev.hcf.ganymede.*
+dev.hctbst.*
+dev.helk.*
+dev.hichamboushaba.suspendactivityresult.*
+dev.hilla.*
+dev.hitools.android.*
+dev.hitools.common.*
+dev.hnaderi.*
+dev.hollowcube.*
+dev.holt.*
+dev.hotwire.*
+dev.hshn.*
+dev.hubx.*
+dev.i-whammy.*
+dev.i10416.*
+dev.iabudiab.*
+dev.iaiabot.furufuru.*
+dev.iaiabot.maze.*
+dev.icerock.*
+dev.icerock.moko.*
+dev.icerock.moko.widgets.*
+dev.icerock.tools.*
+dev.id2r.*
+dev.inkremental.*
+dev.inmo.*
+dev.iomapper.*
+dev.isaacribeiro.*
+dev.itcode.*
+dev.j2ee.*
+dev.j3ee.*
+dev.jahir.*
+dev.jakartalemon.*
+dev.jarand.*
+dev.javatools.*
+dev.javiersolis.android.*
+dev.jbang.*
+dev.jdtech.mpv.*
+dev.jeka.*
+dev.jeka.plugins.*
+dev.jensderuiter.*
+dev.jeziellago.*
+dev.jfr4jdbc.*
+dev.jhseo.*
+dev.jianastrero.compose-nav-transitions.*
+dev.jianastrero.compose-permissions.*
+dev.jigue.*
+dev.jimmymorales.*
+dev.jlibra.*
+dev.jonaz.vured.core.*
+dev.jonaz.vured.util.*
+dev.jonpoulton.alakazam.*
+dev.jonpoulton.dexter.*
+dev.jonpoulton.dexter.plugin.*
+dev.jonpoulton.mandark.*
+dev.jorel.*
+dev.joshuasylvanus.navigator.*
+dev.joss.*
+dev.jsbrucker.*
+dev.jyuch.*
+dev.katsute.*
+dev.kaytea.*
+dev.kdblib.*
+dev.kdrag0n.*
+dev.keiji.apdu.*
+dev.keiji.mangaview.*
+dev.keiji.rfc4648.*
+dev.keiji.tlv.*
+dev.kensa.*
+dev.kerkmann.*
+dev.keva.*
+dev.kgbier.util.*
+dev.khbd.*
+dev.khbd.interp4j.*
+dev.khbd.lens4j.*
+dev.kiki.*
+dev.klepto.commands.*
+dev.klepto.kweb3.*
+dev.klepto.lazyvoids.*
+dev.klepto.unreflect.*
+dev.kord.*
+dev.kord.cache.*
+dev.kord.x.*
+dev.kosmx.needle.*
+dev.kosrat.*
+dev.kotx.*
+dev.koubic.*
+dev.kovstas.*
+dev.krud.*
+dev.kske.*
+dev.ktobe.*
+dev.kylesilver.*
+dev.lajoscseppento.fancydoc.*
+dev.lajoscseppento.gradle.*
+dev.lajoscseppento.ruthless.*
+dev.lajoscseppento.ruthless.java-application.*
+dev.lajoscseppento.ruthless.java-gradle-plugin.*
+dev.lajoscseppento.ruthless.java-library.*
+dev.lajoscseppento.ruthless.logging.*
+dev.lajoscseppento.ruthless.spring-boot-application.*
+dev.lajoscseppento.ruthless.spring-boot-library.*
+dev.landin.archetypes.*
+dev.langchain4j.*
+dev.lcdsmao.jettheme.*
+dev.ldldevelopers.*
+dev.le-app.*
+dev.learning.xapi.*
+dev.learning.xapi.samples.*
+dev.lightdream.*
+dev.limebeck.*
+dev.linfn.lucene.*
+dev.linwood.*
+dev.logchange.*
+dev.logchange.hofund.*
+dev.loqo71la.*
+dev.ludovic.*
+dev.ludovic.netlib.*
+dev.luisramos.kroclin.*
+dev.lukebemish.autoextension.*
+dev.lukebemish.opensesame.*
+dev.lydtech.*
+dev.macula.boot.*
+dev.madetobuild.typedconfig.*
+dev.manpreet.*
+dev.marcellogalhardo.*
+dev.marcelpinto.*
+dev.mardroemmar.*
+dev.marksman.*
+dev.marshi.android.*
+dev.masecla.*
+dev.materii.compose-custom-tabs.*
+dev.materii.pullrefresh.*
+dev.maximilian.util.*
+dev.maxmelnyk.*
+dev.mayuna.*
+dev.mbien.jfrlog.*
+dev.mbien.netbeans.xpath.*
+dev.mbo.*
+dev.mcatta.*
+dev.mccue.*
+dev.mcullenm.*
+dev.medzik.*
+dev.medzik.librepass.*
+dev.merge.*
+dev.merge.api.*
+dev.merge.ats.*
+dev.merge.hris.*
+dev.metaspace.plugin.*
+dev.michallaskowski.mokttp.*
+dev.migwel.chesscomjava.*
+dev.migwel.javadeps.*
+dev.migwel.tournify.*
+dev.miku.*
+dev.minimul.*
+dev.minutest.*
+dev.misfitlabs.kotlinguice4.*
+dev.mitchdenny.trash.*
+dev.mlnr.*
+dev.mlopes.*
+dev.moataz.*
+dev.mobile.*
+dev.mokkery.*
+dev.mongocamp.*
+dev.monosoul.jooq-docker.*
+dev.monosoul.jooq.*
+dev.morlin.map.*
+dev.morphia.critter.*
+dev.morphia.morphia.*
+dev.mrbergin.*
+dev.msfjarvis.tracelog.*
+dev.msfjarvis.whetstone.*
+dev.mslalith.*
+dev.murmurs.kapper.*
+dev.mysearch.*
+dev.mzarnowski.infra.*
+dev.mzarnowski.infra.fs.*
+dev.mzarnowski.os.executable.*
+dev.naoh.*
+dev.nasser.*
+dev.natsuume.*
+dev.natsuume.knp4j.*
+dev.nero.*
+dev.netcode.*
+dev.nicklasw.*
+dev.nicu.akka.*
+dev.niubi.commons.*
+dev.nohus.*
+dev.nohus.autokonfig.*
+dev.nokee.*
+dev.nokee.c-application.*
+dev.nokee.c-language.*
+dev.nokee.c-library.*
+dev.nokee.cpp-application.*
+dev.nokee.cpp-language.*
+dev.nokee.cpp-library.*
+dev.nokee.init.*
+dev.nokee.jni-library.*
+dev.nokee.objective-c-application.*
+dev.nokee.objective-c-ios-application.*
+dev.nokee.objective-c-language.*
+dev.nokee.objective-c-library.*
+dev.nokee.objective-c-xctest-test-suite.*
+dev.nokee.objective-cpp-application.*
+dev.nokee.objective-cpp-language.*
+dev.nokee.objective-cpp-library.*
+dev.nokee.pom-dsl.*
+dev.nokee.swift-application.*
+dev.nokee.swift-ios-application.*
+dev.nokee.swift-library.*
+dev.nokee.xcode-ide.*
+dev.nomadblacky.*
+dev.nordia.whoisrem.*
+dev.notmyfault.serverlib.*
+dev.nullzwo.*
+dev.nwithan8.*
+dev.nycode.kotlinx-serialization-bitmask.*
+dev.nyon.*
+dev.o1c.*
+dev.oak3.*
+dev.obvionaoe.compose.*
+dev.ocpd.liquibase.*
+dev.ocpd.liquibase.ext.*
+dev.ocpd.oss.*
+dev.ocpd.slf4k.*
+dev.ocpd.spring.*
+dev.olshevski.*
+dev.olshevski.navigation.*
+dev.olshevski.safeargs.*
+dev.olshevski.versions.*
+dev.olshevski.viewmodel.*
+dev.omega24.*
+dev.onenowy.moshipolymorphicadapter.*
+dev.onvoid.webrtc.*
+dev.onvoid.webrtc.demo.*
+dev.oop778.*
+dev.oop778.shelftor.*
+dev.openfeature.*
+dev.openfeature.contrib.*
+dev.openfeature.contrib.hooks.*
+dev.openfeature.contrib.providers.*
+dev.openfunction.*
+dev.openfunction.functions.*
+dev.openmobile.*
+dev.opensavvy.pedestal.*
+dev.optics.*
+dev.orhantugrul.safe.*
+dev.orne.*
+dev.orne.test.*
+dev.orquesta.*
+dev.ostara.*
+dev.otbe.*
+dev.pablodiste.datastore.*
+dev.parodos.*
+dev.paseto.*
+dev.patrickgold.compose.tooltip.*
+dev.patrickgold.jetpref.*
+dev.pauloribeiro.cepcorreios.*
+dev.pcms.*
+dev.pcms.test.*
+dev.pelkum.*
+dev.pellet.*
+dev.personnummer.*
+dev.peterrhodes.optionpricing.*
+dev.petitjam.*
+dev.petuska.*
+dev.petuska.klip.*
+dev.petuska.npm.publish.*
+dev.piglin.*
+dev.pinkroom.*
+dev.pinkroom.walletconnectkit.*
+dev.piste.api.*
+dev.piste.jva.*
+dev.pitlor.*
+dev.pixelib.meteor.*
+dev.pixelib.meteor.transport.*
+dev.playmonad.*
+dev.poire.buzz4j.*
+dev.priyankvasa.android.*
+dev.profunktor.*
+dev.programadorthi.routing.*
+dev.prokop.*
+dev.prokop.commons.*
+dev.prokop.crypto.*
+dev.prokop.fps.*
+dev.prokop.rxtx.*
+dev.pyyqww.utils.*
+dev.qadenz.*
+dev.qiao.*
+dev.qinx.*
+dev.qixils.crowdcontrol.*
+dev.quantumfusion.*
+dev.quiro.sheath.*
+dev.r0bert.*
+dev.rablet.*
+dev.rafex.ether.*
+dev.rafex.ether.cli.*
+dev.rafex.ether.email.*
+dev.rafex.ether.jdbc.*
+dev.rafex.ether.json.*
+dev.rafex.ether.jwt.*
+dev.rafex.ether.object.*
+dev.rafex.ether.parent.*
+dev.rafex.ether.properties.*
+dev.rafex.ether.rest.*
+dev.ravenapp.*
+dev.ravindu.*
+dev.reactant.*
+dev.redcoke.*
+dev.reformator.stacktracedecoroutinator.*
+dev.renann.*
+dev.renoth.*
+dev.responsive.*
+dev.resteasy.grpc.*
+dev.resteasy.rxjava.*
+dev.resteasy.tools.*
+dev.ricknout.composesensors.*
+dev.rikka.hidden.*
+dev.rikka.ndk.*
+dev.rikka.ndk.thirdparty.*
+dev.rikka.rikkax.annotation.*
+dev.rikka.rikkax.appcompat.*
+dev.rikka.rikkax.buildcompat.*
+dev.rikka.rikkax.compatibility.*
+dev.rikka.rikkax.core.*
+dev.rikka.rikkax.html.*
+dev.rikka.rikkax.insets.*
+dev.rikka.rikkax.io.*
+dev.rikka.rikkax.layoutinflater.*
+dev.rikka.rikkax.lazy.*
+dev.rikka.rikkax.lifecycle.*
+dev.rikka.rikkax.material.*
+dev.rikka.rikkax.parcelablelist.*
+dev.rikka.rikkax.preference.*
+dev.rikka.rikkax.recyclerview.*
+dev.rikka.rikkax.widget.*
+dev.rikka.shizuku.*
+dev.rikka.tools.*
+dev.rikka.tools.autoresconfig.*
+dev.rikka.tools.materialthemebuilder.*
+dev.rikka.tools.refine.*
+dev.roanh.cpqnativeindex.*
+dev.roanh.gmark.*
+dev.roanh.util.*
+dev.roava.*
+dev.robinohs.*
+dev.robocode.tankroyale.*
+dev.rogeriofbrito.*
+dev.rolang.*
+dev.romainguy.*
+dev.rpeters.*
+dev.rsbat.*
+dev.rubensilva.*
+dev.rudiments.*
+dev.rvr.*
+dev.s7a.*
+dev.sampalmer.*
+dev.samstevens.totp.*
+dev.sanda.*
+dev.sarquella.lifecyclecells.*
+dev.sarquella.mutabledatasource.*
+dev.sarquella.publishtest.*
+dev.sasikanth.*
+dev.sassine.api.*
+dev.saurabharora.lint.checks.*
+dev.scalapy.*
+dev.scarisey.*
+dev.scheibelhofer.*
+dev.schlaubi.*
+dev.schlaubi.lavakord.*
+dev.secondsun.*
+dev.sefiraat.*
+dev.sefiraat.slimetinker.*
+dev.sergiobelda.android.companion.*
+dev.sgora.*
+dev.shamil.*
+dev.sharek.*
+dev.shawngarner.*
+dev.shermende.*
+dev.shopstack.security.*
+dev.shortloop.*
+dev.shortloop.agent.*
+dev.shota.*
+dev.shreyaspatil.*
+dev.shreyaspatil.EasyUpiPayment.*
+dev.shreyaspatil.MaterialDialog.*
+dev.shreyaspatil.autodemolib.*
+dev.shreyaspatil.compose-compiler-report-generator.*
+dev.shreyaspatil.mutekt.*
+dev.shreyaspatil.permission-flow.*
+dev.sigstore.*
+dev.sigstore.maven.*
+dev.sigstore.maven.plugins.*
+dev.simpleframework.*
+dev.simurgh.*
+dev.simurgh.core.jni.*
+dev.sitar.*
+dev.skilltreeplatform.*
+dev.skomlach.*
+dev.skye.daisy.*
+dev.slifer.*
+dev.slop.*
+dev.snipme.*
+dev.snowdrop.*
+dev.soffa.foundation.*
+dev.speakeasyapi.*
+dev.specto.*
+dev.spiti.utilities.*
+dev.srylax.*
+dev.srylax.bbbassets.*
+dev.sschnabe.micronaut.*
+dev.ssdd.*
+dev.stalla.*
+dev.stashy.midifunk.*
+dev.stateholder.*
+dev.stocky37.*
+dev.stratospheric.*
+dev.struchkov.*
+dev.struchkov.godfather.*
+dev.struchkov.godfather.telegram.*
+dev.struchkov.haiti.*
+dev.struchkov.haiti.data.*
+dev.struchkov.haiti.filter.*
+dev.struchkov.haiti.utils.*
+dev.struchkov.openai.*
+dev.struchkov.yookassa.*
+dev.sublab.*
+dev.supasintatiyanupanwong.libraries.android.kits.base.*
+dev.supasintatiyanupanwong.libraries.android.kits.location.*
+dev.supasintatiyanupanwong.libraries.android.kits.maps.*
+dev.supasintatiyanupanwong.libraries.android.kits.places.*
+dev.surratt.*
+dev.susliko.*
+dev.sympho.*
+dev.taie.cloud.*
+dev.taie.nacos.*
+dev.taie.sentinel.*
+dev.talosdx.*
+dev.tauri.*
+dev.teapot.*
+dev.temperlang.*
+dev.teogor.*
+dev.teogor.sudoklify.*
+dev.testify.*
+dev.thanbv1510.*
+dev.thatsnasu.*
+dev.the-fireplace.*
+dev.thecodewarrior.*
+dev.thejakwe.qse.*
+dev.themeinerlp.*
+dev.themeinerlp.plugin-debug.*
+dev.thiagosouto.*
+dev.thriving.oss.*
+dev.tiangong.*
+dev.tiebe.*
+dev.tindersamurai.*
+dev.tmapps.*
+dev.tobee.*
+dev.toliyansky.*
+dev.toniogela.*
+dev.topping.*
+dev.travisbrown.*
+dev.triumphteam.*
+dev.turingcomplete.*
+dev.tuxjsql.*
+dev.twister.*
+dev.uni-hamburg.*
+dev.ustits.krefty.*
+dev.vality.*
+dev.vality.adapter-client-lib.*
+dev.vality.adapter-thrift-lib.*
+dev.vality.geck.*
+dev.vality.logback.*
+dev.vality.maven.plugins.*
+dev.vality.woody.*
+dev.valora.commons.*
+dev.vankka.*
+dev.vankka.DependencyDownload.*
+dev.vankka.dependencydownload.*
+dev.vespucci.gsoc.vh.*
+dev.vhonta.*
+dev.viesoft.paperkit.*
+dev.viskar.*
+dev.vladleesi.kutilicious.*
+dev.voidframework.*
+dev.volo.shimmer.*
+dev.vstrs.*
+dev.walgo.*
+dev.warrant.*
+dev.warrengates.*
+dev.whaling.*
+dev.whyoleg.cryptography.*
+dev.windly.*
+dev.wirespec.jetmagic.*
+dev.xethh.archetype.*
+dev.xethh.libs.*
+dev.xethh.libs.toolkits.*
+dev.xethh.libs.toolkits.akka.*
+dev.xethh.libs.toolkits.webDto.*
+dev.xethh.toolkits.*
+dev.xethh.tools.scala.*
+dev.xethh.utils.*
+dev.xethh.webtools.*
+dev.xinlake.*
+dev.xoa.reporter.*
+dev.yafatek.*
+dev.yasint.*
+dev.yasper.*
+dev.yavin.*
+dev.yavuztas.*
+dev.ybrig.ck8s.cli.*
+dev.yerbie.*
+dev.yila.*
+dev.yorkie.*
+dev.youshallnotpass.*
+dev.zacsweers.*
+dev.zacsweers.autoservice.*
+dev.zacsweers.autoservice.ksp.*
+dev.zacsweers.kctfork.*
+dev.zacsweers.kgp-150-leak-patcher.*
+dev.zacsweers.moshisealed.*
+dev.zacsweers.moshix.*
+dev.zacsweers.redacted.*
+dev.zacsweers.redacted.redacted-gradle-plugin.*
+dev.zacsweers.ticktock.*
+dev.zarr.*
+dev.zerite.craftlib.*
+dev.zhengxiang.*
+dev.zhengying.*
+dev.zio.*
+dev.zodo.*
+dev.zodo.vdp.*
+dev.zxilly.*
+dev.zyzdev.*
+digital.ivan.*
+digital.ivan.lightchain.*
+digital.junkie.*
+digital.nedra.commons.*
+digital.nedra.commons.starter.*
+digital.soares.*
+digital.tail.sdk.tail_mobile_sdk.*
+digital.toke.*
+digital.wup.*
+directory-asn1.*
+directory-clients.*
+directory-naming.*
+directory-network.*
+directory-protocols.*
+directory-shared.*
+directory.*
+directory.directory.*
+displaytag.*
+ditchnet.*
+dk.acto.*
+dk.aeai.*
+dk.alexandra.fresco.*
+dk.alexandra.fresco.outsourcing.*
+dk.ange.edith.*
+dk.apaq.*
+dk.apaq.crud.*
+dk.apaq.crud.jpa.*
+dk.apaq.filter.*
+dk.apaq.framework.*
+dk.apaq.printing.*
+dk.apaq.vaadin.addon.*
+dk.apaq.vfs.*
+dk.apaq.webkit.*
+dk.au.ece.vdmj.*
+dk.bankdata.api.*
+dk.bankdata.gradle.swagger.*
+dk.bankdata.jaxrs.*
+dk.bankdata.jaxws.*
+dk.bankdata.prometheus.*
+dk.bankdata.tools.*
+dk.bitcraft.*
+dk.brics.*
+dk.brics.automaton.*
+dk.cachet.carp.client.*
+dk.cachet.carp.clients.*
+dk.cachet.carp.common.*
+dk.cachet.carp.common.test.*
+dk.cachet.carp.data.*
+dk.cachet.carp.deployment.*
+dk.cachet.carp.deployments.*
+dk.cachet.carp.protocols.*
+dk.cachet.carp.studies.*
+dk.cachet.carp.test.*
+dk.cachet.detekt.extensions.*
+dk.clanie.*
+dk.cloudcreate.essentials.*
+dk.cloudcreate.essentials.components.*
+dk.cooldev.easytiming.*
+dk.cwconsult.*
+dk.cwconsult.peregrin.*
+dk.cwconsult.scalastyle.*
+dk.danskebank.markets.*
+dk.digitalidentity.*
+dk.digst.*
+dk.dma.*
+dk.dma.ais.lib.*
+dk.dma.commons.*
+dk.dma.enav.*
+dk.dren.*
+dk.e-software.*
+dk.eobjects.commons.*
+dk.eobjects.datacleaner.*
+dk.eobjects.metamodel.*
+dk.glasius.*
+dk.grinn.*
+dk.grinn.bom.*
+dk.grinn.keycloak.*
+dk.hyperdivision.*
+dk.i1.diameter.*
+dk.ignalina.lab.spark232.*
+dk.jacobve.maven.archetypes.*
+dk.jonaslindstrom.ruffini.*
+dk.jyskebank.tooling.enunciate.*
+dk.kb.stream.*
+dk.kewill.thirdpartymavencentral.*
+dk.kosmisk.*
+dk.kvalitetsit.*
+dk.kyuff.pomlint.*
+dk.langli.*
+dk.mada.*
+dk.mada.jaxrs.*
+dk.magical.*
+dk.magnusjensen.*
+dk.navicon.*
+dk.netdesign.*
+dk.nodes.arch.*
+dk.nodes.blue.*
+dk.nodes.ci.*
+dk.nodes.data.*
+dk.nodes.filepicker.*
+dk.nodes.formvalidator.*
+dk.nodes.gutenberg.*
+dk.nodes.locksmith.*
+dk.nodes.nstack.*
+dk.nodes.utils.*
+dk.nversion.*
+dk.nykredit.api.*
+dk.nykredit.jackson.dataformat.*
+dk.nykredit.resilience.*
+dk.nykredit.swagger.*
+dk.ralu.opensource.testsupport.*
+dk.schaumburgit.fast-barcode-scanner.*
+dk.sebsa.*
+dk.sublife.docker-integration.*
+dk.swissarmyronin.*
+dk.syddjurs.camel.*
+dk.tbsalling.*
+dk.tildeslash.xray.*
+dk.yalibs.*
+dna.*
+dnsjava.*
+docbook.*
+doccheck.*
+dom4j.*
+domify.*
+doxia.*
+drone.*
+drools-examples.*
+drools.*
+dsh-vocabulary.*
+dtdparser.*
+dumbster.*
+dwr.*
+dynaop.*
+earth.worldwind.*
+easyconf.*
+easymock.*
+ec.gob.senescyt.*
+echo.*
+eclipse.*
+eco.m1.*
+ecs.*
+edenlib.*
+edtftp.*
+edu.amherst.acdc.*
+edu.arizona.sista.*
+edu.asu.diging.*
+edu.berkeley.cs.*
+edu.berkeley.cs.amplab.*
+edu.berkeley.cs.amplab.adam.*
+edu.berkeley.cs.jqf.*
+edu.berkeley.cs.shark.*
+edu.berkeley.nlp.*
+edu.brown.cs.burlap.*
+edu.buffalo.cse.maybe.*
+edu.byu.hbll.*
+edu.byu.hbll.box.*
+edu.byu.hbll.maven.*
+edu.byu.hbll.witness.*
+edu.chop.research.*
+edu.chop.research.dbhi.*
+edu.clemson.cs.resolve.*
+edu.cmu.cs.*
+edu.cmu.cs.delphi.*
+edu.cmu.cs.diamond.opendiamond.*
+edu.cmu.cs.gabriel.*
+edu.cmu.lti.oaqa.bio.core.*
+edu.cmu.lti.oaqa.core.*
+edu.cmu.lti.oaqa.core.provider.*
+edu.cmu.lti.oaqa.cse.*
+edu.cmu.lti.oaqa.ecd.*
+edu.cmu.lti.oaqa.framework.impl.*
+edu.cmu.lti.oaqa.openqa.*
+edu.cmu.ml.rtw.*
+edu.cmu.sei.ams.cloudlet.*
+edu.cmu.sei.ams.log.*
+edu.cmu.sv.*
+edu.cnu.cs.*
+edu.colostate.omslab.*
+edu.columbia.tjw.*
+edu.cornell.library.scholars.*
+edu.cornell.ncrn.ced2ar.*
+edu.cornell.ncrn.ced2ar.data.*
+edu.cornell.ncrn.ced2ar.ddigen.*
+edu.cornell.ncrn.ced2ar.stata.*
+edu.cornell.weill.reciter.*
+edu.duke.cs.*
+edu.eckerd.*
+edu.emory.bmi.*
+edu.emory.clir.*
+edu.emory.mathcs.*
+edu.emory.mathcs.nlp.*
+edu.emory.mathcs.util.*
+edu.fhda.*
+edu.gatech.gtri.bk-tree.*
+edu.gatech.gtri.orafile.*
+edu.gatech.gtri.string-metric.*
+edu.gatech.gtri.typesafeconfig-extensions.*
+edu.gemini.*
+edu.gmu.cs.*
+edu.gmu.swe.phosphor.*
+edu.harvard.eecs.*
+edu.hm.hafner.*
+edu.illinois.*
+edu.illinois.cs.*
+edu.illinois.library.*
+edu.illinois.lis.*
+edu.illinois.wala.*
+edu.internet2.middleware.grouper.*
+edu.internet2.middleware.psp.*
+edu.iris.dmc.*
+edu.isi.kcap.*
+edu.isi.kcap.diskproject.*
+edu.isi.kcap.wings.*
+edu.isi.vista.*
+edu.iu.uits.*
+edu.iu.uits.lms.*
+edu.iu.ul.maven.plugins.*
+edu.jhu.agiga.*
+edu.jhu.hlt.*
+edu.jhu.hlt.optimize.*
+edu.jhu.pacaya-nlp.*
+edu.jhu.pacaya.*
+edu.jhu.prim.*
+edu.jhuapl.accumulo.*
+edu.jhuapl.dorset.*
+edu.jhuapl.dorset.agents.*
+edu.jhuapl.dorset.components.*
+edu.jhuapl.ses.*
+edu.jhuapl.tinkerpop.*
+edu.kit.datamanager.*
+edu.kit.ifv.mobitopp.*
+edu.kit.scc.*
+edu.ksu.canvas.*
+edu.ksu.ome.lti.*
+edu.mines.csci370.sjp.*
+edu.mines.jtk.*
+edu.minneapolis.*
+edu.mit.*
+edu.mit.findstruct.*
+edu.mit.ll.*
+edu.mit.simile.*
+edu.msudenver.cs.*
+edu.ndsu.eci.tapestry5-cayenne.*
+edu.neu.ccs.prl.meringue.*
+edu.nps.moves.*
+edu.nyu.*
+edu.pitt.dbmi.nlp.*
+edu.princeton.cs.*
+edu.princeton.cup.*
+edu.psu.cse.siis.*
+edu.psu.sagnik.research.*
+edu.psu.swe.commons.*
+edu.psu.swe.libraries.*
+edu.psu.swe.scim.*
+edu.purdue.cs.*
+edu.rice.ricechecks.*
+edu.rpi.tw.twks.*
+edu.rpi.twc.sesamestream.*
+edu.sc.seis.*
+edu.sc.seis.gradle.*
+edu.si.trippi.*
+edu.stanford.cs.dawn.*
+edu.stanford.ejalbert.*
+edu.stanford.futuredata.*
+edu.stanford.nlp.*
+edu.stanford.ppl.*
+edu.stanford.protege.*
+edu.stanford.swrl.*
+edu.teco.explorer.*
+edu.teco.smartlambda.*
+edu.ucar.*
+edu.ucar.ral.xml.*
+edu.uchicago.mpcs53013.*
+edu.uci.ics.*
+edu.uci.qa.*
+edu.ucla.cs.compilers.*
+edu.ucla.sspace.*
+edu.ucr.cs.bdlab.*
+edu.ucr.cs.riple.annotator.*
+edu.ucr.cs.riple.nullawayannotator.*
+edu.ucsf.valelab.tsf.*
+edu.uiowa.cs.clc.*
+edu.uiowa.icts.spring.*
+edu.uiowa.jopenmm.*
+edu.uiuc.ncsa.maven.skin.*
+edu.uiuc.ncsa.myproxy.*
+edu.uiuc.ncsa.qdl.*
+edu.uiuc.ncsa.qdl.skin.*
+edu.uiuc.ncsa.security.*
+edu.uiuc.ncsa.security.crypt8.skin.*
+edu.uiuc.ncsa.security.delegation.*
+edu.uiuc.ncsa.security.skin.*
+edu.umass.cs.*
+edu.umass.cs.benchlab.*
+edu.umass.cs.iesl.*
+edu.umd.*
+edu.umd.cs.mtc.*
+edu.umich.it.tl.*
+edu.umn.biomedicus.*
+edu.umn.cs.spatialhadoop.*
+edu.umn.minitex.pdf.*
+edu.umn.nlpie.*
+edu.unl.cse.efs.*
+edu.upc.dama.*
+edu.upc.essi.dtim.*
+edu.upc.essi.dtim.nextiajd.*
+edu.upenn.psych.memory.*
+edu.usc.ir.*
+edu.usf.cims.*
+edu.usf.cutr.*
+edu.usf.messageservice.*
+edu.utah.bmi.*
+edu.utah.bmi.blulab.*
+edu.utah.bmi.nlp.*
+edu.utah.bmi.pojava.*
+edu.utah.ece.async.sboldesigner.*
+edu.utdallas.hltri.*
+edu.utexas.tacc.*
+edu.utexas.tacc.tapis.*
+edu.uvm.ccts.*
+edu.uw.cs.lil.*
+edu.vanderbilt.accre.*
+edu.vanderbilt.isis.*
+edu.vt.middleware.*
+edu.vt.middleware.maven.plugins.*
+edu.washington.cs.dt.*
+edu.washington.cs.knowitall.*
+edu.washington.cs.knowitall.chunkedextractor.*
+edu.washington.cs.knowitall.clearnlp.*
+edu.washington.cs.knowitall.common-scala.*
+edu.washington.cs.knowitall.nlptools.*
+edu.washington.cs.knowitall.ollie.*
+edu.washington.cs.knowitall.openie.*
+edu.washington.cs.knowitall.srlie.*
+edu.washington.cs.knowitall.stanford-corenlp.*
+edu.washington.cs.knowitall.taggers.*
+edu.washington.cs.types.checker.*
+edu.washington.cs.types.jsr308.*
+edu.wgu.osmt.*
+edu.wgu.osmt.searchhub.*
+edu.wisc.library.ocfl.*
+edu.wisc.my.apps.*
+edu.wisc.my.portal.angular.*
+edu.wisc.my.restproxy.*
+edu.wisc.umark.*
+edu.wpi.rail.*
+education.x.*
+education.x.common.*
+ee.bitweb.*
+ee.carlrobert.*
+ee.datanor.httpclient.logger.*
+ee.datanor.spring.logger.*
+ee.datel.*
+ee.datel.dogis6.*
+ee.datel.xtee6.*
+ee.drewoko.*
+ee.getid.*
+ee.mn8.*
+ee.nx-01.tonclient.*
+ee.omnifish.*
+ee.originaal.maven.extensions.*
+ee.originaal.maven.plugins.*
+ee.quest.*
+ee.repl.*
+ee.ringit.extras.camunda.*
+ee.sk.digidoc.*
+ee.sk.mid.*
+ee.sk.smartid.*
+ee.telekom.workflow.*
+ehcache.*
+el-impl.*
+emberio.*
+emma.*
+energy.octopus.*
+engineer.echo.*
+engineer.echo.easyapi.*
+engineer.mathsoftware.jdesk.*
+engineer.nightowl.*
+engineering.bestquality.*
+engineering.dao.*
+engineering.everest.axon.*
+engineering.everest.starterkit.*
+engineering.exploratory.*
+enterprises.orbital.*
+enterprises.orbital.eve.esi.*
+enterprises.orbital.evekit.*
+enterprises.stardust.*
+ervacon.*
+es.3pies.*
+es.accenture.*
+es.apba.infra.esb.*
+es.apba.infra.esb.support.*
+es.arcadiaconsulting.appstorestats.*
+es.arcadiaconsulting.graylog2.*
+es.arcadiaconsulting.javapns.*
+es.arcasi.oss.*
+es.aspl.ronda.*
+es.atrujillo.mjml.*
+es.blackleg.*
+es.blackleg.java.*
+es.blackleg.java.testcontainers.*
+es.blackleg.nb.notifications.*
+es.bsc.*
+es.bsc.dataclay.*
+es.cenobit.struts2.json.*
+es.cenobit.vraptor.*
+es.codeurjc.*
+es.com.arisnegro.spring.*
+es.com.kete1987.*
+es.csic.iiia.bms.*
+es.danirod.*
+es.develex.*
+es.devera.maven.plugins.*
+es.e-ucm.asset.*
+es.e-ucm.maven.plugins.*
+es.e-ucm.tracker.*
+es.ehu.si.ixa.*
+es.eisig.*
+es.gob.afirma.*
+es.gob.afirma.jmulticard.*
+es.gob.afirma.lib.*
+es.indaba.*
+es.iti.commons.*
+es.iti.wakamiti.*
+es.jfml.*
+es.jlarriba.*
+es.jolivar.*
+es.joninx.*
+es.klicap.sonar.*
+es.litesolutions.*
+es.miyoda.*
+es.moki.ratelimitj.*
+es.molabs.*
+es.nimbox.*
+es.nimbox.box.*
+es.nitaur.*
+es.nitaur.bitbucket.*
+es.nitaur.markdown.*
+es.oneoctopus.swiperefreshlayoutoverlay.*
+es.optsicom.lib.*
+es.osoco.logging.*
+es.prodevelop.*
+es.ree.eemws.*
+es.rubenjgarcia.*
+es.sandbox.test.*
+es.sandbox.ui.messages.*
+es.tid.netphony.*
+es.ucm.fdi.gaia.*
+es.ucm.fdi.grasia.faerie.*
+es.ucm.fdi.grasia.faerie.archetypes.*
+es.ucm.fdi.grasia.faerie.demos.*
+es.ucm.fdi.grasia.faerie.examples.*
+es.uib.*
+es.uji.crypto.xades.*
+es.upm.dit.gsi.*
+es.upm.dit.gsi.shanks.*
+es.upm.etsisi.*
+es.upm.fi.oeg.*
+es.upv.comm.*
+es.upv.grycap.coreutils.*
+es.urbanoalvarez.*
+es.urjc.etsii.grafo.*
+es.us.isa.*
+es.us.isa.bpmn.*
+es.us.isa.ppinot.*
+es.usc.citius.common.*
+es.usc.citius.hipster.*
+es.uvigo.ei.sing.*
+es.webbeta.*
+es.weso.*
+esper.*
+eu.0io.*
+eu.adlogix.com.google.api.ads.dfp.*
+eu.agilejava.*
+eu.agno3.*
+eu.agno3.jcifs.*
+eu.agrosense.*
+eu.agrosense.api.*
+eu.agrosense.apps.*
+eu.agrosense.client.*
+eu.agrosense.server.*
+eu.agrosense.spi.*
+eu.akkamo.*
+eu.anmore.mvpdroid.*
+eu.antidotedb.*
+eu.appsatori.*
+eu.ardinsys.*
+eu.aronnax.maven.cloud.*
+eu.aronnax.smartconstraints.*
+eu.axeptio.*
+eu.aylett.*
+eu.aylett.prepackaged.*
+eu.aylett.versioncheck.*
+eu.balzo.auth-droid.*
+eu.bambooapps.*
+eu.basicairdata.*
+eu.benschroeder.*
+eu.binjr.*
+eu.bitfunk.gradle.plugin.development.*
+eu.bitfunk.gradle.plugin.development.convention.*
+eu.bitfunk.gradle.plugin.development.test.*
+eu.bitfunk.gradle.plugin.development.version.catalog.accessor.*
+eu.bitfunk.gradle.plugin.quality.*
+eu.bitfunk.gradle.plugin.quality.code.analysis.*
+eu.bitfunk.gradle.plugin.quality.formatter.*
+eu.bitfunk.gradle.plugin.quality.report.*
+eu.bitfunk.gradle.plugin.tool.*
+eu.bitfunk.gradle.plugin.tool.composite.delegator.*
+eu.bitfunk.gradle.plugin.tool.gitversion.*
+eu.bitfunk.gradle.plugin.tool.versioning.*
+eu.bittrade.libs.*
+eu.bitwalker.*
+eu.bolt.*
+eu.borglum.functional.*
+eu.cdevreeze.confused-scala.*
+eu.cdevreeze.coursier-extra.*
+eu.cdevreeze.springjdbc.*
+eu.cdevreeze.springtx.*
+eu.cdevreeze.tqa.*
+eu.cdevreeze.tqa2.*
+eu.cdevreeze.us-election.*
+eu.cdevreeze.xbrl.formula.*
+eu.cdevreeze.xpathparser.*
+eu.cdevreeze.yaidom.*
+eu.cdevreeze.yaidom2.*
+eu.cdevreeze.yaidombridge.*
+eu.cedarsoft.*
+eu.cedarsoft.commons.*
+eu.cedarsoft.devtools.*
+eu.cedarsoft.utils.*
+eu.cedarsoft.utils.history.*
+eu.cedarsoft.wicket.*
+eu.chargetime.ocpp.*
+eu.ciechanowiec.*
+eu.clarin.switchboard.*
+eu.clarin.weblicht.*
+eu.clarussecure.*
+eu.cloudnetservice.cloudnet.*
+eu.codearte.catch-exception.*
+eu.codearte.duramen.*
+eu.codearte.resteeth.*
+eu.coding-commune.*
+eu.codlab.*
+eu.codlab.moko.*
+eu.coldrye.junit.*
+eu.compass-com.*
+eu.connective.*
+eu.copernik.*
+eu.crydee.*
+eu.crydee.uima.opennlp.*
+eu.crydee.uima.opennlp.resources.*
+eu.crydee.wikipedia.*
+eu.cyber-geiger.*
+eu.danieldk.dictomaton.*
+eu.danieldk.leveldb.*
+eu.danieldk.nlp.*
+eu.danieldk.nlp.jitar.*
+eu.danieldk.quzah.*
+eu.daproject.evl.*
+eu.dariolucia.ccsds.*
+eu.databata.*
+eu.dattri.*
+eu.de-swaef.pdf.*
+eu.de4a.*
+eu.de4a.ial.*
+eu.descry.*
+eu.dicode-project.*
+eu.digitisation.*
+eu.digitisation.utils.*
+eu.dindoffer.*
+eu.doppel-helix.jna.tlbcodegenerator.*
+eu.doppel-helix.netbeans.lib.*
+eu.doppel-helix.netbeans.lib.tm4e.*
+eu.doppel-helix.netbeans.plugin.mantis-integration.*
+eu.doppel-helix.netbeans.plugin.nb-ldap-explorer.*
+eu.doppel-helix.netbeans.plugin.plantuml-nb.*
+eu.dozd.*
+eu.easypush.*
+eu.easyrpa.*
+eu.elbkind.*
+eu.erasmuswithoutpaper.*
+eu.essilab.*
+eu.eu-emi.*
+eu.eu-emi.security.*
+eu.eureka-bpo.primefaces.*
+eu.europa.ec.eurostat.*
+eu.europa.ec.grow.espd.*
+eu.europa.ec.itb.*
+eu.europa.ec.joinup.sat.*
+eu.europa.ec.joinup.sd-dss.*
+eu.europa.ted.eforms.*
+eu.european-language-grid.*
+eu.europeanstudentcard.*
+eu.eventstorm.*
+eu.evops.maven.plugins.*
+eu.fakod.*
+eu.farsil.shelf.*
+eu.fbk.dh.*
+eu.fbk.dkm.*
+eu.fbk.dkm.eso.*
+eu.fbk.dkm.utils.*
+eu.fbk.fcw.*
+eu.fbk.knowledgestore.*
+eu.fbk.parent.*
+eu.fbk.pikes.*
+eu.fbk.rdfpro.*
+eu.fbk.twm.*
+eu.fbk.utils.*
+eu.fispace.*
+eu.flatwhite.*
+eu.flierl.*
+eu.fraho.libs.*
+eu.fraho.spring.*
+eu.franzoni.*
+eu.freme-project.*
+eu.freme-project.bservices.*
+eu.freme-project.bservices.controllers.*
+eu.freme-project.bservices.filters.*
+eu.freme-project.e-services.*
+eu.freme-project.examples.*
+eu.freme-project.packages.*
+eu.fthevenet.*
+eu.fusepool.p3.*
+eu.fusepool.p3.ext.de.fuberlin.wiwiss.silk.*
+eu.fusepool.p3.stanbol-engines-fise2fam.*
+eu.future-earth.*
+eu.future-earth.gwt.*
+eu.galjente.*
+eu.geekplace.*
+eu.geekplace.iesp.*
+eu.geekplace.javapinning.*
+eu.genome.android.*
+eu.getintheloop.*
+eu.ginere.*
+eu.glasp.*
+eu.gsottbauer.*
+eu.hanskruse.*
+eu.hansolo.*
+eu.hansolo.enzo.*
+eu.hansolo.fx.*
+eu.hansolo.fx.charts.*
+eu.hansolo.fx.regulators.*
+eu.hassels.*
+eu.headcrashing.treasure-chest.*
+eu.henkelmann.*
+eu.hexagonmc.*
+eu.hgross.*
+eu.hinsch.*
+eu.hlavki.netbeans.*
+eu.hlavki.text.*
+eu.hoefel.*
+eu.hurion.vaadin.heroku.*
+eu.iamgio.*
+eu.ibagroup.*
+eu.icole.*
+eu.icolumbo.breeze.*
+eu.icolumbo.cinch.*
+eu.ill.*
+eu.imind.play.*
+eu.infomas.*
+eu.inloop.*
+eu.inmite.android.lib.*
+eu.inn.*
+eu.interedition.*
+eu.ioservices.*
+eu.irzinfante.*
+eu.javaspecialists.books.dynamicproxies.*
+eu.jmsanchez.*
+eu.joaocosta.*
+eu.jonahbauer.*
+eu.jrie.jetbrains.*
+eu.jsan.*
+eu.kartoffelquadrat.*
+eu.kevin.*
+eu.kevin.android.*
+eu.kk42.*
+eu.kmap.*
+eu.kratochvil.*
+eu.kratochvil.perfmon.*
+eu.l-space.*
+eu.larkc.csparql.*
+eu.lepicekmichal.signalrkore.*
+eu.lestard.*
+eu.lestard.redux-javafx-devtool.*
+eu.lilithmonodia.*
+eu.limetri.api.*
+eu.limetri.client.*
+eu.limetri.client.lib.*
+eu.limetri.platform.*
+eu.limetri.ygg.*
+eu.lindenbaum.*
+eu.locklogin.*
+eu.lp0.slf4j.*
+eu.lucaventuri.*
+eu.lundegaard.commons.*
+eu.lundegaard.commons.java.*
+eu.lundegaard.java.*
+eu.lundegaard.liferay.*
+eu.lundegaard.maven.*
+eu.lunisolar.*
+eu.lunisolar.magma.*
+eu.m6r.*
+eu.mais-h.mathsync.*
+eu.malanik.*
+eu.markov.kotlin.lucidtime.*
+eu.matfx.*
+eu.matthiasbraun.*
+eu.maveniverse.maven.mima.*
+eu.maveniverse.maven.mima.runtime.*
+eu.maveniverse.maven.parent.*
+eu.maxschuster.*
+eu.medsea.mimeutil.*
+eu.mia-platform.*
+eu.micer.*
+eu.michael-simons.*
+eu.michael-simons.neo4j.*
+eu.mihosoft.ai.astar.*
+eu.mihosoft.appx.appx.*
+eu.mihosoft.appx.vappx.*
+eu.mihosoft.asyncutils.*
+eu.mihosoft.binarytypeutils.*
+eu.mihosoft.devcom.*
+eu.mihosoft.ext.apted.*
+eu.mihosoft.ext.j3d.*
+eu.mihosoft.ext.org.fxyz.*
+eu.mihosoft.ext.velocity.legacy.*
+eu.mihosoft.freerouting.*
+eu.mihosoft.jcapture.*
+eu.mihosoft.jcompiler.*
+eu.mihosoft.jcsg.ext.mesh.*
+eu.mihosoft.jcsg.ext.path.*
+eu.mihosoft.jfx.scaledfx.*
+eu.mihosoft.monacofx.*
+eu.mihosoft.nativefx.*
+eu.mihosoft.streamutils.*
+eu.mihosoft.tcc.tccdist.*
+eu.mihosoft.ugshell.ugdist.*
+eu.mihosoft.ugshell.vugshell.*
+eu.mihosoft.vcollections.*
+eu.mihosoft.vcsg.*
+eu.mihosoft.vcsg.vcsgdist.*
+eu.mihosoft.visoline.*
+eu.mihosoft.vmf.*
+eu.mihosoft.vrl.*
+eu.mihosoft.vrl.densityvis.*
+eu.mihosoft.vrl.jcsg.*
+eu.mihosoft.vrl.jcsg.vplugin.*
+eu.mihosoft.vrl.vcsg.vplugin.*
+eu.mihosoft.vrl.vrljogl.*
+eu.mihosoft.vrl.workflow.*
+eu.mihosoft.vsm.*
+eu.mihosoft.vswc.*
+eu.mihosoft.vtcc.*
+eu.mihosoft.vtcc.tccdist.*
+eu.mihosoft.vvecmath.*
+eu.miltema.*
+eu.miman.android.util.*
+eu.miman.comm.arduino.*
+eu.miman.forge.plugin.util.*
+eu.miman.util.to.*
+eu.mindfusion.*
+eu.monniot.*
+eu.morphus.*
+eu.mulk.jgvariant.*
+eu.mulk.quarkus-googlecloud-jsonlogging.*
+eu.neilalexander.*
+eu.nets.mia.*
+eu.nets.oss.jetty.*
+eu.nets.oss.maven.*
+eu.nets.pia.*
+eu.noleaks.*
+eu.numberfour.maven.plugins.*
+eu.nyerel.dolphin.*
+eu.ocathain.com.sun.mail.*
+eu.ocathain.javax.activation.*
+eu.omisoft.micro.*
+eu.openaire.*
+eu.openminted.*
+eu.openminted.share.annotations.*
+eu.openminted.uc.socialsciences.*
+eu.optique-project.*
+eu.ostrzyciel.jelly.*
+eu.over9000.*
+eu.palaio.*
+eu.palaio.pddl.*
+eu.payzen.*
+eu.payzen.sdk.*
+eu.piotrbuda.*
+eu.piotro.*
+eu.plib.*
+eu.plumbr.*
+eu.portcdm.*
+eu.printingin3d.javascad.*
+eu.printingin3d.simplephysics.*
+eu.printingin3d.smalogger.*
+eu.prismacapacity.*
+eu.qanswer.*
+eu.qualityontime.commons.*
+eu.ralph-schuster.*
+eu.rekawek.coffeegb.*
+eu.rekawek.toxiproxy.*
+eu.rekisoft.android.*
+eu.rekisoft.android.util.*
+eu.rssw.openedge.checks.*
+eu.rssw.openedge.parsers.*
+eu.rssw.openedge.rcode.*
+eu.rssw.pct.*
+eu.rssw.sonar.openedge.*
+eu.scape-project.bitwiser.*
+eu.scape-project.nanite.*
+eu.scasefp7.*
+eu.scasefp7.eclipse.*
+eu.schnuckelig.gradle.*
+eu.seaclouds-project.*
+eu.seaclouds-project.monitor.*
+eu.sec-cert.*
+eu.securibox.*
+eu.seitzal.*
+eu.shiftforward.*
+eu.sim642.shy.*
+eu.simonbinder.*
+eu.sipria.inject.akka.*
+eu.sipria.play.*
+eu.sirenia.seacow.client.*
+eu.sirotin.kotunil.*
+eu.smesec.library.*
+eu.smesec.platform.*
+eu.socialsensor.*
+eu.softisland.android.*
+eu.somatik.serviceloader-maven-plugin.*
+eu.stamp-project.*
+eu.stderr.shibboleth.*
+eu.stratosphere.*
+eu.tailoringexpert.*
+eu.tarienna.*
+eu.tekul.*
+eu.the4thfloor.mockwebserver.*
+eu.the4thfloor.volley.*
+eu.throup.*
+eu.timepit.*
+eu.timerertim.knevo.*
+eu.toennies.*
+eu.toolchain.async.*
+eu.toolchain.condo.*
+eu.toolchain.ffwd.*
+eu.toolchain.microrpc.*
+eu.toolchain.ogt.*
+eu.toolchain.rs.*
+eu.toolchain.scribe.*
+eu.toolchain.serializer.*
+eu.toop.*
+eu.tortitas.jenu.*
+eu.tortitas.utils.*
+eu.trentorise.opendata.*
+eu.trentorise.opendata.commons.*
+eu.trentorise.opendata.josman.*
+eu.trentorise.opendata.semtext.*
+eu.tripled-framework.*
+eu.trisquare.*
+eu.unicore.*
+eu.unicore.security.*
+eu.unicredit.*
+eu.vaadinonkotlin.*
+eu.vahlas.smef.*
+eu.vendeli.*
+eu.verdelhan.*
+eu.vitaliy.*
+eu.vlaurin.hamcrest.*
+eu.vytenis.hamcrest.*
+eu.vytenis.skaitvardziai.*
+eu.wdaqua.*
+eu.webtoolkit.*
+eu.wiegandt.nicklas.*
+eu.woolplatform.*
+eu.wuttke.*
+eu.xeli.*
+eu.xenit.*
+eu.xenit.alfred.*
+eu.xenit.alfred.telemetry.*
+eu.xenit.alfresco-actuators.*
+eu.xenit.alfresco-remote-testrunner.*
+eu.xenit.alfresco.*
+eu.xenit.alfresco.client.*
+eu.xenit.apix.*
+eu.xenit.care4alf.*
+eu.xenit.contentcloud.*
+eu.xenit.contentcloud.abac.*
+eu.xenit.contentcloud.bard.*
+eu.xenit.contentcloud.thunx.*
+eu.xenit.de.*
+eu.xenit.logging.*
+eu.xenit.restrequests.*
+eu.xenit.solr-actuators.*
+eu.xenit.solr-backup.*
+eu.xenit.testing.ditto.*
+eu.xenit.testing.integration-testing.*
+eu.xenit.transformers.*
+eu.zacheusz.jolt.*
+eu.zacheusz.sling.alexa.*
+eu.zirrus.*
+eus.ixa.*
+events.dewdrop.*
+excalibur-altrmi.*
+excalibur-cli.*
+excalibur-collections.*
+excalibur-component-examples.*
+excalibur-component-tests.*
+excalibur-component.*
+excalibur-concurrent.*
+excalibur-configuration.*
+excalibur-containerkit.*
+excalibur-datasource.*
+excalibur-event.*
+excalibur-extension.*
+excalibur-fortress.*
+excalibur-i18n.*
+excalibur-instrument-manager-interfaces.*
+excalibur-instrument-manager.*
+excalibur-instrument.*
+excalibur-io.*
+excalibur-lifecycle.*
+excalibur-logger.*
+excalibur-monitor.*
+excalibur-mpool.*
+excalibur-naming.*
+excalibur-pool.*
+excalibur-sourceresolve.*
+excalibur-store.*
+excalibur-thread.*
+excalibur-util.*
+excalibur-xmlutil.*
+excalibur.*
+exchange.core2.*
+exist.*
+exml.*
+exo.*
+exolabcore.*
+expert.os.integration.*
+exteca.*
+external.atlassian.jgitflow.*
+external.atlassian.json.*
+family.amma.*
+family.amma.deeplinks.*
+fan.mop.*
+fans.java.*
+farm.shangrila.*
+fastutil.*
+fesi.*
+fi.aalto.cs.drumbeat.*
+fi.e257.*
+fi.e257.testing.*
+fi.evident.apina.*
+fi.evident.cissa.*
+fi.evident.dalesbred.*
+fi.evident.elasticsearch.*
+fi.evident.enlight.*
+fi.evident.gradle.beanstalk.*
+fi.evident.lokki.*
+fi.evident.raudikko.*
+fi.foyt.coops.*
+fi.foyt.fni.*
+fi.foyt.paytrail.*
+fi.gekkio.drumfish.*
+fi.gekkio.roboticchameleon.*
+fi.helsinki.cs.nodes.*
+fi.hoski.*
+fi.iki.yak.*
+fi.ishtech.core.*
+fi.ishtech.utils.*
+fi.ishtech.validation.*
+fi.jpalomaki.markdown.*
+fi.jpalomaki.ssh.*
+fi.jubic.*
+fi.jumi.*
+fi.jumi.actors.*
+fi.kapsi.killnine.*
+fi.linuxbox.gradle.*
+fi.linuxbox.slacklog.*
+fi.linuxbox.upcloud.*
+fi.luontola.buildtest.*
+fi.metatavu.acg-bridge.*
+fi.metatavu.beer.*
+fi.metatavu.dcfb.*
+fi.metatavu.edelphi.*
+fi.metatavu.enfuser-ngsi.*
+fi.metatavu.famifarm.*
+fi.metatavu.famifarm.client.*
+fi.metatavu.feign.*
+fi.metatavu.finvoice.*
+fi.metatavu.itextpdfboxrenderer.*
+fi.metatavu.jaxrs.testbuilder.*
+fi.metatavu.jouko.*
+fi.metatavu.keycloak.*
+fi.metatavu.kunta-api-management.*
+fi.metatavu.kunta-api.*
+fi.metatavu.kykyapi.*
+fi.metatavu.linkedevents.*
+fi.metatavu.mecm.reader.*
+fi.metatavu.meta-acg-bridge.*
+fi.metatavu.metaflow.*
+fi.metatavu.metaform.*
+fi.metatavu.metamind.*
+fi.metatavu.metamind.client.*
+fi.metatavu.mikkelinyt.mikkelinyt-rest-model.*
+fi.metatavu.oioi.cm.*
+fi.metatavu.oioi.cm.client.*
+fi.metatavu.paytrail.*
+fi.metatavu.pdftiler.*
+fi.metatavu.polyglot.*
+fi.metatavu.ptv.rest-client.*
+fi.metatavu.restful-ptv.*
+fi.metatavu.restful-ptv.restful-ptv-rest-client.*
+fi.metatavu.soteapi.*
+fi.metatavu.tulistop.*
+fi.metatavu.tulistop.client.*
+fi.metatavu.wso2.csv-datasource.*
+fi.metatavu.wso2.dbquery.*
+fi.metatavu.wso2.ftp.*
+fi.metatavu.wso2.keycloak.*
+fi.metatavu.wso2.liquibase.*
+fi.nationallibrary.*
+fi.otavanopisto.casem.casem-rest-client.*
+fi.otavanopisto.kunta-api.*
+fi.otavanopisto.mikkelinyt.mikkelinyt-rest-model.*
+fi.otavanopisto.mwp.mwp-rest-client.*
+fi.otavanopisto.ptv.rest-client.*
+fi.otavanopisto.restful-ptv.*
+fi.otavanopisto.restful-ptv.restful-ptv-rest-client.*
+fi.pelam.*
+fi.protonode.*
+fi.pyppe.*
+fi.ratamaa.*
+fi.reaktor.*
+fi.seco.*
+fi.sn127.*
+fi.solita.clamav.*
+fi.solita.datatree.*
+fi.solita.json-migraine.*
+fi.testee.*
+fi.villepeurala.*
+fi.vincit.*
+fi.vtt.nubomedia.*
+fi.vtt.nubomedia.armodule.*
+fi.vtt.nubomedia.kurento.*
+fi.vtt.nubomedia.msdata.*
+film.interactive.platform.*
+finance.tradista.flow.*
+financial.atomic.*
+findbugs.*
+fish.charles.cdk-constructs.*
+fish.focus.maven.*
+fish.focus.uvms.*
+fish.focus.uvms.activity.*
+fish.focus.uvms.asset.*
+fish.focus.uvms.audit.*
+fish.focus.uvms.commons.*
+fish.focus.uvms.config.*
+fish.focus.uvms.docker.*
+fish.focus.uvms.exchange.*
+fish.focus.uvms.geoserver.web.overlay.*
+fish.focus.uvms.incident.*
+fish.focus.uvms.lib.*
+fish.focus.uvms.maven.*
+fish.focus.uvms.movement-rules.*
+fish.focus.uvms.movement.*
+fish.focus.uvms.plugins.ais.*
+fish.focus.uvms.plugins.flux.movement.*
+fish.focus.uvms.plugins.inmarsat.*
+fish.focus.uvms.plugins.iridium.*
+fish.focus.uvms.plugins.naf.*
+fish.focus.uvms.plugins.rest.movement.*
+fish.focus.uvms.plugins.sweagency.*
+fish.focus.uvms.reporting.*
+fish.focus.uvms.spatial.*
+fish.focus.uvms.user.*
+fish.focus.uvms.usm.*
+fish.focus.uvms.web-gateway.*
+fish.payara.advisor.*
+fish.payara.api.*
+fish.payara.arquillian.*
+fish.payara.blue.distributions.*
+fish.payara.blue.extras.*
+fish.payara.cloud.connectors.*
+fish.payara.cloud.connectors.amazonsqs.*
+fish.payara.cloud.connectors.azuresb.*
+fish.payara.cloud.connectors.kafka.*
+fish.payara.cloud.connectors.mqtt.*
+fish.payara.distributions.*
+fish.payara.ecosystem.*
+fish.payara.ecosystem.jaxrs.*
+fish.payara.examples.mqtt.*
+fish.payara.extras.*
+fish.payara.maven.archetypes.*
+fish.payara.maven.extensions.*
+fish.payara.maven.plugins.*
+fish.payara.monitoring-console.*
+fish.payara.security.connectors.*
+fish.payara.server.appclient.*
+fish.payara.transformer.*
+fit.chis.cloud.*
+fit.wenchao.*
+flox.*
+flux.*
+fm.audiobox.*
+fm.backtracks.*
+fm.bullhorn.*
+fm.feed.android.*
+fm.finch.*
+fm.jiecao.*
+fm.last.*
+fm.last.commons.*
+fm.last.commons.hive.serde.*
+fm.liu.*
+fm.pattern.*
+fm.void.jetm.*
+fo.nya.*
+fop.*
+forehead.*
+formproc.*
+foundation.cmo.service.*
+foundation.fluent.api.*
+foundation.icon.*
+foundation.klaytn.*
+foundation.metaplex.*
+foundation.stack.*
+foundation.stack.datamill.*
+foxtrot.*
+foxtrot.foxtrot.*
+fr.abes.api-communes.*
+fr.abes.sudoqual.*
+fr.acinq.*
+fr.acinq.acinq-tools.*
+fr.acinq.bitcoin.*
+fr.acinq.lightning.*
+fr.acinq.secp256k1.*
+fr.acinq.tor.*
+fr.adbonnin.cz2128.*
+fr.alecharp.maven.plugins.*
+fr.alexpado.*
+fr.algofi.maven.plugins.*
+fr.apiscol.metadata.*
+fr.applicius.*
+fr.apyx.*
+fr.arakne.*
+fr.arpinum.*
+fr.askjadev.xml.extfunctions.*
+fr.assoba.open.*
+fr.avianey.*
+fr.avianey.androidsvgdrawable.*
+fr.avianey.apache-xmlgraphics.*
+fr.avianey.com.viewpagerindicator.*
+fr.avianey.modjo.*
+fr.avianey.mojo.*
+fr.baloomba.*
+fr.bigray.*
+fr.blueberry-studio.hermes.*
+fr.bmartel.*
+fr.bouyguestelecom.dev.*
+fr.braindead.*
+fr.braindot.*
+fr.brouillard.oss.*
+fr.brouillard.oss.com.github.petitparser.*
+fr.brouillard.oss.jee.*
+fr.brouillard.oss.security.jaas.*
+fr.brouillard.oss.security.xhub.*
+fr.cenotelie.commons.*
+fr.cenotelie.commons.eclipse.*
+fr.cenotelie.hime.*
+fr.cloverconsulting.*
+fr.cnes.sirius.patrius.*
+fr.cnieg.demo.*
+fr.cnieg.keycloak.*
+fr.com.hp.hpl.jena.rdf.arp.*
+fr.cril.*
+fr.cril.cli.*
+fr.d2-si.*
+fr.davit.*
+fr.delthas.*
+fr.dev-mind.*
+fr.diskmth.*
+fr.dralagen.*
+fr.dudie.*
+fr.dvilleneuve.android.*
+fr.dysp.*
+fr.erias.*
+fr.erictruong.*
+fr.everwin.open.api.*
+fr.evidev.netbeans.modules.*
+fr.exanpe.*
+fr.fabienperie.open-as2.*
+fr.fastconnect.factory.tibco.*
+fr.fastconnect.factory.tibco.bw.maven.*
+fr.fastconnect.jaxb.com.tibco.bw.schemas.*
+fr.faylixe.*
+fr.fezlight.*
+fr.figarocms.*
+fr.figarocms.flume.*
+fr.flowarg.*
+fr.flymenu.*
+fr.foop.parsers.*
+fr.foop.ws.*
+fr.funixgaming.api.*
+fr.funixgaming.api.client.*
+fr.funixgaming.api.core.*
+fr.funixgaming.api.core.client.*
+fr.funixgaming.api.core.service.*
+fr.funixgaming.api.core.test.*
+fr.funixgaming.api.funixbot.*
+fr.funixgaming.api.funixbot.client.*
+fr.funixgaming.api.funixbot.service.*
+fr.funixgaming.api.server.*
+fr.funixgaming.api.twitch.*
+fr.funixgaming.api.twitch.client.*
+fr.funixgaming.api.twitch.service.*
+fr.funixgaming.funixbot.*
+fr.funixgaming.funixbot.core.*
+fr.funixgaming.funixbot.discord.*
+fr.funixgaming.funixbot.twitch.*
+fr.funixgaming.twitch.api.*
+fr.fxjavadevblog.*
+fr.ggaly.*
+fr.ght1pc9kc.*
+fr.greweb.*
+fr.groupbees.*
+fr.gugau.lfr.tools.*
+fr.haan.bipak.*
+fr.haan.resultat.*
+fr.hammons.*
+fr.hbis.maven.plugins.*
+fr.hhdev.*
+fr.hmil.*
+fr.ifpen.allotropeconverters.*
+fr.ifremer.*
+fr.ifremer.congo.*
+fr.ina.research.*
+fr.inrae.toulouse.metexplore.*
+fr.inria.atlanmod.commons.*
+fr.inria.atlanmod.neoemf.*
+fr.inria.corese.*
+fr.inria.corese.org.semarglproject.*
+fr.inria.eventcloud.*
+fr.inria.gforge.spirals.*
+fr.inria.gforge.spoon.*
+fr.inria.gforge.spoon.labs.*
+fr.inria.gforge.spoon.spoon-jdiet.*
+fr.inria.jfilter.*
+fr.inria.jtravis.*
+fr.inria.lille.shexjava.*
+fr.inria.minibus.*
+fr.inria.potioc.*
+fr.inria.powerapi.*
+fr.inria.powerapi.example.*
+fr.inria.powerapi.example.adamdemo.*
+fr.inria.powerapi.formula.*
+fr.inria.powerapi.listener.*
+fr.inria.powerapi.processor.*
+fr.inria.powerapi.reporter.*
+fr.inria.powerapi.sensor.*
+fr.inria.powerspy.*
+fr.inria.repairnator.*
+fr.inria.wimmics.*
+fr.insee.eno.*
+fr.insee.lunatic.*
+fr.insee.pogues.*
+fr.insee.trevas.*
+fr.inzh.lang.*
+fr.ippon.*
+fr.ippon.spark.metrics.*
+fr.ird.*
+fr.ird.maven.*
+fr.ird.ob7.*
+fr.ird.observe.*
+fr.ird.observe.toolkit.*
+fr.ird.t3.*
+fr.irit.ics.*
+fr.irit.melodi.semantic-web.*
+fr.irit.smac.*
+fr.irit.smac.lib.contrib.*
+fr.irit.smac.lib.may.*
+fr.irit.smac.may.*
+fr.irit.smac.thirdparty.edu.gmu.cs.*
+fr.irit.smac.thirdparty.ivy.*
+fr.irit.smac.thirdparty.net.sf.rlforj.*
+fr.irun.*
+fr.iscpif.*
+fr.iscpif.effectaside.*
+fr.iscpif.freedsl.*
+fr.iscpif.gridscale.*
+fr.iscpif.gridscale.bundle.*
+fr.iscpif.jglobus.*
+fr.iscpif.scaladget.*
+fr.iscpif.viabilitree.*
+fr.isee-u.safer.*
+fr.it4pme.*
+fr.janalyse.*
+fr.javacrea.*
+fr.javafreelance.fluentlenium.*
+fr.javatic.gradle.*
+fr.javatronic.damapping.*
+fr.jcgay.*
+fr.jcgay.log4j.*
+fr.jcgay.maven.*
+fr.jcgay.maven.color.*
+fr.jcgay.maven.extension.*
+fr.jcgay.maven.plugins.*
+fr.jcgay.send-notification.*
+fr.jcgay.server-notifier.*
+fr.jcgay.snp4j.*
+fr.jetoile.hadoop.*
+fr.jmini.asciidoctorj.*
+fr.jmini.htmlchecker.*
+fr.jmini.utils.*
+fr.jrds.*
+fr.juanwolf.*
+fr.jvsonline.jvsmairistemcli.*
+fr.landel.*
+fr.landel.utils.*
+fr.lehtto.maven.plugins.*
+fr.lenra.gradle.*
+fr.lenra.gradle.language-plugin.*
+fr.liglab.jlcm.*
+fr.lip6.pnml.*
+fr.lirmm.advanse.*
+fr.lirmm.fca4j.*
+fr.lirmm.graphik.*
+fr.lirmm.yamplusplus.*
+fr.lixbox.lixbox-cache.*
+fr.lixbox.lixbox-common.*
+fr.lixbox.lixbox-ged.*
+fr.lixbox.lixbox-io.*
+fr.lixbox.lixbox-orm.*
+fr.lixbox.lixbox-param.*
+fr.lixbox.lixbox-registry.*
+fr.lixbox.lixbox-security.*
+fr.lixbox.lixbox-service.*
+fr.lixbox.lixbox-test.*
+fr.lixbox.lixbox-ui.*
+fr.lixbox.plugins.*
+fr.lixbox.service.*
+fr.loghub.*
+fr.loicknuchel.*
+fr.loof.fonzie.*
+fr.loof.logeek.*
+fr.lteconsulting.*
+fr.lteconsulting.archetypes.*
+fr.lteconsulting.formations.*
+fr.lunatech.*
+fr.maif.*
+fr.manastria.*
+fr.marcwrobel.*
+fr.mastah.*
+fr.mastah.maven.plugin.*
+fr.mastah.maven.plugin.m2e.jsdoc3.*
+fr.masterdocs.*
+fr.matthieu-vergne.*
+fr.mazerty.*
+fr.menana.*
+fr.mines-stetienne.ci.sparql-generate.*
+fr.minuskube.*
+fr.minuskube.inv.*
+fr.mmarie.*
+fr.monbanquet.*
+fr.mougnibas.base-maven.*
+fr.mrmicky.*
+fr.myprysm.vertx.*
+fr.nargit.rating.*
+fr.nathan818.maven.plugins.*
+fr.natsystem.*
+fr.natsystem.natjet.*
+fr.nelaupe.*
+fr.neolegal.*
+fr.nicolaspomepuy.*
+fr.nicolaspomepuy.androidwearcrashreport.*
+fr.njin.*
+fr.noop.*
+fr.norad.bootstrap.*
+fr.norad.core.*
+fr.norad.jaxrs.client.server.*
+fr.norad.jaxrs.doc.*
+fr.norad.jaxrs.oauth2.*
+fr.norad.jmxzabbix.*
+fr.norad.logback.prettier.*
+fr.norad.operating.system.specific.*
+fr.norad.parent.*
+fr.norad.servlet.sample.html.template.*
+fr.norad.typed.command.line.parser.*
+fr.norad.updater.*
+fr.norad.visuwall.*
+fr.norad.visuwall.providers.*
+fr.norsys.asoape.*
+fr.norsys.asoape.it.*
+fr.ojs-creation.*
+fr.onepoint.*
+fr.opensagres.*
+fr.opensagres.js.*
+fr.opensagres.mapreduce.webbrowser.*
+fr.opensagres.maven.plugin.*
+fr.opensagres.maven.plugins.*
+fr.opensagres.mongodb.*
+fr.opensagres.xdocreport.*
+fr.opensagres.xdocreport.appengine-awt.*
+fr.opensagres.xdocreport.itext-gae.*
+fr.opensagres.xdocreport.sfntly.*
+fr.openwide.nuxeo.commons.*
+fr.pacifista.api.*
+fr.pacifista.api.client.*
+fr.pacifista.api.core.*
+fr.pacifista.api.core.client.*
+fr.pacifista.api.core.service.*
+fr.pacifista.api.core.tests.*
+fr.pacifista.api.server.*
+fr.pacifista.api.server.box.*
+fr.pacifista.api.server.box.client.*
+fr.pacifista.api.server.box.service.*
+fr.pacifista.api.server.guilds.*
+fr.pacifista.api.server.guilds.client.*
+fr.pacifista.api.server.guilds.service.*
+fr.pacifista.api.server.permissions.*
+fr.pacifista.api.server.permissions.client.*
+fr.pacifista.api.server.permissions.service.*
+fr.pacifista.api.server.players.*
+fr.pacifista.api.server.players.sync.*
+fr.pacifista.api.server.players.sync.client.*
+fr.pacifista.api.server.players.sync.service.*
+fr.pacifista.api.server.sanctions.*
+fr.pacifista.api.server.sanctions.client.*
+fr.pacifista.api.server.sanctions.service.*
+fr.pacifista.api.server.warps.*
+fr.pacifista.api.server.warps.client.*
+fr.pacifista.api.server.warps.service.*
+fr.pacifista.api.service.*
+fr.pacifista.api.support.*
+fr.pacifista.api.support.tickets.*
+fr.pacifista.api.support.tickets.client.*
+fr.pacifista.api.support.tickets.service.*
+fr.pacifista.api.web.*
+fr.pacifista.api.web.news.*
+fr.pacifista.api.web.news.client.*
+fr.pacifista.api.web.news.service.*
+fr.pacifista.api.web.shop.*
+fr.pacifista.api.web.shop.client.*
+fr.pacifista.api.web.shop.service.*
+fr.pc-scol.printer.*
+fr.perigee.*
+fr.pierrickcaen.*
+fr.pilato.elasticsearch.*
+fr.pilato.elasticsearch.crawler.*
+fr.pilato.elasticsearch.injector.*
+fr.pilato.elasticsearch.river.*
+fr.pilato.elasticsearch.testcontainers.*
+fr.pilato.spring.*
+fr.pinguet62.*
+fr.pinguet62.xjc.*
+fr.polyconseil.smartcity.*
+fr.psug.avro.*
+fr.psug.kafka.*
+fr.pulsedev.*
+fr.putnami.gwt.*
+fr.putnami.pwt.*
+fr.quatrevieux.*
+fr.raluy.simplespreadsheet.*
+fr.ramiro.*
+fr.redfroggy.*
+fr.redfroggy.test.bdd.*
+fr.renardfute.*
+fr.rhaz.*
+fr.rhodless.akira.*
+fr.rolandl.*
+fr.rtone.*
+fr.sagix.*
+fr.sertelon.akr.*
+fr.sertelon.fp.*
+fr.sertelon.media.*
+fr.sertelon.spring.*
+fr.sewatech.mqttra.*
+fr.sewatech.oss.*
+fr.sewatech.utils.*
+fr.shingle.*
+fr.sii.ogham.*
+fr.sii.ogham.internal.*
+fr.sii.sonar.*
+fr.smallcrew.foundation.*
+fr.smarquis.sealed.*
+fr.spacefox.*
+fr.speekha.httpmocker.*
+fr.stardustenterprises.*
+fr.teamjoin.*
+fr.techad.*
+fr.theorozier.*
+fr.thomasdufour.*
+fr.turri.*
+fr.tvbarthel.blurdialogfragment.*
+fr.tvbarthel.cheerleader.*
+fr.tvbarthel.intentshare.*
+fr.uha.ensisa.ff.*
+fr.ujm.tse.lt2c.satin.*
+fr.umr-lastig.*
+fr.univ-lille.cristal.*
+fr.univ-nantes.julestar.*
+fr.univ-nantes.termsuite.*
+fr.univ-smb.listic.dbsf.*
+fr.univ-valenciennes.*
+fr.valentin-henry.*
+fr.varchar-dev.*
+fr.vekia.tools.*
+fr.velossity.osgi.*
+fr.vidal.oss.*
+fr.vsct.dt.*
+fr.vsct.tock.*
+fr.w3blog.*
+fr.whimtrip.*
+fr.wseduc.*
+fr.xebia.extras.*
+fr.xebia.management.*
+fr.xebia.maven.plugins.*
+fr.xebia.springframework.*
+fr.xebia.web.*
+fr.xebia.web.extras.*
+fr.xelians.*
+fr.xioxoz.*
+fr.ybonnel.*
+fr.zebasto.*
+fr.zebasto.dailymotion.*
+fr.ztn.java.*
+freebxml.*
+freemarker.*
+frl.driesprong.*
+fulcrum.*
+fun.awooo.dive.*
+fun.buldimpro.*
+fun.duoge.*
+fun.edoc.*
+fun.fengwk.*
+fun.fengwk.auto-mapper.*
+fun.fengwk.auto-validation.*
+fun.fengwk.common4j.*
+fun.fengwk.commons.*
+fun.fengwk.convention.*
+fun.fengwk.convention4j.*
+fun.fengwk.jwt4j.*
+fun.hereis.code.*
+fun.imcoder.cloud.*
+fun.l-angel.*
+fun.mactavish.*
+fun.mike.*
+fun.mingshan.*
+fun.mortnon.*
+fun.mortnon.moulds.*
+fun.mortnon.pac4j.*
+fun.mortnon.wj-java-sdk.*
+fun.nibaba.*
+fun.parser.*
+fun.pplm.framework.poplar.*
+fun.qinghuan.*
+fun.rubicon.*
+fun.songbo.web.*
+fun.tan90.*
+fun.toodo.*
+fun.tusi.*
+fun.wuqian.*
+fun.xzl.*
+fun.yuner.*
+fun.zyx.*
+fyi.fax.klassindex.*
+ga.babababa.*
+ga.geist.*
+ga.geist.jrv.*
+ga.overfullstack.*
+ga.palomox.lightrest.*
+ga.rugal.*
+ga.rugal.maven.*
+gabriel.*
+games.cultivate.*
+games.datastrophic.*
+games.mythical.*
+games.rednblack.hyperlap2d.*
+games.rednblack.miniaudio.*
+games.rednblack.puremvc.*
+games.spooky.gdx.*
+garden.ephemeral.*
+garden.ephemeral.dsstore.*
+garden.ephemeral.luceneupgrader.*
+garden.ephemeral.math.*
+garden.orto.*
+gay.kanwi.*
+gay.solonovamax.*
+generama.*
+genjar.*
+genjava.*
+geronimo-spec.*
+geronimo.*
+gg.jte.*
+gg.neko.spiceit.*
+gg.nils.*
+gg.pistol.*
+gg.pragma.*
+gg.rivet.*
+gg.s9y.*
+gg.vain.*
+gg.vain.flicker.*
+github.com.taconaut.*
+glass.phil.auto.moshi.*
+glassfish.jasper.*
+global.hh.*
+global.maplink.*
+global.namespace.archive-diff.*
+global.namespace.archive-io.*
+global.namespace.bali.*
+global.namespace.circe-kafka.*
+global.namespace.fun-io.*
+global.namespace.neuron-di.*
+global.namespace.parent-pom.*
+global.namespace.scala-plus.*
+global.namespace.service-wight.*
+global.namespace.truelicense-maven-archetype.*
+global.namespace.truelicense.*
+global.realid.*
+global.realid.cloud.*
+gmbh.dtap.*
+gnu-regexp.*
+gnu.getopt.*
+gov.adlnet.*
+gov.hhs.cms.bluebutton.*
+gov.hhs.cms.bluebutton.fhir.*
+gov.loc.*
+gov.nasa.*
+gov.nasa.gsfc.heasarc.*
+gov.nasa.pds.*
+gov.nasa.pds.model.*
+gov.nasa.pds.registry-api.*
+gov.nasa.race.*
+gov.nih.imagej.*
+gov.nih.ncats.*
+gov.nih.nlm.ncbi.*
+gov.nih.nlm.nls.lvg.*
+gov.nist.isg.*
+gov.nist.math.*
+gov.nist.math.jama.*
+gov.nist.secauto.*
+gov.nist.secauto.cpe.*
+gov.nist.secauto.decima.*
+gov.nist.secauto.metaschema.*
+gov.nist.secauto.oscal.*
+gov.nist.secauto.oscal.tools.oscal-cli.*
+gov.nist.secauto.scap.validation.*
+gov.nist.secauto.swid.*
+gov.nsa.*
+gov.sandia.foundry.*
+gov.tubitak.*
+gov.va.oia.*
+gq.bxteam.*
+gq.jingwei.*
+gq.shiwenhao.*
+gr.abiss.js.*
+gr.abiss.md4j.*
+gr.abiss.mvn.plugins.*
+gr.abiss.xcluder.*
+gr.cite.*
+gr.cite.opendmp.*
+gr.eap.LSHDB.*
+gr.ekt.*
+gr.ekt.bte.*
+gr.grnet.*
+gr.iti.mklab.*
+gr.james.*
+gr.jkl.*
+gr.mmichailidis.*
+gr.netmechanics.cuba.afs.*
+gr.netmechanics.jmix.*
+gr.sergouniotis.*
+gr.skroutz.*
+gr.spinellis.*
+gr.spinellis.ckjm.*
+gr.spiritinlife.*
+gr.teicm.pm.smartfilemanager.*
+gr.xe.*
+graphics.glimpse.*
+graphics.scenery.*
+graphlayout.*
+green.thisfieldwas.*
+grizzly-cachetest.*
+grizzly.*
+groovy.*
+group.flyfish.*
+group.flyfish.framework.*
+group.flyfish.oauth.*
+group.idealworld.dew.*
+group.insyde.*
+group.jihang.*
+group.jihang.framework.*
+group.liquido.*
+group.phorus.*
+group.rober.*
+group.rxcloud.*
+group.scala.karazin.*
+group.springframework.*
+group.springframework.plugin.*
+group.springframework.screw.*
+gs.hitchin.hitchfs.*
+gs.mclo.*
+gsbase.*
+guru.benson.*
+guru.breakthemonolith.*
+guru.bug.gametool.*
+guru.bug.javacourses.*
+guru.drako.utils.*
+guru.nidi.*
+guru.nidi.android.*
+guru.nidi.atlassian.remote.*
+guru.nidi.com.eclipsesource.j2v8.*
+guru.nidi.com.kitfox.*
+guru.nidi.ftpsync.*
+guru.nidi.languager.*
+guru.nidi.maven.plugins.*
+guru.nidi.raml.*
+guru.nidi.simple-3d.*
+guru.qas.*
+guru.springframework.*
+guru.timeseries.*
+guru.z3.*
+guru.zoroark.tegral.*
+hbase4s-core.*
+hboutemy.*
+health.matchbox.*
+help.swgoh.api.*
+hessian.*
+hibernate.*
+hivemind.*
+hk.advanpro.android.*
+hk.jerry.spg.*
+hm.binkley.*
+host.fai.lib.*
+host.skyone.mc.*
+house.inksoftware.*
+howl.*
+hr.aduro.*
+hr.com.vgv.*
+hr.com.vgv.asyncunit.*
+hr.com.vgv.verano.*
+hr.com.vgv.verano.http.*
+hr.fer.grading.*
+hr.fer.grading.create-exercise.*
+hr.fer.grading.exam.*
+hr.fer.oop.*
+hr.helix.*
+hr.hrg.*
+hr.istratech.*
+hr.laplacian.laplas.*
+hr.ngs.templater.*
+hr.simplesource.*
+hr.yeti-it.*
+hsqldb.*
+htmlunit.*
+httpcomponents-httpcore.*
+httpunit.*
+hu.advancedweb.*
+hu.alphabox.*
+hu.autsoft.*
+hu.blackbelt.*
+hu.blackbelt.bundles.apacheds.*
+hu.blackbelt.bundles.docx4j.*
+hu.blackbelt.bundles.easystream.*
+hu.blackbelt.bundles.eclipse-emf-codegen-ecore-xtext.*
+hu.blackbelt.bundles.eclipse-emf-codegen-ecore.*
+hu.blackbelt.bundles.eclipse-emf-codegen.*
+hu.blackbelt.bundles.eclipse-emf-mwe.*
+hu.blackbelt.bundles.eclipse-emf-mwe2.*
+hu.blackbelt.bundles.eclipse-emf-xcore.*
+hu.blackbelt.bundles.eclipse-epsilon.*
+hu.blackbelt.bundles.eclipse-jdt-ecj.*
+hu.blackbelt.bundles.eclipse-xbase.*
+hu.blackbelt.bundles.eclipse-xtend.*
+hu.blackbelt.bundles.eclipse-xtext.*
+hu.blackbelt.bundles.functionaljava.*
+hu.blackbelt.bundles.google-api-client.*
+hu.blackbelt.bundles.guava.*
+hu.blackbelt.bundles.itext.*
+hu.blackbelt.bundles.jasperreports.*
+hu.blackbelt.bundles.jcolor.*
+hu.blackbelt.bundles.juniversalchardet.*
+hu.blackbelt.bundles.jxls.*
+hu.blackbelt.bundles.keycloak-adapter.*
+hu.blackbelt.bundles.lucene.*
+hu.blackbelt.bundles.moquette.*
+hu.blackbelt.bundles.mxgraph.*
+hu.blackbelt.bundles.odfdom.*
+hu.blackbelt.bundles.openapitools.openapi-generator.*
+hu.blackbelt.bundles.orika.*
+hu.blackbelt.bundles.poi.*
+hu.blackbelt.bundles.resilience4j.*
+hu.blackbelt.bundles.restlet.*
+hu.blackbelt.bundles.semver4j.*
+hu.blackbelt.bundles.solr.*
+hu.blackbelt.bundles.subethasmtp.*
+hu.blackbelt.bundles.swagger-parser-v3.*
+hu.blackbelt.bundles.swagger-parser.*
+hu.blackbelt.bundles.t-digest.*
+hu.blackbelt.bundles.throwing-function.*
+hu.blackbelt.bundles.uml.*
+hu.blackbelt.bundles.vavr.*
+hu.blackbelt.bundles.xdocreport.*
+hu.blackbelt.cxf.*
+hu.blackbelt.eclipse.*
+hu.blackbelt.epsilon.*
+hu.blackbelt.judo.*
+hu.blackbelt.judo.eclipse.epp.*
+hu.blackbelt.judo.eclipse.jdk.zulu.*
+hu.blackbelt.judo.jsl.*
+hu.blackbelt.judo.meta.*
+hu.blackbelt.judo.runtime.*
+hu.blackbelt.judo.tatami.*
+hu.blackbelt.karaf.features.*
+hu.blackbelt.mapper.*
+hu.blackbelt.osgi.filestore.*
+hu.blackbelt.osgi.i18n.*
+hu.blackbelt.osgi.liquibase.*
+hu.blackbelt.osgi.utils.*
+hu.blackbelt.osgi.validator.*
+hu.bme.mit.theta.*
+hu.chengming.*
+hu.computertechnika.*
+hu.fitpuli.*
+hu.gecsevar.*
+hu.ibello.*
+hu.icellmobilsoft.coffee.*
+hu.icellmobilsoft.jaxb.*
+hu.icellmobilsoft.pom.*
+hu.icellmobilsoft.roaster.*
+hu.icellmobilsoft.wdc.*
+hu.inbuss.*
+hu.innovitech.pom.*
+hu.kazocsaba.*
+hu.kazocsaba.geom3d.*
+hu.kazocsaba.math.*
+hu.letscode.*
+hu.meza.*
+hu.meza.tools.*
+hu.netmind.beankeeper.*
+hu.paalgyula.*
+hu.perit.spvitamin.*
+hu.ponte.respresso.*
+hu.rxd.*
+hu.simplexion.rui.*
+hu.simplexion.z2.*
+hu.simplexion.z2.counter.*
+hu.simplexion.z2.schematic.*
+hu.simplexion.z2.service.*
+hu.simplexion.zakadabar.*
+hu.skawa.*
+hu.ssh.*
+hu.supercluster.*
+hu.vissy.json-dsl.*
+hu.vissy.plain-text-table.*
+hu.webarticum.*
+hu.webarticum.holodb.*
+hu.webarticum.minibase.*
+hu.webarticum.miniconnect.*
+hu.webarticum.miniconnect.api.*
+hu.webarticum.miniconnect.client.*
+hu.webarticum.strex.*
+hu.webhejj.*
+hu.webhejj.gradle.*
+hu.webhejj.junit.stdio.*
+hudson.plugin.*
+hudson.plugins.*
+hudson.plugins.bamboo.*
+hudson.plugins.cmake.*
+hudson.plugins.dimensionsscm.*
+hudson.plugins.filesystem_scm.*
+hudson.plugins.jdepend.*
+hudson.plugins.klaros.*
+hudson.plugins.libvirt.*
+hudson.plugins.reviewboard.*
+hudson.plugins.sctmexecutor.*
+hudson.plugins.sloccount.*
+hudson.plugins.utplsql.*
+hudson.queueSorter.*
+ical4j.*
+icu.*
+icu.alan344.*
+icu.clemon.*
+icu.d4peng.cloud.*
+icu.d4peng.roc.*
+icu.develop.*
+icu.easyj.*
+icu.easyj.boot.*
+icu.easyj.boot.middleware.*
+icu.easyj.boot.sdk.*
+icu.easyj.framework.*
+icu.easyj.maven.plugins.*
+icu.easyj.middleware.*
+icu.easyj.sdk.*
+icu.funkye.*
+icu.helltab.itool.*
+icu.hilin.*
+icu.lowcoder.spring.cloud.*
+icu.lowcoder.spring.commons.*
+icu.mhb.*
+icu.nullptr.stringfuck.*
+icu.qimuu.*
+icu.weboys.*
+icu.weboys.io.*
+icu.weboys.modbus.*
+icu.windea.breezeframework.*
+icu.wuhufly.*
+icu.wwj.camel.*
+icu.wwj.flexijob.*
+icu.xiezuojing.*
+icu.xuyijie.*
+icu.zhhll.*
+icu4j.*
+id.ac.unpar.*
+id.bafika.*
+id.bureau.*
+id.co.veritrans.*
+id.code.avrist.authenticationmodule.*
+id.dengan.*
+id.fenli.hashtagedittext.*
+id.gits.*
+id.jasoet.*
+id.luckynetwork.dev.lyrams.*
+id.luckynetwork.lyrams.lyralibs.*
+id.luthfiswees.*
+id.meteor.*
+id.mob.*
+id.passage.android.*
+id.unify.sdk.*
+id.unum.*
+id.vouched.android.*
+id.web.michsan.csimulator.*
+id.web.michsan.praytimes.*
+id.web.widat.*
+id.zelory.*
+idb.*
+ie.boboco.*
+ie.corballis.*
+ie.curiositysoftware.*
+ie.equalit.ouinet.*
+ie.omk.*
+ie.stu.*
+iirekm.*
+il.ac.technion.cs.ssdl.*
+il.co.spiralsoft.*
+il.co.top-q.difido.*
+il.org.spartan.*
+im.actor.*
+im.actor.server.*
+im.amomo.circularimageview.*
+im.amomo.leveldb.*
+im.amomo.paypal.*
+im.amomo.rangebar.*
+im.amomo.volley.*
+im.amomo.widget.*
+im.arena.*
+im.bci.*
+im.chic.crypto.*
+im.chic.weixin.*
+im.conversations.webrtc.*
+im.crisp.*
+im.dadoo.*
+im.dart.boot.*
+im.dart.game.*
+im.dino.*
+im.ene.*
+im.ene.kohii.*
+im.ene.lab.*
+im.ene.toro2.*
+im.ligas.liferay.*
+im.mak.*
+im.mange.*
+im.nll.data.*
+im.oen.boot.*
+im.oen.game.*
+im.paideia.*
+im.plmnt.*
+im.qingtui.business.*
+im.qingtui.message.*
+im.qingtui.platform.*
+im.qingtui.qbee.open.*
+im.qingtui.sdk.*
+im.quar.*
+im.shs.*
+im.toss.*
+im.tym.wraop.*
+im.wilk.vor.*
+im.yagni.*
+im.yanchen.*
+im.zego.*
+im.zhiyi.boot.*
+in.abilng.*
+in.adavi.pradyot.*
+in.adeos.*
+in.anjan.struts2-webflow.*
+in.ankushs.*
+in.ankushs.linode4j.*
+in.appat.*
+in.arjsna.*
+in.ashwanthkumar.*
+in.at0m.*
+in.clayfish.*
+in.cleartax.dropwizard.*
+in.clouthink.daas.*
+in.clouthink.repack.*
+in.co.devdattashinde.*
+in.co.diging.services.utility.java.*
+in.co.gauravtiwari.voice.*
+in.co.s13.*
+in.co.sandbox.*
+in.co.uproot.*
+in.code123.*
+in.codehub.*
+in.coinn.*
+in.coinn.sdk.*
+in.deepfleet.roamcharge.*
+in.dragonbra.*
+in.easebuzz.*
+in.easyautomate.*
+in.ejava.*
+in.erail.*
+in.ferrl.*
+in.findcode.*
+in.frol.*
+in.fullstacksolutions.*
+in.hiaust.*
+in.hocg.*
+in.hocg.archetype.*
+in.hocg.boot.*
+in.hocg.payment.*
+in.hocg.squirrel.*
+in.iampsk.oneservice.common.*
+in.iconnetworks.*
+in.infusers.library.*
+in.isecsols.*
+in.jlibs.*
+in.juspay.*
+in.kannangce.*
+in.kiranbagul.*
+in.kncsolutions.dhelm.*
+in.kncsolutions.dhelm.archetype.*
+in.kncsolutions.dhelm.candlebasic.*
+in.kncsolutions.dhelm.candlepattern.*
+in.kncsolutions.dhelm.candlescanner.*
+in.kncsolutions.dhelm.exceptions.*
+in.kncsolutions.dhelm.gfeed.*
+in.kncsolutions.dhelm.indicators.*
+in.kncsolutions.dhelm.mathcal.*
+in.ksharma.*
+in.kudosfinance.android.*
+in.kuros.*
+in.kyle.mcspring.*
+in.malonus.mocktail.*
+in.mayurshah.*
+in.messai.*
+in.momoe.*
+in.mtap.iincube.*
+in.multi-tools.*
+in.navanatech.*
+in.net.broadjradical.*
+in.norbor.*
+in.nvilla.*
+in.octosolutions.*
+in.openbi.*
+in.palash90.ganit.*
+in.palashbauri.*
+in.palashkantikundu.*
+in.payu.*
+in.randomcode.devops.*
+in.raveesh.*
+in.rcard.*
+in.relsellglobal.filespickerlib.*
+in.revos.android.*
+in.s8tech.rsa.*
+in.solomk.*
+in.sourceshift.*
+in.sourceshift.genericmodules.*
+in.specmatic.*
+in.srain.*
+in.srain.3rd.*
+in.srain.cube.*
+in.succinct.beckn.*
+in.syncup.*
+in.techpal.*
+in.testonics.omni.*
+in.tilicho.*
+in.tilicho.android.*
+in.tombo.*
+in.trainman.book.*
+in.umun.framework.*
+in.uncod.android.bypass.*
+in.vectorpro.*
+in.vectorpro.dropwizard.*
+in.virit.*
+in.virit.vwscdn.*
+in.vrsweb.*
+in.wavelabs.*
+in.wilsonl.hyperbuild.*
+in.wilsonl.minifyhtml.*
+in.workarounds.bundler.*
+in.xiandan.*
+in.yajnesh.util.*
+in.yuvi.*
+in.zapr.druid.*
+in.zeromod.*
+in.zestic.*
+in.zhaoj.*
+info.akshaal.*
+info.android15.dint.*
+info.android15.nucleus.*
+info.android15.nucleus5.*
+info.android15.proxypref.*
+info.android15.rxquery.*
+info.android15.satellite.*
+info.android15.solid.*
+info.android15.ulog.*
+info.android15.valuemap.*
+info.ankin.projects.*
+info.archinnov.*
+info.armills.chromecast-java-api-v2.*
+info.atende.webutil.*
+info.batey.kafka.*
+info.bethard.*
+info.bitrich.xchange-stream.*
+info.bliki.wiki.*
+info.bluespot.*
+info.bunji.*
+info.cepheus.*
+info.clearthought.*
+info.codesaway.*
+info.cqframework.*
+info.cukes.*
+info.datamuse.*
+info.debatty.*
+info.debatty.mark.*
+info.developia.*
+info.dreamcoder.*
+info.earty.*
+info.exbe.*
+info.faljse.*
+info.fangjh.common.*
+info.fangjh.pom.*
+info.fingo.*
+info.fingo.xactus.*
+info.folone.*
+info.freelibrary.*
+info.ganglia.gmetric4j.*
+info.ganglia.jmxetric.*
+info.gehrels.*
+info.gehrels.voting.*
+info.gratour.common.*
+info.gratour.gnss.*
+info.guardianproject.*
+info.guardianproject.cacheword.*
+info.guardianproject.conscrypt.*
+info.guardianproject.envoy.*
+info.guardianproject.iocipher.*
+info.guardianproject.netcipher.*
+info.guardianproject.panic.*
+info.hargrave.*
+info.hargrave.configuration.*
+info.henix.*
+info.hexin.*
+info.hoang8f.*
+info.hubbitus.*
+info.hupel.*
+info.hupel.afp.*
+info.hupel.fork.com.verizon.*
+info.hupel.fork.oeffi.*
+info.hupel.fork.org.log4s.*
+info.ibruce.*
+info.ineighborhood.*
+info.informationsea.commandmanager.*
+info.informationsea.dataclustering4j.*
+info.informationsea.tableio.*
+info.javaspec.*
+info.jerrinot.*
+info.jitcom.*
+info.jmonit.*
+info.johtani.*
+info.johtani.elasticsearch.plugin.ingest.*
+info.joshbassett.*
+info.journeymap.*
+info.julang.*
+info.kapable.*
+info.kapable.utils.*
+info.karlovskiy.*
+info.kfgodel.*
+info.kinumi.*
+info.knigoed.isbn.*
+info.kuechler.bmf.*
+info.kuechler.bmf.taxapi.*
+info.kuechler.bmf.taxcalculator.*
+info.kuechler.gpx.*
+info.kuechler.image.*
+info.kwarc.mmt.*
+info.kwarc.sally4.*
+info.kwarc.sally4.comm.*
+info.kwarc.sally4.mhw.*
+info.kwarc.sally4.mhw.comm.*
+info.laht.*
+info.laht.fmi4j.*
+info.laht.kts.*
+info.laht.sspgen.*
+info.laht.threekt.*
+info.laht.vico.*
+info.leadinglight.*
+info.lostred.ruler.*
+info.lyscms.assembly.*
+info.macias.*
+info.magnolia.*
+info.marcussoftware.*
+info.md7.*
+info.metadude.android.*
+info.metadude.kotlin.library.engelsystem.*
+info.metadude.kotlin.library.roadsigns.*
+info.michaelwittig.*
+info.mikaelsvensson.devtools.*
+info.modprobe.*
+info.mukel.*
+info.novatec.*
+info.novatec.ita.*
+info.novatec.testit.*
+info.offthecob.platform.*
+info.pascalkrause.*
+info.peperkoek.*
+info.picocli.*
+info.piwai.frenchtoast.*
+info.piwai.rockslide.*
+info.plateaukao.android.*
+info.plichta.maven.plugins.*
+info.projectkyoto.*
+info.purocean.*
+info.purocean.kotlin-db-migration.1.2.0.info.purocean.*
+info.rmarcus.*
+info.ronjenkins.*
+info.rsdev.xb4j.*
+info.scce.*
+info.schleichardt.*
+info.schnatterer.moby-names-generator.*
+info.schnatterer.musicbrainzws2-java.*
+info.schnatterer.tomcat-reloading-connector.*
+info.semsamot.*
+info.senia.*
+info.setmy.*
+info.setmy.jwt.*
+info.setmy.models.*
+info.setmy.services.*
+info.shuwang.cloud.*
+info.shuwang.cupboard.*
+info.shuwang.eslapi.*
+info.shuwang.payment.*
+info.silin.*
+info.solidsoft.gradle.*
+info.solidsoft.gradle.pitest.*
+info.solidsoft.mockito.*
+info.solidsoft.spock.*
+info.stasha.*
+info.tomfi.alexa.*
+info.tomfi.archetypes.*
+info.tomfi.hebcal.*
+info.tomfi.shabbat.*
+info.unclewang.*
+info.unterrainer.commons.*
+info.unterrainer.commons.udp-observer.*
+info.unterrainer.java.tools.*
+info.unterrainer.java.tools.reporting.*
+info.unterrainer.server.*
+info.vividcode.android.zxing.*
+info.vizierdb.*
+info.xiancloud.*
+info.xiaohei.www.*
+info.yemi.updateapp.*
+info.zhongpu.*
+informa.*
+ink.aos.api.*
+ink.aos.commons.*
+ink.aos.module.*
+ink.codflow.shiro.jwtsession.*
+ink.cory.*
+ink.drinks.*
+ink.fengshuai.*
+ink.gfwl.*
+ink.huaxun.*
+ink.kob.*
+ink.lodz.*
+ink.mnote.devtools.*
+ink.organics.*
+ink.rayin.*
+ink.redamancy.basic.*
+ink.siera.*
+ink.xiaobaibai.*
+ink.zfei.*
+innig.*
+int.esa.ccsds.mo.*
+int.esa.nmf.*
+int.esa.nmf.apps.*
+int.esa.nmf.core.*
+int.esa.nmf.core.moservices.*
+int.esa.nmf.core.moservices.api.*
+int.esa.nmf.core.moservices.impl.*
+int.esa.nmf.mission.simulator.*
+int.esa.nmf.mission.simulator.moservices.impl.*
+int.esa.opssat.*
+io-github-hbase4s.*
+io.*
+io.1533.*
+io.57blocks.*
+io.7mind.izumi.*
+io.7mind.izumi.sbt.*
+io.7mind.izumi.sbtgen.*
+io.aalam.common.*
+io.aalam.maven.*
+io.ably.*
+io.aboutcode.stage.*
+io.aboutcode.stage.persistence.*
+io.aboutcode.stage.persistence.graph.*
+io.aboutcode.stage.persistence.jdbc.*
+io.aboutcode.stage.persistence.orm.*
+io.aboutcode.stage.persistence.relational.*
+io.accumulatenetwork.*
+io.accur8.*
+io.acryl.*
+io.acryl.gradle.plugin.*
+io.acryl.gradle.plugin.avro-base.*
+io.acryl.gradle.plugin.avro.*
+io.activated.objectdiff.*
+io.activated.reduction.*
+io.activej.*
+io.actor4j.*
+io.adabox.*
+io.adalliance.*
+io.adamantic.*
+io.adaptivecards.*
+io.adapty.*
+io.adboss.*
+io.adeptj.*
+io.adgrid.*
+io.admin-shell.aas.*
+io.adobe.cloudmanager.*
+io.adquiz.android.*
+io.adtrace.*
+io.adtrace.sdk.*
+io.advant.*
+io.advantageous.*
+io.advantageous.boon.*
+io.advantageous.czarmaker.*
+io.advantageous.ddp.*
+io.advantageous.discovery.*
+io.advantageous.elekt.*
+io.advantageous.gradle.*
+io.advantageous.guicefx.*
+io.advantageous.konf.*
+io.advantageous.marathon.*
+io.advantageous.metrik.*
+io.advantageous.qbit.*
+io.advantageous.reakt.*
+io.advantageous.reakt.cassandra.*
+io.aecor.*
+io.aelf.*
+io.aergo.*
+io.aeris-consulting.*
+io.aeron.*
+io.aesy.*
+io.aesy.checkstyle.*
+io.aesy.musicbrainz.*
+io.afu.*
+io.afu.sb.*
+io.agora.*
+io.agora.game.*
+io.agora.game.ap.*
+io.agora.rtc.*
+io.agora.rtm.*
+io.agrest.*
+io.agrest.docs.*
+io.agrest.openapi.*
+io.agroal.*
+io.aiactiv.*
+io.aiactiv.sdk.*
+io.aicactus.*
+io.aicactus.sdk.*
+io.aiontechnology.*
+io.aiontechnology.mentorsuccess.*
+io.airbrake.*
+io.aircore.media.*
+io.aircore.panel.*
+io.aircore.ui.*
+io.aircore.unicron.*
+io.airdeploy.*
+io.airlift.*
+io.airlift.airship.*
+io.airlift.discovery.*
+io.airlift.drift.*
+io.airlift.maven.plugins.*
+io.airlift.resolver.*
+io.airlift.tpch.*
+io.aiven.*
+io.ak1.*
+io.ak1.pix.*
+io.akenza.*
+io.alapierre.*
+io.alapierre.commons.*
+io.alapierre.crypto.*
+io.alapierre.ksef.*
+io.alauda.*
+io.alauda.client.*
+io.aleph.*
+io.alicorn.v8.*
+io.alienhead.kleuth.*
+io.alkal.*
+io.allune.*
+io.alphatier.*
+io.altadata.*
+io.altoo.*
+io.amberdata.inbound.*
+io.amberflo.*
+io.americanexpress.*
+io.americanexpress.busybee.*
+io.americanexpress.synapse.*
+io.amient.affinity.*
+io.andromeda.*
+io.andromeda.pippo.*
+io.annot8.*
+io.annotationj.*
+io.anontech.vizivault.*
+io.anserini.*
+io.antmedia.*
+io.antmedia.api.periscope.*
+io.antmedia.app.*
+io.antmedia.webrtc.*
+io.anyrtc.*
+io.ap4k.*
+io.apicurio.*
+io.apigee.*
+io.apigee.build-tools.enterprise4g.*
+io.apigee.gcm.*
+io.apigee.lembos.*
+io.apigee.opensaml.*
+io.apigee.trireme.*
+io.apikey.*
+io.apiman.*
+io.apiman.plugins.*
+io.apimatic.*
+io.apisense.*
+io.apisense.embed.influx.*
+io.apisense.jdeferred.*
+io.apisense.network.*
+io.apisense.sdk.*
+io.apistax.*
+io.apitestbase.*
+io.apiwiz.astrum.*
+io.appbase.*
+io.appbricks.*
+io.appform.core.*
+io.appform.databuilderframework.*
+io.appform.dropwizard.*
+io.appform.dropwizard.actors.*
+io.appform.dropwizard.discovery.*
+io.appform.dropwizard.sharding.*
+io.appform.foxtrot.*
+io.appform.foxtrot.eventingester.*
+io.appform.functionmetrics.*
+io.appform.hbase.ds.*
+io.appform.hope.*
+io.appform.http.*
+io.appform.idman.*
+io.appform.kaal.*
+io.appform.opentracing.annotations.*
+io.appform.ranger.*
+io.appform.rules.*
+io.appform.signals.*
+io.appform.simplefsm.*
+io.appform.testcontainer.*
+io.appgrades.*
+io.appinfra.*
+io.appium.*
+io.applicative.*
+io.appmetrica.analytics.*
+io.appmetrica.gradle.*
+io.appmetrica.gradle.aar-check.*
+io.appmetrica.gradle.android-codequality.*
+io.appmetrica.gradle.android-library.*
+io.appmetrica.gradle.codequality.*
+io.appmetrica.gradle.gradle-plugin.*
+io.appmetrica.gradle.kotlin-library.*
+io.appmetrica.gradle.ktlint.*
+io.appmetrica.gradle.no-logs.*
+io.apptik.comm.*
+io.apptik.json.*
+io.apptik.multiview.*
+io.apptik.rhub.*
+io.apptik.rxhub.*
+io.apptik.widget.*
+io.appulse.*
+io.appulse.encon.*
+io.appulse.encon.java.*
+io.appulse.epmd.java.*
+io.appvengers.aeon.*
+io.appwrite.*
+io.arachn.*
+io.arcblock.did.*
+io.arcblock.forge.*
+io.archimedesfw.*
+io.archimedesfw.commons.*
+io.archimedesfw.context.*
+io.archimedesfw.cqrs.*
+io.archimedesfw.data.*
+io.archimedesfw.maven.micronaut.*
+io.archimedesfw.maven.tiles.*
+io.archimedesfw.security.*
+io.archimedesfw.usecase.*
+io.architect.sdk.*
+io.archivesunleashed.*
+io.arenadata.hive.*
+io.arenadata.security.*
+io.arenadata.vertx.*
+io.aretemed.drakkar.*
+io.argonaut.*
+io.arivera.oss.*
+io.arkitik.arch.*
+io.arkitik.audit.tale.*
+io.arkitik.ktx.radix.*
+io.arkitik.radix.*
+io.arkitik.tracker.*
+io.arrow-kt.*
+io.arrow-kt.analysis.java.*
+io.arrow-kt.analysis.kotlin.*
+io.arrow-kt.arrow-gradle-config-formatter.*
+io.arrow-kt.arrow-gradle-config-jvm.*
+io.arrow-kt.arrow-gradle-config-kotlin.*
+io.arrow-kt.arrow-gradle-config-multiplatform.*
+io.arrow-kt.arrow-gradle-config-nexus.*
+io.arrow-kt.arrow-gradle-config-publish-gradle-plugin.*
+io.arrow-kt.arrow-gradle-config-publish-java-platform.*
+io.arrow-kt.arrow-gradle-config-publish-jvm.*
+io.arrow-kt.arrow-gradle-config-publish-multiplatform.*
+io.arrow-kt.arrow-gradle-config-publish.*
+io.arrow-kt.arrow-gradle-config-versioning.*
+io.arrow-kt.proofs.*
+io.artisan4j.*
+io.ashdavies.auto.*
+io.ashdavies.rx.*
+io.ashdavies.rx.rxtasks.*
+io.astefanutti.camel.cdi.*
+io.astefanutti.metrics.aspectj.*
+io.astefanutti.metrics.cdi.*
+io.astraea.*
+io.astronomer.analytics.android.*
+io.astronomer.analytics.java.*
+io.asyncer.*
+io.ataraxic.nomicflux.*
+io.atlasmap.*
+io.atlasmap.com.sun.xsom.*
+io.atlasmap.examples.*
+io.atlasmap.examples.camel3.*
+io.atlassian.*
+io.atlassian.aws-scala.*
+io.atlassian.fugue.*
+io.atlassian.json-schemagen.*
+io.atlassian.util.concurrent.*
+io.atleon.*
+io.atomicbits.*
+io.atomix.*
+io.atomix.catalyst.*
+io.atomix.copycat.*
+io.attini.cdk.*
+io.aubay.fase.*
+io.autocruit.*
+io.autocrypt.sakarinblue.*
+io.automatiko.*
+io.automatiko.addons.*
+io.automatiko.addons.services.*
+io.automatiko.archetypes.*
+io.automatiko.build.*
+io.automatiko.decision.*
+io.automatiko.engine.*
+io.automatiko.extras.*
+io.automatiko.quarkus.*
+io.automatiko.workflow.*
+io.autonomx.*
+io.avaje.*
+io.avaje.blackboxtest.*
+io.avaje.kapt.*
+io.avaje.kate.*
+io.avaje.maven.*
+io.avaje.metrics.*
+io.avaje.tile.*
+io.avery.*
+io.awspring.cloud.*
+io.axonif.*
+io.axoniq.*
+io.axoniq.axonhub.*
+io.axoniq.console.*
+io.axoniq.inspector.*
+io.axual.archetypes.*
+io.axual.broker.*
+io.axual.client.*
+io.axual.common.*
+io.axual.connect.plugins.azure.*
+io.axual.connect.plugins.converters.*
+io.axual.connect.plugins.http.*
+io.axual.connect.plugins.kafka.*
+io.axual.discovery.*
+io.axual.helper.*
+io.axual.platform.test.*
+io.axual.security.principal.*
+io.axual.serde.*
+io.axual.streams.*
+io.axual.utilities.config.providers.*
+io.axway.alf.*
+io.axway.iron.*
+io.ayro.*
+io.ayte.*
+io.ayte.utility.fabricator.*
+io.ayte.utility.predicate.*
+io.ayte.utility.supplier.*
+io.ayte.utility.task.*
+io.ayte.utility.value.*
+io.azam.azamcodec.*
+io.azam.spa.*
+io.azam.ulidj.*
+io.backchat.hookup.*
+io.backchat.inflector.*
+io.backchat.jerkson.*
+io.backchat.rl.*
+io.backchat.websocket.*
+io.backpackcloud.*
+io.badal.*
+io.ballerina.*
+io.ballerina.messaging.*
+io.ballerina.stdlib.*
+io.baltoro.*
+io.baratine.*
+io.bartholomews.*
+io.basc.framework.*
+io.basc.start.*
+io.basestar.*
+io.bastillion.*
+io.bayberry.*
+io.bayberry.aloha.*
+io.bayonet.*
+io.bddhub.*
+io.bdeploy.*
+io.bdrc.*
+io.bdrc.ewtsconverter.*
+io.bdrc.libraries.*
+io.bdrc.lucene.*
+io.beanmapper.*
+io.beanmother.*
+io.beapi.*
+io.bernhardt.*
+io.bernoulli.*
+io.bespin.*
+io.bestquality.*
+io.beyondprops.*
+io.bfil.*
+io.bidapp.*
+io.bidapp.networks.*
+io.bigconnect.*
+io.bigdime.*
+io.bigdime.bigdime-monitoring.*
+io.bigio.*
+io.bigwig.*
+io.bimble.*
+io.bindingz.*
+io.bit3.*
+io.bitbucket.1drop.*
+io.bitbucket.5faces.*
+io.bitbucket.BharatJyt90.*
+io.bitbucket.aaltayeh.*
+io.bitbucket.ajocardengineering.*
+io.bitbucket.android-universum.*
+io.bitbucket.avalanchelaboratory.*
+io.bitbucket.azure0211.*
+io.bitbucket.boussami_nassim.*
+io.bitbucket.ccdungnt2.*
+io.bitbucket.ccstech.mobile.rewards.sdk.*
+io.bitbucket.chandrakant-idea.*
+io.bitbucket.devworldturk.*
+io.bitbucket.dkrypton.*
+io.bitbucket.dsmoons.*
+io.bitbucket.haneulho_enliple.*
+io.bitbucket.hariramkc.*
+io.bitbucket.hprotravel.*
+io.bitbucket.ivansiabro.*
+io.bitbucket.janmaren.*
+io.bitbucket.jprieto_kinpos.*
+io.bitbucket.kefir666.*
+io.bitbucket.khatri7yash.*
+io.bitbucket.kibitzercz.*
+io.bitbucket.kumargrv324.*
+io.bitbucket.manojkarki_ksystem.*
+io.bitbucket.manojmiyani99.*
+io.bitbucket.mikescorporation.*
+io.bitbucket.mobscannersdk.*
+io.bitbucket.pankajkumar2910.*
+io.bitbucket.payfacebr.*
+io.bitbucket.ruttagorn_chatdee.*
+io.bitbucket.sdevani92.*
+io.bitbucket.sergiovl.*
+io.bitbucket.shilogavra.*
+io.bitbucket.sivaganeshkantamani.*
+io.bitbucket.spicemoney.*
+io.bitbucket.supportomateinc.*
+io.bitbucket.supportomateinc.aop.*
+io.bitbucket.supportomateinc.arquillian.container.*
+io.bitbucket.supportomateinc.commons.*
+io.bitbucket.supportomateinc.commtesting.*
+io.bitbucket.supportomateinc.fsm.*
+io.bitbucket.supportomateinc.javax.sip.*
+io.bitbucket.supportomateinc.media.*
+io.bitbucket.supportomateinc.media.client.*
+io.bitbucket.supportomateinc.media.codecs.*
+io.bitbucket.supportomateinc.media.controls.*
+io.bitbucket.supportomateinc.media.docs.*
+io.bitbucket.supportomateinc.media.hardware.*
+io.bitbucket.supportomateinc.media.io.*
+io.bitbucket.supportomateinc.media.resources.*
+io.bitbucket.supportomateinc.microcontainer.*
+io.bitbucket.supportomateinc.protocols.stream.*
+io.bitbucket.supportomateinc.servlet.sip.*
+io.bitbucket.supportomateinc.servlet.sip.arquillian.showcase.*
+io.bitbucket.supportomateinc.servlet.sip.containers.*
+io.bitbucket.supportomateinc.smpp.*
+io.bitbucket.swapnilcpublic.*
+io.bitbucket.tomwnorton.*
+io.bitbucket.truedmp.*
+io.bitbucket.vatsshashank.*
+io.bitbucket.vfddevteam.*
+io.bitbucket.yxin47.*
+io.bitcoinsv.*
+io.bitcoinsv.bitcoinjsv.*
+io.bitcoinsv.headerSV.*
+io.bitcoinsv.jcl.*
+io.bitexpress.*
+io.bitexpress.openapi.*
+io.bitexpress.topia.commons.*
+io.bitlevel.*
+io.bitrise.gradle.*
+io.bitrise.gradle.gradle-analytics.*
+io.bitrise.trace.*
+io.bitrise.trace.internal.*
+io.bitrise.trace.plugin.*
+io.bitsensor.*
+io.bitsensor.plugins.*
+io.bitunnel.*
+io.bitzl.*
+io.biza.*
+io.bkbn.*
+io.blep.*
+io.blinq.*
+io.blitz.*
+io.blockfrost.*
+io.blocko.*
+io.bloco.*
+io.bloombox.*
+io.blt.*
+io.bluebank.braid.*
+io.bluecabin.common.*
+io.bmeg.*
+io.boneidle.*
+io.boodskap.iot.ext.*
+io.bootique.*
+io.bootique.agrest.*
+io.bootique.aws.*
+io.bootique.bom.*
+io.bootique.cayenne.*
+io.bootique.curator.*
+io.bootique.cxf.*
+io.bootique.di.*
+io.bootique.docker.*
+io.bootique.docs.*
+io.bootique.flyway.*
+io.bootique.jcache.*
+io.bootique.jdbc.*
+io.bootique.jersey.*
+io.bootique.jersey.client.*
+io.bootique.jetty.*
+io.bootique.job.*
+io.bootique.jooq.*
+io.bootique.kafka.*
+io.bootique.kafka.client.*
+io.bootique.kotlin.*
+io.bootique.linkmove.*
+io.bootique.linkrest.*
+io.bootique.liquibase.*
+io.bootique.logback.*
+io.bootique.metrics.*
+io.bootique.modules.parent.*
+io.bootique.mongo.*
+io.bootique.mvc.*
+io.bootique.mybatis.*
+io.bootique.parent.*
+io.bootique.rabbitmq.*
+io.bootique.rabbitmq.client.*
+io.bootique.shiro.*
+io.bootique.simplejavamail.*
+io.bootique.swagger.*
+io.bootique.tapestry.*
+io.bootique.undertow.*
+io.bootstage.testkit.*
+io.bosh.client.*
+io.bpic.aws.*
+io.bpic.cielo.*
+io.brachu.*
+io.branch.external.answersshim.*
+io.branch.invite.sdk.android.*
+io.branch.roots.sdk.android.*
+io.branch.sdk.android.*
+io.branch.sdk.nativecompute.*
+io.branch.sdk.workflow.*
+io.branch.segment.analytics.android.integrations.*
+io.breadbutter.*
+io.bretty.*
+io.brooklyn.*
+io.brooklyn.alfresco.*
+io.brooklyn.ambari.*
+io.brooklyn.clocker.*
+io.brooklyn.couchdb-cluster.*
+io.brooklyn.elk.*
+io.brooklyn.etcd.*
+io.brooklyn.example.*
+io.brooklyn.jenkins.*
+io.brooklyn.maven.*
+io.brooklyn.networking.*
+io.brooklyn.three-tier-webapp.*
+io.brunk.tokenizers.*
+io.bspk.*
+io.btrace.*
+io.bucketeer.*
+io.bugbattle.*
+io.bugtags.library.*
+io.buildo.*
+io.buji.*
+io.bullet.*
+io.bunting.keyring.*
+io.buoyant.*
+io.burkard.*
+io.burt.*
+io.buybrain.*
+io.bytebeam.*
+io.bytom.*
+io.cafienne.*
+io.cafienne.bounded.*
+io.calendarium.*
+io.calimero.*
+io.callstats.*
+io.calq.*
+io.camassia.*
+io.camassia.security.*
+io.camlcase.*
+io.camunda.*
+io.camunda.connector.*
+io.camunda.spring.*
+io.cana.boot.*
+io.cana.steam.*
+io.candy-doc.*
+io.card.*
+io.cardell.*
+io.carml.*
+io.carml.jar.*
+io.carpe.*
+io.cartographer.*
+io.caspercommunity.*
+io.cassandrareaper.*
+io.cassaundra.*
+io.cassava.*
+io.castle.*
+io.castle.android.*
+io.castled.*
+io.castled.android.*
+io.catappult.*
+io.catbird.*
+io.causallabs.*
+io.cdap.*
+io.cdap.cdap.*
+io.cdap.common.*
+io.cdap.delta.*
+io.cdap.http.*
+io.cdap.mmds.*
+io.cdap.plugin.*
+io.cdap.re.*
+io.cdap.tests.e2e.*
+io.cdap.twill.*
+io.cdap.wrangler.*
+io.cdsoft.*
+io.cellery.distribution.*
+io.cellery.observability.*
+io.cellery.security.*
+io.cellulant.*
+io.cequence.*
+io.ceratech.*
+io.cereebro.*
+io.ceresdb.*
+io.cettia.*
+io.cettia.asity.*
+io.cettia.platform.*
+io.chabok.*
+io.chandler.*
+io.channel.*
+io.chapp.commons.*
+io.chapp.wield.*
+io.charlescd.*
+io.chatpal.solr.*
+io.chino.*
+io.chocotea.*
+io.choerodon.*
+io.chris-kipp.*
+io.chrisdavenport.*
+io.chucknorris.*
+io.churchkey.*
+io.chymyst.*
+io.ciera.*
+io.cimpress.*
+io.cine.*
+io.ciogram.*
+io.circe.*
+io.citizenjournalist.speech.*
+io.citrine.*
+io.ckite.*
+io.clarify.api.*
+io.clevermaps.client-sdk.*
+io.clickhandler.*
+io.clickity.*
+io.clickocean.*
+io.clickocean.dmp.*
+io.clogr.*
+io.cloudbeat.cucumber.*
+io.cloudboost.*
+io.cloudevents.*
+io.cloudex.*
+io.cloudflight.architectureicons.*
+io.cloudflight.ci.info.*
+io.cloudflight.cleancode.archunit.*
+io.cloudflight.gradle.*
+io.cloudflight.iconcollection.*
+io.cloudflight.json.*
+io.cloudflight.license.spdx.*
+io.cloudflight.platform.spring.*
+io.cloudflight.structurizr.*
+io.cloudflight.swagger-template.*
+io.cloudflight.testresources.springboot.*
+io.cloudracer.*
+io.cloudreactor.*
+io.cloudshiftdev.awscdk-dsl-kotlin.*
+io.cloudshiftdev.gradle.*
+io.cloudshiftdev.release-plugin.*
+io.cloudslang.*
+io.cloudslang.content.*
+io.cloudslang.lang.*
+io.cloudslang.tools.*
+io.cloudsoft.amp.*
+io.cloudsoft.brooklyn.tosca.*
+io.cloudsoft.jclouds.*
+io.cloudsoft.jclouds.api.*
+io.cloudsoft.jclouds.common.*
+io.cloudsoft.jclouds.driver.*
+io.cloudsoft.jclouds.labs.*
+io.cloudsoft.jclouds.labs.management.*
+io.cloudsoft.jclouds.labs.representations.*
+io.cloudsoft.jclouds.provider.*
+io.cloudsoft.jmeter.*
+io.cloudsoft.networking.*
+io.cloudsoft.windows.*
+io.cloudstate.*
+io.cloudthing.sdk.*
+io.cobrowse.*
+io.cobweb.*
+io.code-check.*
+io.codearte.accurest.*
+io.codearte.duramen.*
+io.codearte.gradle.nexus.*
+io.codearte.jfairy.*
+io.codearte.prop2yaml.*
+io.codearte.props2yaml.*
+io.codebottle.*
+io.codecastle.scriptorium.*
+io.codef.api.*
+io.codegen.gwt-json-overlay.*
+io.codegen.gwt.openapigenerator.*
+io.codegen.jso-builder.*
+io.codegen.wi.suwiml.*
+io.codekontor.mojos.*
+io.codekontor.mvnresolver.*
+io.codekontor.slizaa.*
+io.codekontor.slizaa.extensions.*
+io.codekontor.slizaa.mojos.*
+io.codelair.*
+io.codelens.*
+io.codemodder.*
+io.codemonastery.*
+io.codenotary.*
+io.codescan.*
+io.codeworth.*
+io.codingpassion.*
+io.codis.jodis.*
+io.cogile.mongo.*
+io.coil-kt.*
+io.coinapi.rest.*
+io.coinapi.websocket.*
+io.coinstr.*
+io.collett.*
+io.committed.*
+io.committed.baleen.*
+io.committed.invest.*
+io.committed.krill.*
+io.concordant.*
+io.conduktor.*
+io.conekta.*
+io.coney.testing.*
+io.configrd.*
+io.configz.*
+io.confluent.*
+io.confluent.avro.*
+io.confluent.kafka.*
+io.confluent.ksql.*
+io.confluent.maven.*
+io.confluent.parallelconsumer.*
+io.confound.*
+io.connectedhealth-idaas.*
+io.contek.brewmaster.*
+io.contek.enigma.*
+io.contek.hdf.*
+io.contek.invoker.*
+io.contek.morphling.*
+io.contek.reloading.*
+io.contek.timbersaw.*
+io.contek.tinker.*
+io.contek.tusk.*
+io.contek.ursa.*
+io.contek.viper.*
+io.contek.warlock.*
+io.contek.zeus.*
+io.contentchef.*
+io.contextmap.*
+io.continual.*
+io.continuum.bokeh.*
+io.contract-testing.contractcase.*
+io.coodoo.*
+io.corbel.*
+io.corbel.lib.*
+io.cordite.*
+io.cordite.braid.*
+io.cordite.services.*
+io.cortical.*
+io.coti.*
+io.cotiviti.*
+io.cotiviti.test.*
+io.countmatic.api.*
+io.cour.*
+io.covenantsql.*
+io.craftcode.*
+io.craftgate.*
+io.craftsman.*
+io.crashbox.*
+io.crate.*
+io.cresco.*
+io.crnk.*
+io.cronapp.*
+io.cronenbergworld.*
+io.cronitor.*
+io.crossbar.autobahn.*
+io.crossroads.*
+io.crowdcode.*
+io.crowdcode.maven.plugins.*
+io.crowdcode.sormas.lbds.*
+io.crowdcode.webdav.*
+io.crums.*
+io.cryptoapis.*
+io.cryptocontrol.*
+io.crysknife.*
+io.crysknife.legacy.ui.*
+io.crysknife.legacy.ui.databinding.*
+io.crysknife.legacy.ui.navigation.*
+io.crysknife.ui.*
+io.crysknife.ui.mutationobserver.*
+io.crysknife.ui.navigation.*
+io.crysknife.ui.templates.*
+io.crysknife.ui.translation.*
+io.csar.*
+io.csra.wily.*
+io.cubos.*
+io.cucumber.*
+io.cumul.*
+io.curity.*
+io.customer.android.*
+io.cvbio.*
+io.cvbio.collection.*
+io.cvbio.collection.mutable.*
+io.cvbio.coord.*
+io.cwatch.*
+io.cyclops.*
+io.czlab.*
+io.d11.*
+io.dangernoodle.*
+io.daobab.*
+io.daos.*
+io.dapr.*
+io.data2viz.*
+io.data2viz.d2v.*
+io.data2viz.geojson.*
+io.dataapps.chlorine.*
+io.databridges.*
+io.dataease.*
+io.datafx.*
+io.datakernel.*
+io.datalake.geode.jta.*
+io.datalbry.alxndria.*
+io.datalbry.commons.*
+io.datalbry.config-schema.*
+io.datalbry.confluence.*
+io.datalbry.connector.*
+io.datalbry.jetbrains.*
+io.datalbry.jira.*
+io.datalbry.precise.*
+io.datalbry.testcontainers.*
+io.datanerds.*
+io.datarouter.*
+io.datasnap.*
+io.dataspray.*
+io.datawire.mdk.*
+io.datawire.quark.*
+io.datawire.quark.build.*
+io.daten.*
+io.datumo.*
+io.dazraf.*
+io.dbkover.*
+io.dbmaster.*
+io.dbmaster.plugins.*
+io.ddavison.*
+io.ddf.*
+io.debezium.*
+io.deephaven.*
+io.deephaven.barrage.*
+io.deephaven.plugins.*
+io.deepmedia.tools.*
+io.deepmedia.tools.deployer.*
+io.deepmedia.tools.testing.*
+io.deepsense.*
+io.deepsense.neptune.*
+io.defaultj.*
+io.defn.*
+io.dekorate.*
+io.delmore.*
+io.delta.*
+io.demkada.olympus.*
+io.demograph.*
+io.denkbar.smb.*
+io.depeche.*
+io.descoped.stride.application.*
+io.determan.*
+io.determann.*
+io.devapo.camunda.*
+io.devbench.*
+io.devbench.uibuilder.*
+io.devbench.uibuilder.archetypes.*
+io.devbench.uibuilder.components.*
+io.devbench.uibuilder.components.util.*
+io.devbench.uibuilder.context-management.*
+io.devbench.uibuilder.core.*
+io.devbench.uibuilder.core.theme.*
+io.devbench.uibuilder.data.*
+io.devbench.uibuilder.examples.example-app.*
+io.devbench.uibuilder.i18n.*
+io.devbench.uibuilder.i18n.plugin.*
+io.devbench.uibuilder.security.*
+io.devcon5.*
+io.devcon5.commons.*
+io.devcon5.timeseries.*
+io.develotex.*
+io.devhq.*
+io.devnindo.core.*
+io.dfinery.*
+io.dgraph.*
+io.dhilar.*
+io.dhilar.phzip.*
+io.dialob.*
+io.didomi.sdk.*
+io.digdag.*
+io.digiexpress.*
+io.digified.*
+io.dimeformat.*
+io.dingodb.*
+io.dinject.*
+io.dinject.kapt.*
+io.display.*
+io.disquark.*
+io.disquark.immutables.*
+io.divide.*
+io.divolte.*
+io.djanta.*
+io.djanta.community.*
+io.dldb.sdk.*
+io.dmuncle.maven.*
+io.dnsdb.sdk.*
+io.dock2dock.*
+io.docops.*
+io.documentnode.*
+io.dogote.*
+io.dolby.*
+io.donesky.blocky.*
+io.doorbell.*
+io.doov.*
+io.drdroid.*
+io.dreamfly.dependencies.*
+io.drinkwater.*
+io.dronefleet.mavlink.*
+io.dropwizard-bundles.*
+io.dropwizard.*
+io.dropwizard.archetypes.*
+io.dropwizard.logback.*
+io.dropwizard.metrics.*
+io.dropwizard.metrics5.*
+io.dropwizard.modules.*
+io.druid.*
+io.druid.extensions.*
+io.druid.extensions.contrib.*
+io.dscope.*
+io.dstore.*
+io.dstream.*
+io.dstream.nifi.*
+io.dstream.spark.*
+io.dstream.sql.*
+io.dstream.tez.*
+io.dtective.*
+io.dubbo.springboot.*
+io.durg.kirtimukh.*
+io.durg.kirtimukh.dw.*
+io.dvlopt.*
+io.dweomer.*
+io.dwpbank.movewp3.*
+io.dylemma.*
+io.dyte.*
+io.dyte.core.*
+io.dyte.gradle.*
+io.dyte.gradle.plugin.base.*
+io.dyte.kotlin.*
+io.dyte.kotlin.kmmbridge.*
+io.dyte.mediasoup.*
+io.earcam.*
+io.earcam.instrumental.*
+io.earcam.maven.*
+io.earcam.maven.plugin.*
+io.earcam.utilitarian.*
+io.earcam.wrapped.*
+io.easybest.*
+io.easyspring.framework.*
+io.easyspring.security.*
+io.easyspring.service.*
+io.easywalk.*
+io.ebean.*
+io.ebean.test.*
+io.ebean.tile.*
+io.ebean.tools.*
+io.echo-dev.*
+io.ecocode.*
+io.edurt.datacap.*
+io.edurt.datacap.client.*
+io.edurt.datacap.common.*
+io.edurt.datacap.plugin.*
+io.edurt.datacap.plugin.http.*
+io.edurt.datacap.plugin.jdbc.*
+io.edurt.datacap.plugin.natived.*
+io.edurt.gcm.*
+io.edurt.gcm.client.*
+io.edurt.gcm.engine.*
+io.edurt.gcm.framework.*
+io.edurt.gcm.storage.*
+io.eels.*
+io.effectus.*
+io.eflabs.cucumber.*
+io.eflabs.vertigo.*
+io.ehdev.testify.*
+io.ejekta.*
+io.ejs.*
+io.elastest.*
+io.elastest.epm.*
+io.elastic.*
+io.eldermael.*
+io.electrum.*
+io.elegans.*
+io.element.android.*
+io.elements.pay.*
+io.elepay.*
+io.eliez.*
+io.elsci.isotope-distribution.*
+io.elsci.multinomial-selection.*
+io.embold.scan.*
+io.embrace.*
+io.embrace.swazzler.*
+io.emqx.*
+io.engineblock.*
+io.enoa.*
+io.entilzha.*
+io.envoyproxy.controlplane.*
+io.envoyproxy.envoymobile.*
+io.envoyproxy.protoc-gen-validate.*
+io.eos-ecosystem.*
+io.ep2p.*
+io.epiphanous.*
+io.epirus.*
+io.eqoty.*
+io.eqoty.dapp.secret.*
+io.eqoty.kryptools.*
+io.eqoty.secretk.*
+io.eqoty.web3k.*
+io.erhardt.*
+io.err0.*
+io.es4j.*
+io.esastack.*
+io.esborg.*
+io.esborg.starter.*
+io.estatico.*
+io.esticade.*
+io.etcd.*
+io.etcd.examples.*
+io.etrace.*
+io.evanwong.oss.*
+io.eventcenter.*
+io.eventuate.cdc.*
+io.eventuate.common.*
+io.eventuate.common.messaging.*
+io.eventuate.examples.common.*
+io.eventuate.local.java.*
+io.eventuate.messaging.activemq.*
+io.eventuate.messaging.http.*
+io.eventuate.messaging.kafka.*
+io.eventuate.messaging.rabbitmq.*
+io.eventuate.messaging.redis.*
+io.eventuate.platform.*
+io.eventuate.platform.testcontainer.support.*
+io.eventuate.plugins.gradle.*
+io.eventuate.tram.core.*
+io.eventuate.tram.sagas.*
+io.eventuate.tram.springcloudsleuth.*
+io.eventuate.tram.view.support.*
+io.eventuate.util.*
+io.everitoken.sdk.*
+io.everon.*
+io.evitadb.*
+io.evvo.*
+io.exemplary.aws.*
+io.exemplary.guice.*
+io.exoquery.*
+io.exotrom.jenkins.shared.space.*
+io.extasy.*
+io.extremum.*
+io.eyesprotocol.validator.*
+io.eyolas.http.*
+io.ezard.manuscript.*
+io.fabric8.*
+io.fabric8.apps.*
+io.fabric8.apps.devops.*
+io.fabric8.apps.ipaas.*
+io.fabric8.archetypes.*
+io.fabric8.assertj.*
+io.fabric8.bom.*
+io.fabric8.devops.apps.*
+io.fabric8.devops.distro.*
+io.fabric8.devops.find-projects.*
+io.fabric8.devops.packages.*
+io.fabric8.django.*
+io.fabric8.docker.*
+io.fabric8.elasticsearch.*
+io.fabric8.etcd.*
+io.fabric8.etcd.reader.*
+io.fabric8.examples.*
+io.fabric8.examples.fabric-camel-dosgi.*
+io.fabric8.fab.*
+io.fabric8.fab.tests.*
+io.fabric8.fabric8-team-components.apps.*
+io.fabric8.forge.*
+io.fabric8.forge.apps.*
+io.fabric8.forge.distro.*
+io.fabric8.forge.packages.*
+io.fabric8.funktion.*
+io.fabric8.funktion.apps.*
+io.fabric8.funktion.connector.*
+io.fabric8.funktion.distro.*
+io.fabric8.funktion.examples.*
+io.fabric8.funktion.packages.*
+io.fabric8.funktion.platform.*
+io.fabric8.funktion.runtimes.*
+io.fabric8.funktion.starter.*
+io.fabric8.insight.*
+io.fabric8.ipaas.*
+io.fabric8.ipaas.apps.*
+io.fabric8.ipaas.camel.*
+io.fabric8.ipaas.distro.*
+io.fabric8.ipaas.mq.*
+io.fabric8.ipaas.packages.*
+io.fabric8.ipaas.platform.*
+io.fabric8.ipaas.platform.distro.*
+io.fabric8.ipaas.platform.packages.*
+io.fabric8.itests.*
+io.fabric8.itests.autoscale.*
+io.fabric8.itests.paxexam.*
+io.fabric8.java-generator.*
+io.fabric8.jenkins.*
+io.fabric8.jenkins.packages.*
+io.fabric8.jenkins.pipelines.*
+io.fabric8.jenkins.plugins.*
+io.fabric8.jube.*
+io.fabric8.jube.images.*
+io.fabric8.jube.images.examples.*
+io.fabric8.jube.images.fabric8.*
+io.fabric8.jube.images.jboss.*
+io.fabric8.jube.images.jube.*
+io.fabric8.jube.images.quickstart.*
+io.fabric8.jube.images.wildfly.*
+io.fabric8.jube.itests.*
+io.fabric8.kubeflix.*
+io.fabric8.kubeflix.distro.*
+io.fabric8.kubeflix.examples.*
+io.fabric8.kubeflix.packages.*
+io.fabric8.kubernetes.*
+io.fabric8.launcher.*
+io.fabric8.mq.*
+io.fabric8.online.*
+io.fabric8.online.apps.*
+io.fabric8.online.distro.*
+io.fabric8.online.packages.*
+io.fabric8.patch.*
+io.fabric8.platform.*
+io.fabric8.platform.apps.*
+io.fabric8.platform.console.*
+io.fabric8.platform.console2.*
+io.fabric8.platform.distro.*
+io.fabric8.platform.packages.*
+io.fabric8.portswizzler.*
+io.fabric8.quickstarts.*
+io.fabric8.release.*
+io.fabric8.release.packages.*
+io.fabric8.runtime.*
+io.fabric8.samples.*
+io.fabric8.schemagenerator.*
+io.fabric8.security.*
+io.fabric8.security.sso.activemq.*
+io.fabric8.security.sso.client.*
+io.fabric8.support.*
+io.fabric8.tenant.*
+io.fabric8.tenant.apps.*
+io.fabric8.tenant.packages.*
+io.fabric8.tooling.testing.*
+io.fabric8.updatebot.*
+io.fabric8.zipkin.*
+io.fabric8.zipkin.examples.*
+io.fabric8.zipkin.packages.*
+io.failify.*
+io.failify.samples.*
+io.falu.*
+io.fares.bind.jackson.discovery.*
+io.fares.bind.xjc.plugins.*
+io.fares.design.builder.*
+io.fares.junit.mongodb.*
+io.fares.junit.soapui.*
+io.fares.maven.plugins.*
+io.fastjson.*
+io.fastjson.bnsf.*
+io.fastra.*
+io.fastra.mqtt.*
+io.fastup.*
+io.featureflow.*
+io.featurehub.cloudevents.*
+io.featurehub.composites.*
+io.featurehub.edge.*
+io.featurehub.mr.*
+io.featurehub.mr.sdk.*
+io.featurehub.sdk.*
+io.featurehub.sdk.composites.*
+io.featurehub.sdk.tiles.*
+io.featurehub.strategies.*
+io.featurehub.tooling.*
+io.federecio.*
+io.feistel.*
+io.feling.*
+io.femo.*
+io.fency.*
+io.ffit.carbon.*
+io.filepicker.*
+io.finarkein.*
+io.finarkein.auth.*
+io.finarkein.flux.*
+io.finarkein.flux.fiber.*
+io.findify.*
+io.finix.payments.processing.client.*
+io.finnhub.*
+io.fintrospect.*
+io.firebus.*
+io.firedome.*
+io.fission.*
+io.fixprotocol.*
+io.fixprotocol.orchestra.*
+io.fixprotocol.orchestrations.*
+io.fixprotocol.sbe.*
+io.fixprotocol.silverflash.*
+io.fixprotocol.tablature.*
+io.fledware.*
+io.flexify.*
+io.flexio.*
+io.flexio.commons.*
+io.flexio.io.*
+io.flightmap.app-android.*
+io.flinkspector.*
+io.flipt.*
+io.floodgate.*
+io.floodplain.*
+io.florianlopes.*
+io.flowcov.*
+io.flowthings.*
+io.flowup.*
+io.fluentlenium.*
+io.fluidsonic.cldr.*
+io.fluidsonic.compiler.*
+io.fluidsonic.country.*
+io.fluidsonic.css.*
+io.fluidsonic.currency.*
+io.fluidsonic.dataloader.*
+io.fluidsonic.gradle.*
+io.fluidsonic.graphql.*
+io.fluidsonic.i18n.*
+io.fluidsonic.json.*
+io.fluidsonic.locale.*
+io.fluidsonic.meta.*
+io.fluidsonic.mirror.*
+io.fluidsonic.mongo.*
+io.fluidsonic.pdf.*
+io.fluidsonic.raptor.*
+io.fluidsonic.react.*
+io.fluidsonic.server.*
+io.fluidsonic.stdlib.*
+io.fluidsonic.time.*
+io.fluo.*
+io.flux-capacitor.*
+io.fluxx.*
+io.fnproject.fn.*
+io.fnproject.fn.examples.*
+io.focuspoints.*
+io.fogsy.*
+io.foldables.*
+io.foldright.*
+io.foojay.api.*
+io.forestframework.*
+io.formapi.*
+io.foxcapades.lib.*
+io.foxcapades.lib.annotations.*
+io.foxcapades.lib.kps.*
+io.frama.parisni.*
+io.frebel.*
+io.freefair.aggregate-jacoco-report.*
+io.freefair.aggregate-javadoc-jar.*
+io.freefair.aggregate-javadoc-legacy.*
+io.freefair.aggregate-javadoc.*
+io.freefair.android-colors.*
+io.freefair.aspectj.*
+io.freefair.aspectj.base.*
+io.freefair.aspectj.post-compile-weaving.*
+io.freefair.code-generator.*
+io.freefair.compress.*
+io.freefair.compress.7z.*
+io.freefair.compress.ar.*
+io.freefair.compress.cpio.*
+io.freefair.compress.trees.*
+io.freefair.git-version.*
+io.freefair.github.base.*
+io.freefair.github.dependency-manifest.*
+io.freefair.github.dependency-submission.*
+io.freefair.github.package-registry-maven-publish.*
+io.freefair.github.pom.*
+io.freefair.gradle.*
+io.freefair.javadoc-links.*
+io.freefair.javadoc-utf-8.*
+io.freefair.javadocs.*
+io.freefair.jsass-base.*
+io.freefair.jsass-java.*
+io.freefair.jsass-war.*
+io.freefair.jsass-webjars.*
+io.freefair.lombok.*
+io.freefair.maven-central.validate-poms.*
+io.freefair.maven-optional.*
+io.freefair.maven-plugin.*
+io.freefair.maven-publish-java.*
+io.freefair.maven-publish-war.*
+io.freefair.mjml.base.*
+io.freefair.mjml.java.*
+io.freefair.mkdocs.*
+io.freefair.okhttp-spring-boot.*
+io.freefair.okhttp.*
+io.freefair.plantuml.*
+io.freefair.quicktype.*
+io.freefair.sass-base.*
+io.freefair.sass-java.*
+io.freefair.sass-war.*
+io.freefair.sass-webjars.*
+io.freefair.settings.plugin-versions.*
+io.freefair.war-archive-classes.*
+io.freefair.war-attach-classes.*
+io.freefair.war-overlay.*
+io.freefair.war.*
+io.freemonads.*
+io.frees.*
+io.freestar.*
+io.freshpaint.android.*
+io.freshpaint.android.integrations.*
+io.fria.*
+io.fria.lilo.*
+io.frontroute.*
+io.fruitful.*
+io.fruitful.binding.*
+io.fruitful.collectionmodule.*
+io.fruitful.dotprogress.*
+io.fruitful.highlightext.*
+io.fruitful.navigator.*
+io.fsaap.platform.common.*
+io.fsq.*
+io.functionalj.*
+io.funkode.*
+io.funkyminds.*
+io.funtom.*
+io.fusionauth.*
+io.futuristic.*
+io.fxlabs.*
+io.fyno.*
+io.fyno.kotlin-sdk.*
+io.g740.*
+io.gaia-pipeline.*
+io.gamedock.sdk.*
+io.gameoftrades.*
+io.gameup.android.*
+io.gamioo.*
+io.garam.*
+io.gardenerframework.camellia.*
+io.gardenerframework.fragrans.*
+io.gate.*
+io.gatling.*
+io.gatling.advantageous.boon.*
+io.gatling.com.zaxxer.*
+io.gatling.frontline.*
+io.gatling.highcharts.*
+io.gatling.uncommons.maths.*
+io.gatling.vtd.*
+io.gdcc.*
+io.geekabyte.ristex.*
+io.geekbytes.*
+io.geewit.boot.*
+io.geewit.cache.*
+io.geewit.core.*
+io.geewit.data.*
+io.geewit.oltu.commons.*
+io.geewit.oltu.jose.*
+io.geewit.oltu.oauth2.*
+io.geewit.oltu.oidc.*
+io.geewit.utils.core.*
+io.geewit.utils.core.gw-core-codec-utils.2.0.38.io.geewit.utils.core.*
+io.geewit.utils.core.gw-core-codec-utils.2.0.38.io.geewit.utils.web.*
+io.geewit.utils.web.*
+io.geewit.web.*
+io.geewit.weixin.*
+io.geewit.weixin.api.*
+io.geewit.weixin.event.*
+io.generators.*
+io.geobyte.commons.*
+io.geobyte.geojson.*
+io.geobyte.leaflet4jsf.*
+io.geobyte.websocket.*
+io.georocket.*
+io.get-coursier.*
+io.get-coursier.jarjar.*
+io.get-coursier.jniutils.*
+io.get-coursier.mill.*
+io.get-coursier.publish.*
+io.get-coursier.sbt.*
+io.get-coursier.scala-native.*
+io.get-coursier.util.*
+io.getclump.*
+io.getconnect.*
+io.getkyo.*
+io.getlime.app.*
+io.getlime.core.*
+io.getlime.security.*
+io.getmage.android.*
+io.getmedusa.*
+io.getnelson.api.*
+io.getnelson.helm.*
+io.getnelson.knobs.*
+io.getnelson.nelson.*
+io.getnelson.platypus.*
+io.getnelson.quiver.*
+io.getquill.*
+io.getstream.*
+io.getstream.client.*
+io.getunleash.*
+io.ghostwriter.*
+io.gierla.reactivecomponents.*
+io.gierla.typedrecyclerview.*
+io.gige.*
+io.ginko.*
+io.gitee.Bowen-Lee.*
+io.gitee.ForteScarlet.*
+io.gitee.ForteScarlet.plusutils.*
+io.gitee.GaiJoon.*
+io.gitee.ZephyrCui.*
+io.gitee.a3077932030.*
+io.gitee.afucloud.*
+io.gitee.aghp.*
+io.gitee.ah-circle.*
+io.gitee.ai-paas.*
+io.gitee.aj_mayu.*
+io.gitee.alanfenng.*
+io.gitee.aluka8023.*
+io.gitee.an-zhisiwei---qingdao_0.*
+io.gitee.ank_code.*
+io.gitee.antopen.*
+io.gitee.anwena.*
+io.gitee.any-design.*
+io.gitee.asialjim.*
+io.gitee.awyoo.*
+io.gitee.baicaixiaozhan.*
+io.gitee.bao-yuanye.*
+io.gitee.bengele.*
+io.gitee.benming110.*
+io.gitee.binai.*
+io.gitee.binaryfox.*
+io.gitee.birds-of-prey.*
+io.gitee.blogg.*
+io.gitee.buzizhi.*
+io.gitee.caixiadao.*
+io.gitee.caoxiaoyu97.*
+io.gitee.ccgkxdy.*
+io.gitee.cg1021.*
+io.gitee.chearnee.*
+io.gitee.chearnee.fw.*
+io.gitee.chemors.*
+io.gitee.chippyer.*
+io.gitee.chming7.*
+io.gitee.chordwang.*
+io.gitee.cikaros.*
+io.gitee.cjjjune.*
+io.gitee.cloudladder.*
+io.gitee.cly2012.*
+io.gitee.cmmboy.*
+io.gitee.cntool.*
+io.gitee.cnwisdom_liborui.*
+io.gitee.continental-dada.*
+io.gitee.dccjll.*
+io.gitee.declear.*
+io.gitee.deep_feel.*
+io.gitee.djhkemr.*
+io.gitee.djm123.*
+io.gitee.djxchi.*
+io.gitee.dongjeremy.*
+io.gitee.double_leaves.*
+io.gitee.dqcer.*
+io.gitee.dw-project.*
+io.gitee.eixo.*
+io.gitee.ethan-osc_admin.*
+io.gitee.fire_erudition.*
+io.gitee.firstao.*
+io.gitee.fly_block.*
+io.gitee.fpzhan.*
+io.gitee.gan_jian_wen_main.*
+io.gitee.geminidev.bot.*
+io.gitee.gfh_7067576_admin.*
+io.gitee.gignn.*
+io.gitee.goudadong.*
+io.gitee.gourd-eva.*
+io.gitee.grtsc.*
+io.gitee.h25094152.*
+io.gitee.hai2007.servicer.*
+io.gitee.he-fu-lin.*
+io.gitee.hejinjin.*
+io.gitee.hello-go.*
+io.gitee.hihopeorg.*
+io.gitee.hjzq.*
+io.gitee.huang-guiming.*
+io.gitee.huaxun-ink.*
+io.gitee.huaxun-ink.constant.*
+io.gitee.hwcgetit.*
+io.gitee.hziee514.*
+io.gitee.ijero.*
+io.gitee.it_fk.*
+io.gitee.jaemon.*
+io.gitee.jetmit.*
+io.gitee.jinceon.*
+io.gitee.jiujiupin.*
+io.gitee.johnpeng.*
+io.gitee.kevin_kuang_93.*
+io.gitee.kingdonwang.*
+io.gitee.kotle.*
+io.gitee.kould.*
+io.gitee.kroup.*
+io.gitee.l_j_d.*
+io.gitee.laoshirenggo.*
+io.gitee.leukotrichia.*
+io.gitee.lglbc.*
+io.gitee.lgsg.*
+io.gitee.liqm-b.*
+io.gitee.litingbin.*
+io.gitee.litong.*
+io.gitee.liu_qinglong.*
+io.gitee.liuhuayun.*
+io.gitee.liukaixiong.*
+io.gitee.liuzhihai520.*
+io.gitee.lk0423.*
+io.gitee.long-zhangming.*
+io.gitee.loulan_yxq.*
+io.gitee.lshaci.*
+io.gitee.ludii.*
+io.gitee.luoqiz.*
+io.gitee.luozhaogong.*
+io.gitee.lyf20200320.*
+io.gitee.lzx411559669.*
+io.gitee.marslilei.*
+io.gitee.mayan50.*
+io.gitee.mcolley.*
+io.gitee.meishihao123.*
+io.gitee.mightlin.*
+io.gitee.miixlDeKongJian.*
+io.gitee.minelx.*
+io.gitee.mingbaobaba.*
+io.gitee.mrxangel.*
+io.gitee.myandroidlearn.*
+io.gitee.needcoke.*
+io.gitee.oneMiku.*
+io.gitee.ordinarykai.*
+io.gitee.osarms.*
+io.gitee.osnetwork.*
+io.gitee.osnetwort.*
+io.gitee.passer-team.*
+io.gitee.perry_fan.*
+io.gitee.pickled_vegetables.*
+io.gitee.podigua.*
+io.gitee.purefrends.*
+io.gitee.putaoo.*
+io.gitee.qiangdaba.*
+io.gitee.qincji.*
+io.gitee.qinjie1314.*
+io.gitee.qq1134380223.*
+io.gitee.qqxqq.*
+io.gitee.qrkcn.*
+io.gitee.quanwenz.*
+io.gitee.rainlotus98.*
+io.gitee.renhaisong.*
+io.gitee.reywong.*
+io.gitee.sbolo.*
+io.gitee.sections.*
+io.gitee.seening.*
+io.gitee.shizichao.*
+io.gitee.snddbgydw.*
+io.gitee.sojoys.*
+io.gitee.solarterms.*
+io.gitee.spongebobpineapple-house.*
+io.gitee.srccode.*
+io.gitee.srccode.context-inject.*
+io.gitee.stayrational.*
+io.gitee.stone4j.*
+io.gitee.su-qiu.*
+io.gitee.sunjx93.*
+io.gitee.sunpeng2023.*
+io.gitee.super-sophon.*
+io.gitee.szq53331802.*
+io.gitee.tengjijing.*
+io.gitee.thant.*
+io.gitee.thc.*
+io.gitee.the-best-riven.*
+io.gitee.thinkBungee.*
+io.gitee.thinkbungee.*
+io.gitee.tonggong.*
+io.gitee.tooleek.*
+io.gitee.uexpo_1.*
+io.gitee.unix8.*
+io.gitee.vesdk.*
+io.gitee.vinrichard.*
+io.gitee.wang_ming_yi.*
+io.gitee.weir_admin.*
+io.gitee.wongchan.*
+io.gitee.wxlibowen.*
+io.gitee.wywxy.*
+io.gitee.wyy1994.*
+io.gitee.xiao_y_y.*
+io.gitee.xiaomaomi-xj.*
+io.gitee.xinsuinian.*
+io.gitee.xqs0317.*
+io.gitee.xuchenoak.*
+io.gitee.xuqiudong.*
+io.gitee.xushaoguo1995.*
+io.gitee.xzhix.*
+io.gitee.yan_wei_hua.*
+io.gitee.yandeqing.*
+io.gitee.yanyuxin.*
+io.gitee.yiwyn.*
+io.gitee.yjjk_1.*
+io.gitee.yjjk_1.android.*
+io.gitee.yswysw.*
+io.gitee.yuhaibin.*
+io.gitee.yunlongn.*
+io.gitee.yuygoi.*
+io.gitee.zay9p02.*
+io.gitee.zero-wsh.*
+io.gitee.zhang-yanning.*
+io.gitee.zhang-yiya.*
+io.gitee.zhangbinhub.acp.*
+io.gitee.zhangbinhub.acp.boot.*
+io.gitee.zhangbinhub.acp.cloud.*
+io.gitee.zhangbinhub.acp.core.*
+io.gitee.zhangbinhub.acp.dependency.*
+io.gitee.zhangsisiyao.*
+io.gitee.zhangwentao.*
+io.gitee.zhangzhiwei-zzw.*
+io.gitee.zhenergy.*
+io.gitee.zhengchengdong.*
+io.gitee.zherc.*
+io.gitee.zhishuaijunn.*
+io.gitee.zhongte.*
+io.gitee.zhousiwei.*
+io.gitee.zhucan123.*
+io.gitee.zhuyunlong2018.*
+io.gitee.zjbqdzq.*
+io.gitee.zlbjs.*
+io.gitee.zodiacstack.*
+io.gitee.zodiacstack.quaf.*
+io.gitee.zqycl.*
+io.gitee.zwenbobo.*
+io.gitee.zxing2021.*
+io.gitee.zycn328171146.*
+io.gitee.zznote.*
+io.gitee.zzxygitee.*
+io.github.*
+io.github.0123456hahaha0123456.*
+io.github.0123456hahaha0123456.duc.gradle.*
+io.github.029vaibhav.*
+io.github.0xera.*
+io.github.0xpolygonid.polygonid_android_sdk.*
+io.github.0xpolygonid.polygonid_flutter_sdk.*
+io.github.0xpolygonid.polygonid_flutter_wrapper.*
+io.github.0xvoila.*
+io.github.100ferhas.*
+io.github.100mslive.*
+io.github.100nandoo.*
+io.github.1024hertz-hodgepodge.*
+io.github.114snehasish.*
+io.github.11904212.*
+io.github.13126851612.*
+io.github.1351360552.*
+io.github.136750162.*
+io.github.1455033987.*
+io.github.1479HuangDa.*
+io.github.15198184721.*
+io.github.15608447849.*
+io.github.1583511688wow.*
+io.github.1994.*
+io.github.1997chang.*
+io.github.19ucs112.*
+io.github.1c-syntax.*
+io.github.1tchy.*
+io.github.1tchy.java9modular.*
+io.github.1tchy.java9modular.org.apache.commons.*
+io.github.1tchy.shaded.com.h2database.*
+io.github.1yukikaze.*
+io.github.2220810599.*
+io.github.2268143474.*
+io.github.2307vivek.*
+io.github.247452312.*
+io.github.291700351.*
+io.github.2bllw8.*
+io.github.2gis.*
+io.github.2lbj.*
+io.github.2ysp.*
+io.github.3moeslam.*
+io.github.417-72ki.*
+io.github.4drian3d.*
+io.github.4sh.datamaintain.*
+io.github.4sh.retable.*
+io.github.506954774.*
+io.github.52ylx.*
+io.github.574996894.*
+io.github.5v1988.*
+io.github.6point6.*
+io.github.79121262.*
+io.github.805369979.*
+io.github.864282291.*
+io.github.89iuv.*
+io.github.920651004.*
+io.github.969025903.*
+io.github.972424611.*
+io.github.985892345.*
+io.github.987nabil.*
+io.github.9ins.*
+io.github.Aas-ee.*
+io.github.AdaricGame.*
+io.github.Afanyifu.*
+io.github.Ahmed-Abdel-aziz.*
+io.github.Al-Hussein-96.*
+io.github.Al-PdR.*
+io.github.AleksicNikola00.*
+io.github.AllenKu0.*
+io.github.AmalH.*
+io.github.AnLaVN.*
+io.github.AndroiddevnapID.*
+io.github.Antonovvv.*
+io.github.ApamateSoft.*
+io.github.AppNetlink.*
+io.github.Arjen10.*
+io.github.ArtyomPanfutov.*
+io.github.Ashu7950.*
+io.github.Aussama-Ul-Islam.*
+io.github.Avril1.*
+io.github.BAByte.*
+io.github.BeardedManZhao.*
+io.github.BlueOcean1998.*
+io.github.Bow-JST.*
+io.github.CDAGaming.*
+io.github.CHENkai8385.*
+io.github.Caratacus.*
+io.github.CashCat22.*
+io.github.ChinaVolvocars.*
+io.github.ChivoxSupport.*
+io.github.Chung10Kr.*
+io.github.ClearloveX7.*
+io.github.CodeTrainerMan.*
+io.github.Core310.*
+io.github.CyberAgent.*
+io.github.CyberXavier.*
+io.github.DDAaTao.*
+io.github.DJH1233.*
+io.github.Dango-dx.*
+io.github.DangoDX.*
+io.github.DaniilRoman.*
+io.github.DarkAssassinator.*
+io.github.Darkprnce.*
+io.github.Databeans.*
+io.github.DeveKing7.*
+io.github.DigitalUnion.*
+io.github.DrantDev.*
+io.github.EdaySoftGame.*
+io.github.EdgeSolution.*
+io.github.Ethan0507.*
+io.github.FDoubleman.*
+io.github.FHfirehuo.*
+io.github.FNCYchain.*
+io.github.FacePlusPlus.*
+io.github.FadhiliFumwa-alation.*
+io.github.Feiyizhan.*
+io.github.Fi0x.*
+io.github.FlyJingFish.*
+io.github.FlyJingFish.OpenImage.*
+io.github.ForteScarlet.*
+io.github.ForteScarlet.plusutils.*
+io.github.ForteScarlet.simple-robot-core.*
+io.github.ForteScarlet.simple-robot-module.*
+io.github.ForteScarlet.simple-robot.*
+io.github.FouadKom.*
+io.github.GameDevTurbo.*
+io.github.GentleThug.*
+io.github.GitHub-Xzhi.*
+io.github.Gleidson28.*
+io.github.Gleidson28.decorator.*
+io.github.H0n0riuss.*
+io.github.HHa1ey.*
+io.github.HHs11.*
+io.github.Hacker1248084491.*
+io.github.Harlantown.*
+io.github.HarshitPersona.*
+io.github.Hikarimiku.*
+io.github.HollandZang.*
+io.github.HuChen-dot.*
+io.github.HycHcl.*
+io.github.IAmCodingCoding.*
+io.github.JDhaut.*
+io.github.JackLee992.*
+io.github.JayeshMardiya.*
+io.github.Joehaivo.*
+io.github.John-Smith-Dav.*
+io.github.JowsNunez.*
+io.github.Junkmer.*
+io.github.K-CCinc.*
+io.github.KILLER2017.*
+io.github.KKH0730.*
+io.github.KSamima.*
+io.github.Kcud.*
+io.github.Kimjiyo0oN.*
+io.github.Kingcool759.*
+io.github.Kingforv.*
+io.github.Kino521.*
+io.github.Kloping.*
+io.github.LCoder1024.*
+io.github.Leney.*
+io.github.LeoKingdom.*
+io.github.Leomrlin.*
+io.github.LiJunYi2.*
+io.github.LiePy.*
+io.github.LilG123.*
+io.github.Lindelt.*
+io.github.Lotin822.*
+io.github.LuccaBoets.*
+io.github.LuizYokoyama.*
+io.github.MaciejG604.*
+io.github.Mastercard-Platform.*
+io.github.Matij.*
+io.github.Merry74751.*
+io.github.MichaPehlivan.*
+io.github.Michaelibrahim93.*
+io.github.MigadaTang.*
+io.github.MikAoJk.*
+io.github.Miroso02.*
+io.github.Mkean.*
+io.github.ModularEnigma.*
+io.github.Mom0aut.*
+io.github.MrFishC.*
+io.github.MrTangBo.*
+io.github.MrZWC.*
+io.github.NYK1024212458.*
+io.github.NakulSabharwal.*
+io.github.NateshR.*
+io.github.NavjotSRakhra.*
+io.github.NevetScar.*
+io.github.NicHub-Semprini.*
+io.github.Nil-cire.*
+io.github.NuclearInstruments.*
+io.github.Onionsss.*
+io.github.Owenli0202.*
+io.github.ParkSangGwon.*
+io.github.PobyCoder.*
+io.github.Poseidon-R.*
+io.github.PranavNair0001.*
+io.github.RafaelShift.*
+io.github.RafhaelSouza.*
+io.github.RedRackham-R.*
+io.github.Reg1283251.*
+io.github.ReleaseStandard.CodeEditor.*
+io.github.ReleaseStandard.CodeEditor.editor.*
+io.github.ReleaseStandard.CodeEditor.emptyPlugin.*
+io.github.ReleaseStandard.CodeEditor.languages.*
+io.github.ReleaseStandard.CodeEditor.logger-debug.*
+io.github.ReleaseStandard.CodeEditor.widget-linenumber.*
+io.github.ReleaseStandard.CodeEditor.widget-symbolinput.*
+io.github.ReleaseStandard.CodeEditorlogger-debug.*
+io.github.Rhythm-2019.*
+io.github.Riduidel.aadarchi.*
+io.github.Riduidel.agile-architecture-documentation-system.*
+io.github.Rosemoe.CodeEditor.*
+io.github.Rosemoe.sora-editor.*
+io.github.SSTentacleSS.mindustry.*
+io.github.SaH1367321.*
+io.github.Savion1162336040.*
+io.github.SepCzp.*
+io.github.SethEpic.*
+io.github.SharinPix.*
+io.github.ShawnLin013.*
+io.github.ShawnkuoMEXC.*
+io.github.ShiftF6-MX.*
+io.github.SimpleCodeMaker.*
+io.github.Sounean.*
+io.github.Spatio-Temporal-Lab.*
+io.github.Ssungkim9999.*
+io.github.Strive357.*
+io.github.Strive357.catapi-common.*
+io.github.Sum-sdl.*
+io.github.SummerMineJack.*
+io.github.TengShiSource.*
+io.github.TestPlanB.*
+io.github.TheMelody.*
+io.github.TheRealjavisKong.*
+io.github.TheSparklingStarrySky.*
+io.github.ThomasChant.*
+io.github.ThomasChant.jpa-plus.*
+io.github.Thomaswoood.*
+io.github.ThreeSidea.*
+io.github.TomaszReda.*
+io.github.TradersTeam.*
+io.github.Trimuchinni.*
+io.github.TrustlyInc.*
+io.github.USAMAWIZARD.*
+io.github.Version1.*
+io.github.VinceKgb.*
+io.github.VladimirSergeevichFedorov.*
+io.github.WCaiZhu.*
+io.github.WandererXII.*
+io.github.WavJaby.*
+io.github.WeLoopTeam.*
+io.github.WeronikaJargielo.*
+io.github.WuFengXue.*
+io.github.WuShang-3306.*
+io.github.XibalbaM.*
+io.github.YLZylkj.*
+io.github.YXxy1002.*
+io.github.Yash-777.*
+io.github.Youth-KanDian.*
+io.github.ZCSDK.*
+io.github.ZJU-ACES-ISE.*
+io.github.ZY945.utils.*
+io.github.Zelax1024.*
+io.github.ZeronDev.*
+io.github.Zhang-Kezheng.*
+io.github.ZhongFuCheng3y.*
+io.github.a-blekot.*
+io.github.a-fistful-of-code.*
+io.github.a312588726.*
+io.github.a386572631.*
+io.github.a812086325.*
+io.github.a914-gowtham.*
+io.github.aa3615058.*
+io.github.aa41336160.*
+io.github.aa47kk.*
+io.github.aa86799.*
+io.github.aaabramov.*
+io.github.aafactory.*
+io.github.aafc-bicoe.*
+io.github.aag-ventures.*
+io.github.aagitoex.*
+io.github.aakira.*
+io.github.aalbul.*
+io.github.aalda.*
+io.github.aapplet.*
+io.github.aaronanderson.*
+io.github.aaronjyoder.*
+io.github.aarshinkov.*
+io.github.aashitshah26.*
+io.github.abacef.*
+io.github.abaddon.*
+io.github.abaddon.kcqrs.*
+io.github.abaddon.testcontainer.*
+io.github.abaddon.testcontanier.*
+io.github.abarhub.*
+io.github.abciop.*
+io.github.abductcows.*
+io.github.abdus-shakur.*
+io.github.abertnguyen.*
+io.github.abg1979.maven.*
+io.github.abhaynaik-dev.*
+io.github.abhijeet4469.*
+io.github.abhilashsiyer.*
+io.github.abhinavminhas.*
+io.github.abhishekghoshh.*
+io.github.abhriyaroy.*
+io.github.abissell.*
+io.github.ablearthy.*
+io.github.ableron.*
+io.github.abocidee.*
+io.github.abvadabra.*
+io.github.accipiter2000.*
+io.github.acdcjunior.*
+io.github.ace-design.*
+io.github.acecandy.*
+io.github.acehua.*
+io.github.acelost.*
+io.github.acgnnsj.*
+io.github.acgs-org.*
+io.github.achacha.*
+io.github.achelois-armoury.*
+io.github.achtern.*
+io.github.achuala.*
+io.github.acinmavi.*
+io.github.ackeecz.*
+io.github.ackeescreenshoter.*
+io.github.ackuq.*
+io.github.aclisp.*
+io.github.acm19.*
+io.github.acmenlt.*
+io.github.acoboh.*
+io.github.acoustic-analytics.*
+io.github.acshmily.*
+io.github.acuccovi.*
+io.github.acuccovi.maven.*
+io.github.acuccovi.validator.*
+io.github.adalbert44.*
+io.github.adambl4.*
+io.github.adamhamlin.*
+io.github.adamkorcz.*
+io.github.adarryring.*
+io.github.adasupport.*
+io.github.addario-org.*
+io.github.adelbertc.*
+io.github.adempiere.*
+io.github.adessose.*
+io.github.adibfara.listgen.*
+io.github.adityabavadekar.*
+io.github.adityakumar28.*
+io.github.adj5672.*
+io.github.adlered.*
+io.github.admin1475963.*
+io.github.admin4j.*
+io.github.adnanomerovic.*
+io.github.adon92.*
+io.github.adorable-skullmaster.*
+io.github.adr.*
+io.github.adraffy.*
+io.github.adrianjuhl.*
+io.github.adriankhl.*
+io.github.adrianmo.*
+io.github.adrianosiqueira.*
+io.github.adrianulbona.*
+io.github.adriens.*
+io.github.adtechservice.*
+io.github.adv4nt4ge.*
+io.github.advantagefse.*
+io.github.adven27.*
+io.github.advwacloud.*
+io.github.aecsocket.*
+io.github.aelho.*
+io.github.aemmie.*
+io.github.aerospike-examples.*
+io.github.af19git5.*
+io.github.afalabarce.*
+io.github.afap.*
+io.github.afezeria.*
+io.github.afkt.*
+io.github.afsalthaj.*
+io.github.afzalriz304.*
+io.github.ag88.*
+io.github.agamula90.*
+io.github.agcom.*
+io.github.agdturner.*
+io.github.agebe.*
+io.github.agebhar1.*
+io.github.agenthun.*
+io.github.agentsoz.*
+io.github.aghajari.*
+io.github.agileek.*
+io.github.agolovenko.*
+io.github.agoraio-community.*
+io.github.agoraio-usecase.*
+io.github.agoraio-usecase.capture.*
+io.github.agoraio-usecase.common.*
+io.github.agoraio-usecase.meeting.*
+io.github.agoraio-usecase.tools.*
+io.github.agoralab.*
+io.github.agrawalashish1990.*
+io.github.agrawald.*
+io.github.agrevster.*
+io.github.agrica.*
+io.github.agsimeonov.*
+io.github.agus5534.*
+io.github.ahd2254.*
+io.github.ahfz.sdk.*
+io.github.ahjohannessen.*
+io.github.ahmad-hamwi.*
+io.github.ahmadaltayeh.*
+io.github.ahmed-abdel-aziz.*
+io.github.ahmedagdmoun.*
+io.github.ahmedagdmoun.tools.ide.*
+io.github.ahmedagdmoun.tools.ide.dev.*
+io.github.ahmedelkolfat.*
+io.github.ahmedkhaledak.*
+io.github.ahmednader65.*
+io.github.ahmedriahi.*
+io.github.ahmerafzal1.*
+io.github.aholland.*
+io.github.ahsirg.*
+io.github.ahsirg.scheduling.*
+io.github.aigens.order.place.*
+io.github.aijavaer.*
+io.github.aileben.*
+io.github.ailll.*
+io.github.air-foi-hr.*
+io.github.air-iot.*
+io.github.airnowplatform.*
+io.github.airwallex.*
+io.github.airxiechao.*
+io.github.aiuiplayer.*
+io.github.aixmi.*
+io.github.ajacquierbret.*
+io.github.ajantha8.*
+io.github.ajclopez.*
+io.github.akang943578.*
+io.github.akayibrahim.*
+io.github.akibanoichiichiyoha.*
+io.github.akiomik.*
+io.github.akmtool.*
+io.github.akornatskyy.*
+io.github.akri16.*
+io.github.aksharp.*
+io.github.akshathraghav.*
+io.github.akshay-thakare.*
+io.github.aktoluna.*
+io.github.akvelon.*
+io.github.alacu.*
+io.github.alaksion.*
+io.github.aland-1415.*
+io.github.alandelon.*
+io.github.alanhay.*
+io.github.alanpeng899.*
+io.github.alaugks.*
+io.github.albanybuipe96.*
+io.github.alberto-hernandez.*
+io.github.alberto-perez-1994.*
+io.github.albertopires.utils.*
+io.github.albertus82.*
+io.github.albertus82.storage.*
+io.github.albertzyc.*
+io.github.albilu.*
+io.github.albinchang.*
+io.github.ale-openness.o2g.*
+io.github.alecarnevale.*
+io.github.aleksas.*
+io.github.alekseysotnikov.*
+io.github.aleonq.*
+io.github.aleonq.kmp.*
+io.github.aleris.*
+io.github.alesaudate.*
+io.github.alessandropaparella.*
+io.github.alex-hcf.*
+io.github.alex-only.*
+io.github.alexanderprendota.*
+io.github.alexanderschuetz97.*
+io.github.alexandertang.*
+io.github.alexandrehtrb.*
+io.github.alexandrepiveteau.*
+io.github.alexarchambault.*
+io.github.alexarchambault.ammonite.*
+io.github.alexarchambault.bleep.*
+io.github.alexarchambault.deps.*
+io.github.alexarchambault.json-rpc.*
+io.github.alexarchambault.libdaemon.*
+io.github.alexarchambault.mill.*
+io.github.alexarchambault.py4j.*
+io.github.alexarchambault.python.*
+io.github.alexarchambault.sbt.*
+io.github.alexarchambault.scala-cli.*
+io.github.alexarchambault.scala-cli.signing.*
+io.github.alexarchambault.scala-cli.snailgun.*
+io.github.alexarchambault.scala-cli.tmp.*
+io.github.alexarchambault.test.*
+io.github.alexarchambault.tmp.*
+io.github.alexarchambault.tmp.ipcsocket.*
+io.github.alexarchambault.tmp.libsodiumjni.*
+io.github.alexarchambault.tmp.test.*
+io.github.alexarchambault.windows-ansi.*
+io.github.alexengrig.*
+io.github.alexeyike.*
+io.github.alexgladkov.*
+io.github.alexis779.*
+io.github.alexisvisco.*
+io.github.alexkamanin.*
+io.github.alexlampa.*
+io.github.alexmaryin.*
+io.github.alexmaryin.metarkt.*
+io.github.alexmofer.appcompat.*
+io.github.alexmofer.clipboard.*
+io.github.alexmofer.drawable.*
+io.github.alexmofer.font.*
+io.github.alexmofer.ftp.*
+io.github.alexmofer.job.*
+io.github.alexmofer.multiprocesssharedpreferences.*
+io.github.alexmofer.mvp.*
+io.github.alexmofer.printer.*
+io.github.alexmofer.retrofit.*
+io.github.alexmofer.tool.*
+io.github.alexmofer.widget.*
+io.github.alexo.*
+io.github.alexswilliams.*
+io.github.alexwatts.*
+io.github.alexyavo.*
+io.github.alexzhyshko.*
+io.github.alfeilex.*
+io.github.alfeilex.tools.ide.*
+io.github.alfrad.*
+io.github.algomaster99.*
+io.github.algorixco.*
+io.github.ali-ghanbari.*
+io.github.ali-rezaei.*
+io.github.ali1995reza.*
+io.github.aliaksandrrachko.*
+io.github.aliaksei-karaliou.*
+io.github.alibek228k.*
+io.github.alice52.*
+io.github.aliceapps.*
+io.github.alifgarindra.*
+io.github.alihaider63.*
+io.github.alikelleci.*
+io.github.alikian.*
+io.github.aliothliu.*
+io.github.alireza-milani.*
+io.github.alisonfahl.*
+io.github.alitajs.*
+io.github.alittlehuang.*
+io.github.aliyun-beta.*
+io.github.aliyun-mq.*
+io.github.aliyun-sls.*
+io.github.aliyunmq.*
+io.github.aljoshakoecher.skillup.*
+io.github.alkincakiralar1996.vidoven.*
+io.github.allanhasegawa.kelm.*
+io.github.allanmarques83.*
+io.github.allegiaco.*
+io.github.allencui.*
+io.github.allenhub110.spring-boot.httpclient.*
+io.github.alleriawindrunner.*
+io.github.alleyway.*
+io.github.alliedium.ignite.migration.*
+io.github.allisonbrummer.*
+io.github.ally-financial.*
+io.github.almawave.ps.batch.manager.*
+io.github.almighty-satan.jaskl.*
+io.github.almogtavor.*
+io.github.alopukhov.gusp.*
+io.github.alopukhov.sybok.*
+io.github.alperbry.build-tracker-client.*
+io.github.alperenp.*
+io.github.alperensert.*
+io.github.alperensert.capmonster_java.*
+io.github.alphabet-jumpfish.*
+io.github.alphagodzilla.*
+io.github.alphajiang.*
+io.github.alphicc.*
+io.github.alstanchev.*
+io.github.altapay.*
+io.github.altimedia-cloud.*
+io.github.alucardxy.*
+io.github.amaembo.*
+io.github.amaizeing.*
+io.github.aman0209.*
+io.github.amang06fa.*
+io.github.amank22.logvue.*
+io.github.amarcinkowski.*
+io.github.amaris.*
+io.github.amayaframework.*
+io.github.amazingSaltFish.*
+io.github.ambershogun.*
+io.github.ambiel127.*
+io.github.ambitiousliu.*
+io.github.amdb-dev.*
+io.github.amedal-1024.*
+io.github.amerainc.*
+io.github.amerousful.*
+io.github.amikos-tech.*
+io.github.aminbhst.*
+io.github.aminekarimii.*
+io.github.amings.*
+io.github.aminovmaksim.*
+io.github.amitsharma101.*
+io.github.amk-sdk.*
+io.github.amonglang.*
+io.github.amosalb.*
+io.github.amrdeveloper.*
+io.github.amrhassan.*
+io.github.amrjlg.*
+io.github.amuthansakthivel.*
+io.github.amuzanl.kotlin.*
+io.github.amyassist.*
+io.github.amzexin.*
+io.github.anakos.*
+io.github.ananananzhuo-blog.*
+io.github.anand1st.*
+io.github.anand405.*
+io.github.anandjaguar96.*
+io.github.anass-abea.*
+io.github.anborg.*
+io.github.andeb.*
+io.github.andello.*
+io.github.anderscheow.*
+io.github.anderson-marques.*
+io.github.andersoncrocha.*
+io.github.andersonfeng.*
+io.github.andjsrk.*
+io.github.andreabrighi.*
+io.github.andreacimminoarriaga.*
+io.github.andreagiulianelli.*
+io.github.andreamarcolin.*
+io.github.andreas-schroeder.*
+io.github.andreas-solti.matrix-toolkits-java.*
+io.github.andreas-solti.xeslite.*
+io.github.andrebeat.*
+io.github.andrelugomes.*
+io.github.andresguedes.*
+io.github.andrew-k-21-12.*
+io.github.andrew0000.*
+io.github.andrewauclair.ModernDocking.*
+io.github.andrewchupin.*
+io.github.andrewrigas.*
+io.github.andreww1011.*
+io.github.andreypfau.*
+io.github.andriamarosoa.*
+io.github.andrnv.*
+io.github.androidfred.*
+io.github.androidktx.*
+io.github.androidpoet.*
+io.github.andronikusgametech.*
+io.github.andviane.*
+io.github.andyalvarezdev.*
+io.github.aneelkkhatri.*
+io.github.anesuphiri521.*
+io.github.aneudeveloper.func.*
+io.github.aneudeveloper.func.engine.*
+io.github.angleto.*
+io.github.angpysha.*
+io.github.angpysha.iospicker.*
+io.github.anhorseg.*
+io.github.anikethreddy-c.*
+io.github.animatedledstrip.*
+io.github.animeshbhagwat.*
+io.github.anioutkazharkova.*
+io.github.anioutkazharkova.knn.*
+io.github.aniruddh-0701.*
+io.github.anisha1095.*
+io.github.anki-japan.*
+io.github.annippolito.*
+io.github.annocjx.*
+io.github.anon10w1z.*
+io.github.anoopsivarajan.*
+io.github.anovos.*
+io.github.anshdutt.*
+io.github.ansorre.*
+io.github.antany.*
+io.github.anthorx.*
+io.github.antimonit.*
+io.github.antivanov.*
+io.github.antoni25z.*
+io.github.antoniovizuete.*
+io.github.antonkharenko.*
+io.github.antonparshukov.*
+io.github.antonsjava.*
+io.github.antonybi.*
+io.github.ants-double.*
+io.github.antwhale.*
+io.github.anubisdenko.*
+io.github.anweber.*
+io.github.anyicomplex.*
+io.github.anylifezlb.*
+io.github.anyzm.*
+io.github.aochoa-cds.*
+io.github.aochoae.*
+io.github.aokush.*
+io.github.aomsweet.*
+io.github.aooohan.*
+io.github.apanashchenko.*
+io.github.aparnachaudhary.*
+io.github.apex-dev-tools.*
+io.github.apex-protocol.*
+io.github.api7.*
+io.github.apilogic-io.*
+io.github.apimatic.*
+io.github.apimorphism.*
+io.github.apisitkaewsasan.*
+io.github.apiumhub.*
+io.github.apkcloud.*
+io.github.apl-cornell.*
+io.github.apollokwok.*
+io.github.apolo49.pixelmk.*
+io.github.app-outlet.*
+io.github.appoptics.*
+io.github.appspirimentlabs.*
+io.github.aprietop.*
+io.github.apringframework.*
+io.github.aptusproject.*
+io.github.apulbere.*
+io.github.aquen.*
+io.github.ar-log.*
+io.github.ar-tool.*
+io.github.arainko.*
+io.github.arash-jahani.*
+io.github.arashiyama11.*
+io.github.aravind9494.*
+io.github.archangelx360.*
+io.github.archine.*
+io.github.architers.*
+io.github.architshah248.calendar.*
+io.github.archytas-it.*
+io.github.ardelhite.*
+io.github.ardoco.*
+io.github.ardoco.core.*
+io.github.arenas782.*
+io.github.aresxue.*
+io.github.aresxue.boot.*
+io.github.aresxue.boot.util.*
+io.github.argcc.*
+io.github.argonariod.*
+io.github.ari4java.*
+io.github.aristotll.*
+io.github.aritzhack.*
+io.github.ariyankhan.*
+io.github.arjun20398.*
+io.github.arjunarisang.*
+io.github.arjundandagi.*
+io.github.arjunguha.*
+io.github.arkc0s.*
+io.github.arkinator.*
+io.github.arkits.*
+io.github.arlixu.*
+io.github.arm-software.*
+io.github.armanayvazyan.*
+io.github.armindoantunes.*
+io.github.arniu.*
+io.github.arnowang1.*
+io.github.arpit-sharma-usc.*
+io.github.arpitnoob31.*
+io.github.arrudalabs.*
+io.github.arstechna.*
+io.github.artemmey.*
+io.github.artemnefedov.*
+io.github.artemptushkin.proxy.image.*
+io.github.artemy-osipov.thrift.*
+io.github.artfultom.*
+io.github.arther1228.*
+io.github.artificial-vulnerability-tools.*
+io.github.artislong.*
+io.github.artjourney.*
+io.github.artofcode-info.*
+io.github.artrayme.*
+io.github.artsok.*
+io.github.arttttt.*
+io.github.artur3280.*
+io.github.arturaz.*
+io.github.asakaev.*
+io.github.asarkisian.cframework.*
+io.github.ascopes.jct.*
+io.github.asd1614.*
+io.github.asdf101221.*
+io.github.asdfjkl.*
+io.github.asdfjkl.jchesslib.*
+io.github.asewhy.*
+io.github.asghar07.*
+io.github.asharapov.*
+io.github.asharapov.logtrace.*
+io.github.asharapov.nexus.*
+io.github.ashimjk.*
+io.github.ashish19goyal.*
+io.github.ashishdas1921.*
+io.github.ashishgkwd534.*
+io.github.ashishkujoy.*
+io.github.ashishmk.*
+io.github.ashl7.*
+io.github.ashr123.*
+io.github.ashu0000008.*
+io.github.ashuk203.*
+io.github.ashutoshgngwr.*
+io.github.ashwinbhaskar.*
+io.github.ashwinjay.*
+io.github.ashwithpoojary98.*
+io.github.askmeagain.*
+io.github.askua-dx.*
+io.github.asleepyfish.*
+io.github.asmain6.*
+io.github.asmanmirza.*
+io.github.asodja.*
+io.github.aspectmania-mc.*
+io.github.asperan.*
+io.github.asseco-pst.*
+io.github.assimbly.*
+io.github.assist-iot-sripas.*
+io.github.astaplet.*
+io.github.astinchoi.*
+io.github.astonbitecode.*
+io.github.astrapi69.*
+io.github.asvanberg.*
+io.github.atalisasowen.*
+io.github.atetzner.*
+io.github.atkawa7.*
+io.github.atlascommunity.*
+io.github.atmaramnaik.*
+io.github.atome-fe.*
+io.github.atomfinger.*
+io.github.atos-digital-id.*
+io.github.atpstorages.*
+io.github.attila-fazekas.*
+io.github.atty303.*
+io.github.auspiciouschan1.*
+io.github.autocomplete1.*
+io.github.automated-a11y.*
+io.github.automatik.*
+io.github.automationreddy.*
+io.github.automationsde.*
+io.github.autoparams.*
+io.github.autumn-framework.*
+io.github.autumnforestboy.*
+io.github.avasachinbaijal.*
+io.github.avegera.*
+io.github.aviadmini.*
+io.github.avivcarmis.*
+io.github.avulavasudha.*
+io.github.awhalefall.*
+io.github.awidesky.*
+io.github.awiodev.*
+io.github.awwsmm.*
+io.github.axel-n.*
+io.github.axonivy.*
+io.github.axxiss.*
+io.github.axxiss.android.*
+io.github.ayavorskiy.*
+io.github.ayfri.*
+io.github.aymanzahran.*
+io.github.ayomideyoung.*
+io.github.ayriaofficial.*
+io.github.ayvytr.*
+io.github.azadkins.*
+io.github.azagniotov.*
+io.github.azahnen.*
+io.github.azgraal.*
+io.github.azhansy.*
+io.github.azhon.*
+io.github.azhur.*
+io.github.azodox.*
+io.github.azril0409.*
+io.github.b-sahana.*
+io.github.b5ben86.*
+io.github.babisk.*
+io.github.baboaisystem.*
+io.github.babyblue94520.*
+io.github.baccata.*
+io.github.bachilo-k.*
+io.github.bad-pop.*
+io.github.baedorf.tailoringexpert.*
+io.github.baharmc.*
+io.github.baijianruoli.*
+io.github.bajins.*
+io.github.baked-libs.*
+io.github.balazskreith.hamok.*
+io.github.balcony-seats.*
+io.github.balddonkey2333.*
+io.github.bambrikii.etl-utils.*
+io.github.bambrikii.eval.*
+io.github.bambrikii.gradle.*
+io.github.bambrikii.tiny-utils.*
+io.github.bandii.*
+io.github.banfengcanyue.*
+io.github.bannerxu.*
+io.github.bantenio.interstellar.*
+io.github.baohj.*
+io.github.baozi926.*
+io.github.barackyoung.*
+io.github.barblin.*
+io.github.barbosa-thiago.*
+io.github.barkbeetle.*
+io.github.barnardb.*
+io.github.barqawiz.*
+io.github.barrieshieh.base.*
+io.github.barrypitman.*
+io.github.bartek-wesolowski.*
+io.github.bartoszpop.*
+io.github.barvin.*
+io.github.basantditstek.*
+io.github.baseinsight.*
+io.github.basilapi.*
+io.github.bastide.*
+io.github.battery-staple.*
+io.github.baumrobson.*
+io.github.baunz.*
+io.github.bayescom.*
+io.github.bbarker.*
+io.github.bbggo.*
+io.github.bbstilson.*
+io.github.bbyshp.*
+io.github.bcarter97.*
+io.github.bcckzteam.*
+io.github.bcoughlan.*
+io.github.bctester2012.*
+io.github.bculkin2442.*
+io.github.bdbull.maven.cloud.*
+io.github.bdezonia.*
+io.github.bdluck.*
+io.github.beanfiller.*
+io.github.bedwarsrel.*
+io.github.bedwarsrel.com.*
+io.github.beeline09.android-uniDevId.*
+io.github.behappy-project.*
+io.github.behzod1996.*
+io.github.behzodhalil.*
+io.github.beijing-penguin.*
+io.github.being-eyram.*
+io.github.beksar1998.*
+io.github.belgif.openapi.*
+io.github.belmomusta.*
+io.github.bemappy.*
+io.github.ben-willis.*
+io.github.benarena.*
+io.github.benas.*
+io.github.benas.cb4j.*
+io.github.benedekh.*
+io.github.benfromchina.*
+io.github.benkiefer.*
+io.github.benoitlouy.*
+io.github.beokbeok.*
+io.github.bergturing.*
+io.github.berkayelken.*
+io.github.berkleytechnologyservices.*
+io.github.bernaozgen.*
+io.github.bernd32.*
+io.github.berstanio.*
+io.github.berthax.*
+io.github.bes2008.solution.agileway.*
+io.github.bes2008.solution.agileway.eipchannel.*
+io.github.bes2008.solution.agileway.metrics.*
+io.github.bes2008.solution.agileway.protocol.*
+io.github.bes2008.solution.agileway.ssh.*
+io.github.bes2008.solution.agileway.syslog.*
+io.github.bes2008.solution.audit.*
+io.github.bes2008.solution.audit.entityloader.*
+io.github.bes2008.solution.easyjson.*
+io.github.bes2008.solution.esorm.*
+io.github.bes2008.solution.langx.*
+io.github.bes2008.solution.langx.security.*
+io.github.bes2008.solution.sqlhelper.*
+io.github.bes2008.soultion.esorm.*
+io.github.beseting.*
+io.github.betacatcode.*
+io.github.betterigo.*
+io.github.bettersupport.lock.*
+io.github.bettersupport.websocket.*
+io.github.beyka.*
+io.github.beyondeye.*
+io.github.beyondlov1.*
+io.github.bglowney.*
+io.github.bhaskarkh.*
+io.github.bhatikuldeep.*
+io.github.bhautik008.*
+io.github.bhavin-qfonapp.*
+io.github.bhbac-nhnent.*
+io.github.bhowell2.*
+io.github.bhuwanupadhyay.*
+io.github.bianjieai.*
+io.github.bibhas2.*
+io.github.bichengfei.*
+io.github.biekangdong.*
+io.github.biezhi.*
+io.github.bigDragonKing.*
+io.github.bigbang360.*
+io.github.bigbio.*
+io.github.bigbio.external.*
+io.github.bigbird-0101.*
+io.github.bigwg.*
+io.github.bigwolftime.*
+io.github.bill95.*
+io.github.billywei001.*
+io.github.billywei01.*
+io.github.bimromatic.*
+io.github.bin0801.*
+io.github.binance.*
+io.github.binaryfoo.*
+io.github.binbean.*
+io.github.binishmanandhar23.admobincompose.*
+io.github.binishmanandhar23.dynamiccurve.*
+io.github.binishmanandhar23.photoeditorx.*
+io.github.binout.*
+io.github.binout.asciidoctor.*
+io.github.biometix.*
+io.github.bipindasan.*
+io.github.birddevelper.*
+io.github.bishion.*
+io.github.bissim.*
+io.github.bit-man.*
+io.github.bitbrain.*
+io.github.bitcoin-education.*
+io.github.bitmartexchange.*
+io.github.bitonator.*
+io.github.bitscorpio.*
+io.github.bitstorm.*
+io.github.bitvale.*
+io.github.biuabiu.*
+io.github.bizppurio-api.*
+io.github.bizyun.*
+io.github.bjbt.*
+io.github.bjmob.*
+io.github.bkoehm.*
+io.github.bkosaraju.*
+io.github.black-06.jackson.*
+io.github.blackappsolutions.*
+io.github.blackbaroness.*
+io.github.blackbeard334.*
+io.github.blackdotan.*
+io.github.blackdotan.scrat.*
+io.github.blackfireteam.msimsdk.*
+io.github.blackmo18.*
+io.github.blackspherefollower.*
+io.github.bladestone01.*
+io.github.blankyn.*
+io.github.blatez.*
+io.github.blazmrak.utils.*
+io.github.blckrbbit.*
+io.github.blessedmusicalturkeys.*
+io.github.blindspot-security.*
+io.github.bloepiloepi.*
+io.github.bloquesoft.*
+io.github.blucky8649.*
+io.github.bluecat0419.*
+io.github.bluedreamteng.*
+io.github.bluegroundltd.*
+io.github.bluemiaomiao.*
+io.github.bluepaybr.*
+io.github.bluesofy.*
+io.github.bluewindvane.*
+io.github.blundell.*
+io.github.bmcstdio.*
+io.github.bmob.*
+io.github.bmuskalla.*
+io.github.bmwcarit.*
+io.github.bngsh.*
+io.github.bobbysandhu.*
+io.github.bobdeng.*
+io.github.bobman38.*
+io.github.boc-tothefuture.*
+io.github.bodiart.*
+io.github.bodin.*
+io.github.boessu.*
+io.github.boguszpawlowski.chassis.*
+io.github.boguszpawlowski.composecalendar.*
+io.github.boguszpawlowski.librarysample.*
+io.github.bohhom.*
+io.github.bolttechmy.*
+io.github.bolzer.*
+io.github.bonacinavalerio.*
+io.github.bonigarcia.*
+io.github.boniu-w.*
+io.github.bookzhan.*
+io.github.boostchicken.*
+io.github.bootmeta.result.*
+io.github.bootmethod.*
+io.github.bootpay.*
+io.github.bootstream.*
+io.github.bootystar.*
+io.github.boredmathematician.*
+io.github.borewit.*
+io.github.borisnaguet.*
+io.github.boswelja.accomplice.*
+io.github.boswelja.batterystats.*
+io.github.boswelja.ephemeris.*
+io.github.boswelja.migration.*
+io.github.boswelja.tts-ktx.*
+io.github.boswelja.watchconnection.*
+io.github.bovane.*
+io.github.bowenzheng98.*
+io.github.boy12hoody.guia.*
+io.github.boykinchoi.*
+io.github.bozrahvice.starter.*
+io.github.bozwin.*
+io.github.bp3r.*
+io.github.bpairan.*
+io.github.bplommer.*
+io.github.bpoole6.*
+io.github.bradenhc.*
+io.github.bradfordcan.*
+io.github.bradpatras.*
+io.github.brahmamp.*
+io.github.brahmamp.brahmamp.*
+io.github.brainlezz.*
+io.github.bralax.*
+io.github.brandonjmitchell.*
+io.github.brantunger.*
+io.github.braully.*
+io.github.brevilo.*
+io.github.brfreitas.*
+io.github.brianapple.*
+io.github.bric3.fireplace.*
+io.github.brightloong.*
+io.github.brijframework.*
+io.github.briqt.*
+io.github.brobert83.*
+io.github.brondbet.*
+io.github.brooks0129.*
+io.github.broot02.*
+io.github.broscr.*
+io.github.bruce0203.*
+io.github.brucefreedy.*
+io.github.brunogalv.contacts.*
+io.github.brunomancuso.*
+io.github.brymlee.*
+io.github.btechsuresh.*
+io.github.btjfsu.*
+io.github.buckcri.xclacks.*
+io.github.budacab.*
+io.github.buerxixi.*
+io.github.bug-wheels.*
+io.github.buginspector.*
+io.github.buginspector.jin.*
+io.github.bugrpt.*
+io.github.buhuiwandexiaobai.*
+io.github.buiduylinh.*
+io.github.build-security.*
+io.github.bullet-tooth.*
+io.github.bumptechlab.*
+io.github.buntec.*
+io.github.burakpadr.*
+io.github.burbokop.*
+io.github.buszi0809.*
+io.github.butkoprojects.*
+io.github.bvotteler.*
+io.github.bweng20.*
+io.github.bxcf.*
+io.github.bxkftechteam.*
+io.github.byc-smart.*
+io.github.byhook.*
+io.github.byte-track.*
+io.github.bytebeats.*
+io.github.bytes-chaser.*
+io.github.bzdgn.*
+io.github.bzethmayr.fungu.*
+io.github.bzhaoopenstack.*
+io.github.c-a-services.*
+io.github.c-a-services.mule.maven.*
+io.github.c-classen.oakdsl.*
+io.github.c-fraser.*
+io.github.c-santana-sp.*
+io.github.c0nnor263.*
+io.github.c47harsis.*
+io.github.c4dt.*
+io.github.cShen-code.*
+io.github.cactacea.*
+io.github.cactacea.addons.*
+io.github.cadence-oss.*
+io.github.caesarb.*
+io.github.cafeteru.*
+io.github.cafetux.*
+io.github.caij.*
+io.github.cainlara.*
+io.github.caiquan-github.*
+io.github.caiweitao.*
+io.github.cajr8023.*
+io.github.cake-lier.*
+io.github.caldremch.*
+io.github.callcontrol.*
+io.github.callstack-internal.*
+io.github.calmera.*
+io.github.calvinkeum.*
+io.github.calwenb.*
+io.github.camaine.*
+io.github.campanula-medium.*
+io.github.camshaft54.*
+io.github.cangHW.*
+io.github.canny1913.*
+io.github.canrili.*
+io.github.cans-communication.*
+io.github.cao2068959.*
+io.github.capsi-informatique.*
+io.github.captain-p-goldfish.*
+io.github.captaindp.*
+io.github.captainwonjong.*
+io.github.carbaj03.*
+io.github.cardano-community.*
+io.github.cardinal-alpha.*
+io.github.careem.*
+io.github.carldata.*
+io.github.carlosmtobon.*
+io.github.carlosthe19916.*
+io.github.carlowakefield.*
+io.github.carnival-data.*
+io.github.caronchen.*
+io.github.carousell.*
+io.github.carschno.*
+io.github.caseforge.*
+io.github.casehubdk.*
+io.github.casey-c.*
+io.github.castmart.*
+io.github.casuallc.*
+io.github.casually-blue.*
+io.github.catchpig.kmvvm.*
+io.github.catchyan.*
+io.github.catcoderr.*
+io.github.catlin-dev.*
+io.github.cats4scala.*
+io.github.cbartosiak.*
+io.github.cboudereau.dataseries.*
+io.github.cbrown184.*
+io.github.cbtp.materialYou.*
+io.github.cbtp.totem.*
+io.github.cchacin.*
+io.github.ccincharge.*
+io.github.ccjjzz.*
+io.github.ccodemvc.*
+io.github.ccqstark.*
+io.github.cctyl.*
+io.github.cdancy.*
+io.github.cdandoy.*
+io.github.cdimascio.*
+io.github.cdklabs.*
+io.github.cdklabs.cdk_cloudformation.*
+io.github.cdlearner.*
+io.github.cdsap.*
+io.github.cdsap.geapi.*
+io.github.cdsap.talaiot.*
+io.github.cdsap.talaiot.plugin.*
+io.github.cedulive.*
+io.github.cegredev.*
+io.github.celestibytes.*
+io.github.celikfatih.*
+io.github.cementwork.*
+io.github.cemiltokatli.jurl.*
+io.github.cemiltokatli.passwordgenerator.*
+io.github.cemiltokatli.uricomponent.*
+io.github.censodev.*
+io.github.centercode.*
+io.github.centrale-canine.*
+io.github.centrifugal.*
+io.github.ceoche.*
+io.github.cepr0.*
+io.github.cernier.*
+io.github.cernoch.*
+io.github.cerrorism.*
+io.github.cgglyle.*
+io.github.cgi.*
+io.github.cha1yi.*
+io.github.chad2li.*
+io.github.chadj2.*
+io.github.chafficui.*
+io.github.chains-project.*
+io.github.chairz.*
+io.github.chalilayang.*
+io.github.chandan-b-verma.*
+io.github.changebooks.*
+io.github.changlezhong.material.*
+io.github.chanus.*
+io.github.chao2zhang.*
+io.github.chao2zhang.livedatadebugger.*
+io.github.chao2zhang.logginglivedata.*
+io.github.chao2zhang.rna.*
+io.github.chaosleung.*
+io.github.chaosopen.*
+io.github.chapeco.api.testrail.*
+io.github.chardskarth.*
+io.github.chargemap.android.*
+io.github.charitrajain24.*
+io.github.charles-grozny.*
+io.github.charles-grozny.bukkit-config.*
+io.github.charles-grozny.pluginlib.*
+io.github.charleslcy.*
+io.github.charlieamat.*
+io.github.charlotteumr.jv.*
+io.github.charmicat.*
+io.github.charries96.*
+io.github.chartiq.*
+io.github.chavin-chen.*
+io.github.chawloo.*
+io.github.chayanforyou.*
+io.github.chdown.*
+io.github.che-incubator.*
+io.github.check-leak.*
+io.github.cheddar.*
+io.github.cheetunit.*
+io.github.chehsunliu.fuglekt.*
+io.github.chehsunliu.ossrh.*
+io.github.chek539.*
+io.github.chen-gliu.*
+io.github.chenchen-engine.*
+io.github.chenfd99.*
+io.github.chenfei0928.*
+io.github.chengao93.*
+io.github.chengjie-jlu.*
+io.github.chengtx01.*
+io.github.chenguoqing1001.*
+io.github.chengzis.*
+io.github.chenhaoaijay.*
+io.github.chenjp-huan.*
+io.github.chenlauter.*
+io.github.chenmtech.*
+io.github.chenqunming.*
+io.github.chensj1992.*
+io.github.chentao7v.*
+io.github.chenwuwen.*
+io.github.chenxuancode.*
+io.github.chenxucd.*
+io.github.cheny2151.*
+io.github.chenyujie-lab.*
+io.github.chenyzh.*
+io.github.chenzb428.*
+io.github.cheongbong.*
+io.github.cherrio-llc.*
+io.github.chetan-tuteja.*
+io.github.chgocn.*
+io.github.chichengyu.*
+io.github.chiclaim.*
+io.github.chikei.*
+io.github.chikyukido.*
+io.github.chillired.*
+io.github.china-mobile2008.*
+io.github.chinacoolder.*
+io.github.chinaedulive.*
+io.github.chinalwb.*
+io.github.chinhung.*
+io.github.chinmay-kalmane.*
+io.github.chiper-inc.*
+io.github.chiraagchakravarthy.*
+io.github.chiraggupta95apr.*
+io.github.chiraghahuja.jsonparser.*
+io.github.chiraghahuja.xmlparser.*
+io.github.chiselverify.*
+io.github.chndnbhrdwj.*
+io.github.chomeng.*
+io.github.chongwen.*
+io.github.chopyourbrain.*
+io.github.chozzle.*
+io.github.chr56.*
+io.github.chris-zen.*
+io.github.chris2018998.*
+io.github.chrisdostert.*
+io.github.chriskn.*
+io.github.chrisruffalo.*
+io.github.chrissom.*
+io.github.christian-draeger.*
+io.github.christian-german.*
+io.github.christianmelon.*
+io.github.christophknabe.*
+io.github.chronoscala.*
+io.github.chronosx88.*
+io.github.chshen1998.*
+io.github.chujinlong1.*
+io.github.chungggg.*
+io.github.chungtsai.*
+io.github.chunhodong.*
+io.github.chunyang4015.*
+io.github.churunfa.*
+io.github.chuvoks.*
+io.github.chuxuecentaline.*
+io.github.chyccs.*
+io.github.ci-cmg.*
+io.github.ciaica-anastasia.urlvalidator.*
+io.github.ciaraobrien.*
+io.github.cibotech.*
+io.github.cidverse.*
+io.github.cinFengzi.*
+io.github.cinpecan.*
+io.github.ciriti.*
+io.github.cisumer.*
+io.github.citcom-project.*
+io.github.citcon-aoyansheng.upi_sdk_adnroid.*
+io.github.ciusji.*
+io.github.cjchen98.*
+io.github.cjkent.kotlinbeans.*
+io.github.cjkent.osiris.*
+io.github.cjlkbxt.*
+io.github.cjoseflores.*
+io.github.cjstehno.*
+io.github.cjstehno.ersatz.*
+io.github.ck-jesse.*
+io.github.ck-open.*
+io.github.ckenergy.*
+io.github.ckenergy.compose.safeargs.*
+io.github.clarkdian.*
+io.github.clarkding.*
+io.github.clarksandholtz.*
+io.github.classgraph.*
+io.github.classops.urouter.*
+io.github.clayton-k.*
+io.github.cleanpojo.*
+io.github.clearblade.*
+io.github.clearwsd.*
+io.github.clescot.*
+io.github.cleydyr.*
+io.github.clickonometrics.android.*
+io.github.clickscript.*
+io.github.cliffgr.*
+io.github.clightning4j.*
+io.github.clistery.*
+io.github.clockclap.*
+io.github.clockworm.*
+io.github.clojure.*
+io.github.clormor.*
+io.github.cloud-dis-sdk.*
+io.github.cloudchacho.*
+io.github.cloudiator.*
+io.github.cloudiator.axe.*
+io.github.cloudiator.flexiant.*
+io.github.cloudiator.lance.*
+io.github.cloudiator.sword.*
+io.github.cloudiator.visor.*
+io.github.cloudify.*
+io.github.cloudscheduler.*
+io.github.clrossel.*
+io.github.cmas1.*
+io.github.cmduque.*
+io.github.cmoine.*
+io.github.cmorgia.*
+io.github.cms3102.*
+io.github.cmu-phil.*
+io.github.cn-chenhuping.*
+io.github.cn-luyang.*
+io.github.cnoke.*
+io.github.cnoke.ktnet.*
+io.github.cnoke.startup.*
+io.github.cns-dgsw.*
+io.github.cnspary.*
+io.github.cnzbq.*
+io.github.cobayo.*
+io.github.cocolabs.*
+io.github.cocomikes.*
+io.github.cocreationsrv.*
+io.github.codbex.*
+io.github.code-log.*
+io.github.codec356.*
+io.github.codecitizen.*
+io.github.codecraftplugin.*
+io.github.codehookschannel.*
+io.github.codejanovic.*
+io.github.codek-li.jrock.*
+io.github.codemak2r.*
+io.github.codemumbler.*
+io.github.codemumbler.maven.plugin.*
+io.github.codeplutos.*
+io.github.codepoem.*
+io.github.coder-ah-fei.*
+io.github.coder-dongjiayi.*
+io.github.coder168.*
+io.github.codergjw.*
+io.github.codermjlee.*
+io.github.coderodde.*
+io.github.codesakshi.*
+io.github.codestory-product.*
+io.github.codexiaomai.environmentswitcher.*
+io.github.codingblazer.*
+io.github.codingspeedup.*
+io.github.coenraadhuman.*
+io.github.coffee-break.*
+io.github.coffee330501.*
+io.github.coffeelibs.*
+io.github.colagom.*
+io.github.coldluna.*
+io.github.colin4124.*
+io.github.colinzhu.*
+io.github.colonelparrot.*
+io.github.colossusmk2.*
+io.github.colovaria-graphics.*
+io.github.coltonliang.*
+io.github.comet-crypto.*
+io.github.commonground-testing.*
+io.github.commonslibs.*
+io.github.comrada.*
+io.github.comradewalker.*
+io.github.comradewalker.aws-ca.ca-publish.*
+io.github.comradewalker.aws-ca.ca.*
+io.github.concurrent-recursion.*
+io.github.conerjoy.*
+io.github.config-item.*
+io.github.config4k.*
+io.github.conflux-chain.*
+io.github.congcoi123.*
+io.github.conghuahuadan.*
+io.github.congyl1988.publishcmd.*
+io.github.consenlabs.android.*
+io.github.contentsignature.*
+io.github.contractautomataproject.*
+io.github.coolbeevip.*
+io.github.cooliceman.*
+io.github.coolishbee.*
+io.github.coolys.*
+io.github.cooperlyt.*
+io.github.cooperun.*
+io.github.coordinates2country.*
+io.github.copper-leaf.*
+io.github.coralewh.*
+io.github.corbym.*
+io.github.corca-ai.*
+io.github.cornelius-tyranade.*
+io.github.cosmobdai.bdp.*
+io.github.cossme.*
+io.github.coteji.*
+io.github.cotide.*
+io.github.couchbaselabs.*
+io.github.cozodb.*
+io.github.cozyloon.*
+io.github.cozyloon.RAapi.*
+io.github.cozyloon.ezconfig.*
+io.github.cozyloon.lets.*
+io.github.cpacm.*
+io.github.cpesch.com.github.crob1140.*
+io.github.cpetot.*
+io.github.cpo1964.*
+io.github.cppsh1t.*
+io.github.cptimario.*
+io.github.cqpsjsl.*
+io.github.cquiroz.*
+io.github.cquiroz.react.*
+io.github.cqwsbuy.*
+io.github.crabzilla.*
+io.github.crac.*
+io.github.crac.com.amazonaws.*
+io.github.crac.io.agroal.*
+io.github.crac.io.micronaut.*
+io.github.crac.io.vertx.*
+io.github.crac.org.apache.kafka.*
+io.github.crac.org.apache.tomcat.embed.*
+io.github.crackanddie.*
+io.github.crackthecodeabhi.*
+io.github.crashiv.*
+io.github.crazecoder.*
+io.github.createam-labs.*
+io.github.createsequence.*
+io.github.creekmoon.*
+io.github.crew102.*
+io.github.cric96.*
+io.github.crizzis.*
+io.github.crmei.*
+io.github.croabeast.*
+io.github.crocodilezz.android.*
+io.github.crocodilezz.autoproperties.*
+io.github.cross-rates.*
+io.github.crossmint.*
+io.github.crossriverbank.payments.processing.client.*
+io.github.crotodev.*
+io.github.crow-misia.aws-sdk-android-ktx.*
+io.github.crow-misia.libmediasoup-android.*
+io.github.crow-misia.libwebrtc.*
+io.github.crow-misia.libyuv.*
+io.github.crow-misia.location-coroutines.*
+io.github.crow-misia.sdp.*
+io.github.crow-misia.zxing-android.*
+io.github.crudzilla.*
+io.github.cruisoring.*
+io.github.cruisoring.functionExtensions.*
+io.github.cruiz666.*
+io.github.cryptoworldchain.*
+io.github.crystailx.*
+io.github.crystal-processes.*
+io.github.crystalizeFavors.*
+io.github.crzy633.*
+io.github.cs1302uga.*
+io.github.csdn-mobile.*
+io.github.cse1110.*
+io.github.csf200701.*
+io.github.cshunsinger.*
+io.github.ctavera.*
+io.github.ctgnz.*
+io.github.ctiliescu.*
+io.github.ctripcorp.*
+io.github.ctyuncloud-java.*
+io.github.cube8540.*
+io.github.cubedtear.*
+io.github.cuioss.*
+io.github.cuioss.test.*
+io.github.cuixiang0130.*
+io.github.cupidchow.*
+io.github.cupybara.*
+io.github.cuukenn.*
+io.github.cwdesautels.*
+io.github.cweijan.*
+io.github.cweyy.*
+io.github.cwfc-ccfb.*
+io.github.cwkproject.*
+io.github.cwsky0221.multiplepicker.*
+io.github.cybercentrecanada.*
+io.github.cyberpython.*
+io.github.cyf1997.*
+io.github.cyfeer-mobile.*
+io.github.cyjishuang.*
+io.github.cymchad.*
+io.github.cyrilschumacher.*
+io.github.cyuliu.*
+io.github.cyzest.*
+io.github.czeffik.*
+io.github.cziesman.*
+io.github.czq-git.*
+io.github.d-exclaimation.*
+io.github.d00mch.*
+io.github.d2a4u.*
+io.github.d4j-opensource.*
+io.github.d4vos.*
+io.github.da1y1.*
+io.github.daanipuui.*
+io.github.dabasvijay.*
+io.github.dachv.*
+io.github.dachv.spring.data.event.*
+io.github.dadino.*
+io.github.dadino.appinfoplugin.*
+io.github.dadino.barcodescanner.*
+io.github.dadino.quickstart3.*
+io.github.dadino.zebraprintlibrary.*
+io.github.daemon369.*
+io.github.daenyth.*
+io.github.daflamingfox.*
+io.github.dagdelenmustafa.*
+io.github.daggerok.*
+io.github.daggerok.example.*
+io.github.daghemberg.*
+io.github.dagonco.*
+io.github.daichi-m.*
+io.github.daijp.*
+io.github.dailinfeng66.*
+io.github.dailinyucode.*
+io.github.dailystruggle.*
+io.github.daiwenzh5.kt.*
+io.github.dakshsemwal.*
+io.github.dale-lib.*
+io.github.dalpengida.*
+io.github.dalpengida.repo-t.*
+io.github.dalwadi2.*
+io.github.damiancritchfield.*
+io.github.damianvdb.*
+io.github.dan2097.*
+io.github.danaodai951.*
+io.github.dango-dx.*
+io.github.dango-dx.plugin.apkrename.*
+io.github.dango-sdx.*
+io.github.daniel-tucano.*
+io.github.danielafriyie.*
+io.github.danielandroidtt.*
+io.github.danielblue.*
+io.github.danielnaczo.*
+io.github.danielpeach.java-plugin.*
+io.github.danielpine.*
+io.github.danielthedev.*
+io.github.daniloarcidiacono.*
+io.github.daniloarcidiacono.test.ci.*
+io.github.daniloarcidiacono.typescriptmapper.*
+io.github.danioscx.*
+io.github.dantegrek.*
+io.github.danthe1st.*
+io.github.danushka96.*
+io.github.danvsantos.*
+io.github.danygold.*
+io.github.daosanqing.*
+io.github.daosupport.*
+io.github.daoyixun.*
+io.github.dargiri.*
+io.github.darkbluetang.*
+io.github.darker.promise.*
+io.github.darkhan08.*
+io.github.darkokoa.*
+io.github.darkweird.*
+io.github.darkxanter.*
+io.github.darkxanter.exposed.*
+io.github.darkxanter.graphql.*
+io.github.darkxanter.kotlock.*
+io.github.darmi7.*
+io.github.darrenluo.*
+io.github.darrmirr.*
+io.github.darvld.krpc.*
+io.github.darvld.wireframe.*
+io.github.dashingqi.*
+io.github.dat0106.*
+io.github.datYori.*
+io.github.data-rocks-team.*
+io.github.data-tools.*
+io.github.datacanvasio.expretau.*
+io.github.datachina.*
+io.github.dataeyesdk.*
+io.github.datafusion-contrib.*
+io.github.dataoperandz.*
+io.github.dataspread.*
+io.github.datenmuehle.*
+io.github.dathin.*
+io.github.datl4g.*
+io.github.datumcenter.*
+io.github.dav009.*
+io.github.davdarras.*
+io.github.daveboy.*
+io.github.davejoyce.*
+io.github.davemeier82.homeautomation.*
+io.github.daveschoutens.simple-jbdc.*
+io.github.daveschoutens.simple-jdbc.*
+io.github.david-allison-1.*
+io.github.david-sledge.*
+io.github.davidblanar.*
+io.github.davidburstrom.contester.*
+io.github.davidchild.*
+io.github.daviddenton.*
+io.github.davidebasile.*
+io.github.davidebocca.*
+io.github.davidedomini.*
+io.github.davidgregory084.*
+io.github.davidhallj.*
+io.github.davidkgp.*
+io.github.davidluoye.*
+io.github.davidpdp.*
+io.github.davidtomas14.*
+io.github.davidwhitlock.com.sandwich.*
+io.github.davidwhitlock.cs410J.*
+io.github.davidwhitlock.cs410J.original.*
+io.github.davisusanibar.*
+io.github.daviswlau.*
+io.github.davw.*
+io.github.dawnfz.*
+io.github.daxium.*
+io.github.dayeshing.*
+io.github.dazhaodai.*
+io.github.dboy233.*
+io.github.dbses.*
+io.github.dbspinner.*
+io.github.dbstarll.*
+io.github.dbstarll.dubai.*
+io.github.dbstarll.flink.*
+io.github.dbstarll.flume.*
+io.github.dbstarll.parent.*
+io.github.dbstarll.study.*
+io.github.dbstarll.test.*
+io.github.dbstarll.utils.*
+io.github.dcascaval.*
+io.github.ddd-spring.*
+io.github.dddframework.*
+io.github.dddinjava.*
+io.github.dddplus.*
+io.github.ddebree.*
+io.github.ddimtirov.*
+io.github.ddk-prog.*
+io.github.de314.*
+io.github.dead8309.*
+io.github.dead8309.tailwind-kt.*
+io.github.deadshot465.*
+io.github.deal-engine.*
+io.github.dean-lhb.*
+io.github.deansg.*
+io.github.deathbycaptcha.*
+io.github.debasishg.*
+io.github.deblockt.*
+io.github.deduper.*
+io.github.deep-bi.*
+io.github.deepeshpatel.*
+io.github.deersunny.*
+io.github.defective4.*
+io.github.defective4.amcc.*
+io.github.definiti.*
+io.github.defipay.*
+io.github.dehengyang.*
+io.github.dekanako.*
+io.github.delirius325.*
+io.github.dellisd.spatialk.*
+io.github.delta-reporter.*
+io.github.delta11.*
+io.github.demonran.*
+io.github.dengbing0907.*
+io.github.dengliming.redismodule.*
+io.github.dengshiwei.*
+io.github.dengyiqian.*
+io.github.dengyu1115.*
+io.github.denis1986.*
+io.github.denisbronx.netmock.*
+io.github.dennisguo.*
+io.github.dennisochulor.*
+io.github.dennysfredericci.*
+io.github.dennysfredericci.omdbapi.*
+io.github.densudas.*
+io.github.deonwu.*
+io.github.dephin.*
+io.github.deppan.*
+io.github.deppan.adapter.*
+io.github.dequanking.*
+io.github.derklaro.*
+io.github.derkrischan.*
+io.github.dermitza.*
+io.github.derrickchanjl.*
+io.github.derryterran.*
+io.github.detekt.*
+io.github.detekt.gradle.compiler-plugin.*
+io.github.detekt.sarif4j.*
+io.github.detekt.sarif4k.*
+io.github.dev-craft.*
+io.github.dev-vince.*
+io.github.devacfr.maven.skins.*
+io.github.devallever.*
+io.github.devalves1993.*
+io.github.devatherock.*
+io.github.devbhuwan.*
+io.github.devdevx.*
+io.github.developerdomjones.*
+io.github.developerrajkumar4156.*
+io.github.developersancho.*
+io.github.devgoks.*
+io.github.devil-ycl.*
+io.github.devil0ll.*
+io.github.devilsen.*
+io.github.devilyard.*
+io.github.devlibx.*
+io.github.devlibx.easy.*
+io.github.devlibx.flink.*
+io.github.devlibx.jung.*
+io.github.devlibx.miscellaneous.*
+io.github.devlibx.tools.java.maven.*
+io.github.devlibx.userlib.*
+io.github.devngho.*
+io.github.devnsi.*
+io.github.devopsix.*
+io.github.devopsplugin.*
+io.github.devopsutilities.*
+io.github.devreborn.*
+io.github.devsecops-zone.*
+io.github.devsong.*
+io.github.devthurain.*
+io.github.devzwy.*
+io.github.deweyjose.*
+io.github.dexky.*
+io.github.deynne.*
+io.github.dfianthdl.*
+io.github.dfm1210.*
+io.github.dftrakesh.*
+io.github.dgroup.*
+io.github.dh-free.*
+io.github.dhawanrachakonda.*
+io.github.dheid.*
+io.github.dhi13man.*
+io.github.dhruvit-r.*
+io.github.diamondminer88.*
+io.github.diareuse.*
+io.github.dibog.*
+io.github.dictzip.*
+io.github.didi.*
+io.github.didi.dokit.*
+io.github.didi.hummer.*
+io.github.didi1150.*
+io.github.didipay.*
+io.github.diduweiwu.*
+io.github.diego2la.*
+io.github.diegourban.*
+io.github.diegulog.*
+io.github.dieproht.*
+io.github.dieselr.*
+io.github.digimono.*
+io.github.digitalchickenlabs.*
+io.github.digitalgust.*
+io.github.digitalhealthintegration.*
+io.github.digma-ai.*
+io.github.dikhim.*
+io.github.dilldong.*
+io.github.dilrajsingh1997.*
+io.github.dilsh0d.*
+io.github.dimagor555.mvicompose.*
+io.github.dimcloud.*
+io.github.dimensiondev.*
+io.github.dimitarg.*
+io.github.dimitrovvlado.*
+io.github.dimpon.*
+io.github.dinakaranram9.*
+io.github.dinesh-scaletech.*
+io.github.dineshgpillai.*
+io.github.dineshkumargandla.*
+io.github.dineshsolanki.*
+io.github.dingdangdog.*
+io.github.dingyi222666.*
+io.github.dingyishen-amazon.*
+io.github.dingzheng2017.*
+io.github.diogenes1oliveira.*
+io.github.dippatra.calculationlibrary.*
+io.github.disaster1-tesk.*
+io.github.dispalt.*
+io.github.diverse-project.k3.*
+io.github.divinator.*
+io.github.divinator.wgapi.*
+io.github.divinespear.*
+io.github.divya0319.*
+io.github.dixtdf.*
+io.github.diy-coder.*
+io.github.dizhifeng.*
+io.github.djhaskin987.*
+io.github.djice.*
+io.github.djoe-denne.*
+io.github.djr4488.*
+io.github.dk900912.*
+io.github.dkgithup2022.*
+io.github.dkim19375.*
+io.github.dkqa.*
+io.github.dkrypton.*
+io.github.dldash.*
+io.github.dlgrech.*
+io.github.dllewellyn.safetorun.*
+io.github.dlomsak.*
+io.github.dlutsniper.*
+io.github.dmarcs.*
+io.github.dmateusp.*
+io.github.dmitributorchin.*
+io.github.dmitriy1892.kmm.*
+io.github.dmitriy1892.kmm.utils.*
+io.github.dmitriy1morozov.*
+io.github.dmitrymysenko.*
+io.github.dmlloyd.*
+io.github.dmlloyd.module-info.*
+io.github.dmp-cuiot.*
+io.github.dmrolfs.*
+io.github.dmytrodm.*
+io.github.dmytrofesyk.math.*
+io.github.dnamik.*
+io.github.dnos-project.*
+io.github.dnovitski.*
+io.github.dnspod.*
+io.github.dobrynya.*
+io.github.dododcdc.*
+io.github.dogla.*
+io.github.doip-sim-ecu.*
+io.github.dokar3.*
+io.github.doketan.mathgeometry.*
+io.github.doketan.simplemath.*
+io.github.doki23.*
+io.github.dolphin2410.*
+io.github.domain-primitives.*
+io.github.dominaezzz.matrixkt.*
+io.github.dominys.*
+io.github.domlen2003.*
+io.github.domstolene.*
+io.github.domstolene.esas.*
+io.github.dondragon2.*
+io.github.dongjmroot.*
+io.github.dongpingwang.*
+io.github.donnie4w.*
+io.github.donphds.*
+io.github.dontirun.*
+io.github.dontshavetheyak.*
+io.github.doocs.*
+io.github.doohee94.*
+io.github.doolse.*
+io.github.doriordan.*
+io.github.dorjoos.*
+io.github.dos65.*
+io.github.doublethinkgamestech.*
+io.github.doublewei-ad.*
+io.github.douira.*
+io.github.douyayun.*
+io.github.dovaleac.*
+io.github.dovemy.*
+io.github.dovydasvenckus.*
+io.github.dph5199278.*
+io.github.dpsoft.*
+io.github.dpxxdp.*
+io.github.dqohn.*
+io.github.dr-yanglong.*
+io.github.dr3amteam.dhome.*
+io.github.draco1023.*
+io.github.dragneelfps.*
+io.github.dragons96.*
+io.github.drahovac.*
+io.github.drbreen.*
+io.github.dreamlike-ocean.*
+io.github.dreamvoid.*
+io.github.drednote.*
+io.github.dreierf.*
+io.github.drewctaylor.*
+io.github.drewlakee.*
+io.github.drgoodness.*
+io.github.dripWaterArun.*
+io.github.drofmij.*
+io.github.dropwizard-jobs.*
+io.github.drrename.*
+io.github.drrename.codesignjava.*
+io.github.dsapr.*
+io.github.dsc-cmt.*
+io.github.dsc-finance-open.*
+io.github.dseelp.*
+io.github.dseelp.framecord.*
+io.github.dseelp.kommon.*
+io.github.dseelp.kotlincord.*
+io.github.dsfdsgdghfdhgfjgfjghjg65.*
+io.github.dsheirer.*
+io.github.dsibilio.*
+io.github.dsly-android.*
+io.github.dslzc.*
+io.github.dspasojevic.*
+io.github.dstears.*
+io.github.dszopa.*
+io.github.dtcyad1.*
+io.github.dteducation.*
+io.github.dtm-labs.*
+io.github.du-meng-nan.*
+io.github.duaiyun1314.*
+io.github.duang-labs.*
+io.github.duckasteroid.cdb.*
+io.github.duckasteroid.progress.*
+io.github.duckie-team.util.*
+io.github.ducthienbui97.*
+io.github.dudiao.*
+io.github.duduhuang88.*
+io.github.duking666.*
+io.github.dumarsma.*
+io.github.dummie-java.*
+io.github.dumonad.*
+io.github.dungnm1311.*
+io.github.dunmengjun.*
+io.github.dunpju.*
+io.github.dunwu.*
+io.github.dunwu.boot.*
+io.github.dunwu.tool.*
+io.github.duoduobabi.*
+io.github.duolabmeng6.javaefun.*
+io.github.duqian42707.*
+io.github.dv996coding.*
+io.github.dvgaba.*
+io.github.dvhoang.*
+io.github.dwibambang72.*
+io.github.dxslin.*
+io.github.dxx.*
+io.github.dynamixon.*
+io.github.dynamsoftallen.*
+io.github.dynsxyc.*
+io.github.dzh.*
+io.github.dziioniis.*
+io.github.dzirbel.*
+io.github.dzmitry-lakisau.*
+io.github.dzmitryrak.*
+io.github.dzsf.*
+io.github.dzw1113.*
+io.github.e4basil.*
+io.github.eademidea.*
+io.github.eafy.*
+io.github.eagerlogic.*
+io.github.eaglesakura.android-application-runtime.*
+io.github.eaglesakura.armyknife-android-junit4.*
+io.github.eaglesakura.armyknife-gms.*
+io.github.eaglesakura.armyknife-jetpack.*
+io.github.eaglesakura.armyknife-runtime.*
+io.github.eaglesakura.displayinfo.*
+io.github.eaglesakura.eventstream.*
+io.github.eaglesakura.firearm-di.*
+io.github.eaglesakura.firearm-event.*
+io.github.eaglesakura.firearm-experimental.*
+io.github.eaglesakura.firearm-rpc.*
+io.github.eaglesakura.flexible-thread-pool-dispatcher.*
+io.github.eaglesakura.lazysingleton.*
+io.github.eaglesakura.live-task-counter.*
+io.github.eaglesakura.livedata-factory.*
+io.github.eaglesakura.static-random.*
+io.github.eaglesakura.swagger2-codegen.*
+io.github.eaglesakura.workflowdispatcher.*
+io.github.ealenxie.*
+io.github.eamonnmcmanus.*
+io.github.eaphonetech.*
+io.github.earcut4j.*
+io.github.earogov.*
+io.github.earthchen.*
+io.github.eartho-group.*
+io.github.easikoglu.*
+io.github.easonliu09.utils.*
+io.github.easy-do.*
+io.github.easycode8.*
+io.github.easyframe.*
+io.github.easyfream.*
+io.github.easymapper.*
+io.github.easymodeling.*
+io.github.easyobject.*
+io.github.easytuples.*
+io.github.eatnuh.*
+io.github.eaxdev.*
+io.github.eb4j.*
+io.github.ebicep.*
+io.github.eciuca.blockly.*
+io.github.eckig.*
+io.github.eckig.grapheditor.*
+io.github.ecsoya.*
+io.github.ecubi.*
+io.github.edasich.backpack.*
+io.github.eddieringle.android.libs.andicons.*
+io.github.edefritz.*
+io.github.edgemetric.*
+io.github.edilib.*
+io.github.edjona.*
+io.github.edmaputra.*
+io.github.edmondantes.*
+io.github.edouardfouche.*
+io.github.edricchan03.androidx.browser.*
+io.github.edricchan03.androidx.common.*
+io.github.edricchan03.androidx.common.enums.*
+io.github.eduard-romanyuk.*
+io.github.eduardohl.*
+io.github.edwardUL99.*
+io.github.edwgiz.*
+io.github.edwinlam.*
+io.github.eeaters.*
+io.github.eegets.*
+io.github.eendroroy.*
+io.github.eeroom.*
+io.github.eetchyza.*
+io.github.efaker.*
+io.github.efekahraman.*
+io.github.efenglu.*
+io.github.efenglu.japicc.*
+io.github.efenglu.maven.tiles.*
+io.github.effiban.*
+io.github.efguydan.*
+io.github.eforest.*
+io.github.efwgrp.*
+io.github.egd-prodigal.*
+io.github.egonw.*
+io.github.egonw.bacting.*
+io.github.egormkn.*
+io.github.ehn-digital-green-development.*
+io.github.eiffelyk.*
+io.github.eightmonth.cloud.*
+io.github.eimapi.*
+io.github.eireglas.*
+io.github.eisop.*
+io.github.eisuto.*
+io.github.eiualee.*
+io.github.ejchathuranga.*
+io.github.ejif.chromej.*
+io.github.ejif.geometry.*
+io.github.ejif.ortools.*
+io.github.ekiryushin.*
+io.github.ekrosrb.*
+io.github.ekuzmichev.*
+io.github.el-siglo-21.*
+io.github.eladiorodriguezveve.*
+io.github.elbryan.*
+io.github.eldenmango.*
+io.github.eleanor-em.*
+io.github.electronic-mango.*
+io.github.elegantdevelopment.*
+io.github.element36-io.*
+io.github.eleven19.*
+io.github.elf4j.*
+io.github.elkan1788.*
+io.github.elkhoudiry.*
+io.github.elki-project.*
+io.github.elongdeo.*
+io.github.elonlit.*
+io.github.eltos.*
+io.github.elye.*
+io.github.emanonwzy.*
+io.github.emanuelepaiano.*
+io.github.emanuelvictor.*
+io.github.embedded-middleware.*
+io.github.embeddedkafka.*
+io.github.embracelong.*
+io.github.emd4600.*
+io.github.emeraldjava.*
+io.github.emilyy-dev.*
+io.github.emotionbug.*
+io.github.emreken.*
+io.github.emsoft.*
+io.github.enayzuin.spring.jpa.filter.*
+io.github.encryptorcode.*
+io.github.enderman-tping.*
+io.github.endless4s.*
+io.github.endorlabs.*
+io.github.endreman0.*
+io.github.endzeitbegins.*
+io.github.enedir.*
+io.github.enemyghost.*
+io.github.enliple-ibot.*
+io.github.enliplegit.*
+io.github.ennuil.*
+io.github.enowr.android.*
+io.github.enpassant.*
+io.github.enridaga.*
+io.github.enriquemolinari.*
+io.github.enriquerodbe.*
+io.github.ensozos.*
+io.github.ensyb.properties.*
+io.github.entropy-cloud.*
+io.github.eo-cqrs.*
+io.github.eoinkanro.*
+io.github.eonie.*
+io.github.epi155.*
+io.github.epicarchitect.*
+io.github.equipognoss.*
+io.github.er1c.*
+io.github.erandipraboda.*
+io.github.erdtman.*
+io.github.erfangc.*
+io.github.ergooo.*
+io.github.ergoplatform.*
+io.github.ericdriggs.*
+io.github.ericluoliu.*
+io.github.ericmedvet.*
+io.github.ericmpapa.*
+io.github.ericsson-mts.*
+io.github.erictsangx.*
+io.github.erikvanzijst.*
+io.github.erioh.*
+io.github.ermadmi78.*
+io.github.ermadmi78.kobby.*
+io.github.eroshenkoam.*
+io.github.errantfiddle.*
+io.github.erroraway.*
+io.github.erwinc1.*
+io.github.eryingzhangstrike.*
+io.github.erzads.*
+io.github.es-meta.*
+io.github.esabook.*
+io.github.esabook.chucker.*
+io.github.esafirm.circle.*
+io.github.esafirm.uibook.*
+io.github.eselltech.*
+io.github.esentsov.*
+io.github.esirotkin.*
+io.github.espresso4j.*
+io.github.espressoengine.*
+io.github.essentiale.*
+io.github.estefanoshin.*
+io.github.estivensh4.*
+io.github.eternalstone.*
+io.github.ethereal-collection.*
+io.github.ethereal-rpc.*
+io.github.etspaceman.*
+io.github.etuzon.*
+io.github.eugener.*
+io.github.evanrupert.*
+io.github.eventbox.*
+io.github.ever-ai-technologies.*
+io.github.everythingme.*
+io.github.everywherewego.*
+io.github.evgen2sat.*
+io.github.evgenii-shcherbakov.*
+io.github.evgeniycheban.*
+io.github.evgeniymish.*
+io.github.evis.*
+io.github.evkost.*
+io.github.evkost.state-dsl.*
+io.github.exa-mohamedi.*
+io.github.exaberries.*
+io.github.exav.*
+io.github.exciter-z.*
+io.github.excu101.*
+io.github.exjson.*
+io.github.exortions.*
+io.github.expatiat.jambalaya.*
+io.github.expertflow.*
+io.github.expram.*
+io.github.extrawest.*
+io.github.extvos.*
+io.github.ezhuwx.*
+io.github.ezoodb-client.*
+io.github.ezutil.*
+io.github.ezviz-open.*
+io.github.fDizzzy.*
+io.github.fa4nir.*
+io.github.fabianlinz.*
+io.github.fabianterhorst.*
+io.github.fabiojose.klay.*
+io.github.fabiojose.snip.*
+io.github.fabiozumbi12.RedProtect.*
+io.github.fabiuxx.*
+io.github.fabricio20.*
+io.github.facaiy.*
+io.github.facephi.*
+io.github.factoryfx.*
+io.github.fairyspace.*
+io.github.faketime-java.*
+io.github.fallwizard.*
+io.github.famoco.*
+io.github.fanapsoft.*
+io.github.fanbook-open.*
+io.github.fangfangzhang1580668.*
+io.github.fangziyi2015.*
+io.github.fanlinglonghub.*
+io.github.fanlysir.*
+io.github.fans008.*
+io.github.fantyflow.*
+io.github.fanyong920.*
+io.github.faob-dev.*
+io.github.farhad9577.*
+io.github.farhankaz.*
+io.github.farimarwat.*
+io.github.farshidroohi.*
+io.github.fashionsuperman.*
+io.github.fast-classpath-scanner.*
+io.github.fastcube.factory.tibco.*
+io.github.fastcube.factory.tibco.bw.maven.*
+io.github.fastcube.jaxb.com.tibco.bw.schemas.*
+io.github.fasterTool.*
+io.github.fastfilter.*
+io.github.fastily.*
+io.github.fastmock.*
+io.github.faurecia-aptoide.*
+io.github.faveoled.*
+io.github.fawu-k.*
+io.github.fbbzl.*
+io.github.fcuringa.*
+io.github.fddi.*
+io.github.febialfarabi.*
+io.github.fededri.arch.*
+io.github.feederiken.*
+io.github.feer921.*
+io.github.fehu.*
+io.github.feijiing.*
+io.github.feikongl.*
+io.github.feinrasur.*
+io.github.felipebonezi.*
+io.github.felipecarrillo100.*
+io.github.felipeflores.*
+io.github.felixbr.*
+io.github.felixgilioli.*
+io.github.felixsekett.*
+io.github.fengpeitian.*
+io.github.fengshenyanyi.*
+io.github.fengsql.*
+io.github.fengwensheng100.*
+io.github.fengxxc.*
+io.github.fengyupianzhou.*
+io.github.fengzaiyao.*
+io.github.fenqing168.*
+io.github.ferdinand-swoboda.folo.*
+io.github.ferhatwi.*
+io.github.ferius057.*
+io.github.fern-api.*
+io.github.ferozed.kafka.connect.*
+io.github.ffadly.*
+io.github.fherbreteau.*
+io.github.fifilyu.*
+io.github.fileanalysissuite.adapters.rest.contract.*
+io.github.fileanalysissuite.adaptersdk.convenience.*
+io.github.fileanalysissuite.adaptersdk.impls.jaxrs.*
+io.github.fileanalysissuite.adaptersdk.interfaces.*
+io.github.fileanalysissuite.adaptersdk.schema.*
+io.github.fileanalysissuite.restadapters.filesystem.*
+io.github.filesystem-watcher.*
+io.github.filipkowicz.*
+io.github.filipowm.*
+io.github.filippovissani.*
+io.github.finagle.*
+io.github.finalrose7.*
+io.github.finefuture.*
+io.github.finikes.*
+io.github.finschia.*
+io.github.finsther.*
+io.github.fintector.*
+io.github.fintekkers.*
+io.github.firatgursoy.*
+io.github.firechun.*
+io.github.firefang.*
+io.github.firejar710.elixer.*
+io.github.firemaples.*
+io.github.firstletterz.*
+io.github.fishb1.*
+io.github.fishcancry.gabon.*
+io.github.fisher2911.*
+io.github.fitapp-os.*
+io.github.fixess.*
+io.github.fjank.*
+io.github.fjh2021.*
+io.github.fkie-cad.*
+io.github.fkocak2505.*
+io.github.fkohl04.*
+io.github.fkz.*
+io.github.flagship-io.*
+io.github.flash-freezing-lava.*
+io.github.flash-query.*
+io.github.flashvayne.*
+io.github.flaviolionelrita.*
+io.github.flaw101.*
+io.github.flayone.*
+io.github.flbulgarelli.*
+io.github.flef.*
+io.github.flexibletech.*
+io.github.flintersvn.*
+io.github.florent-brosse.*
+io.github.florent37.*
+io.github.floriansw.*
+io.github.floto.*
+io.github.floverfelt.*
+io.github.flow-engine.*
+io.github.flowergjj.*
+io.github.flowersinthesand.*
+io.github.flowfan.*
+io.github.floydpink.jsii.helloWorld.*
+io.github.floydpink.jsii.helloWorldJava.*
+io.github.flozano.mustache.*
+io.github.flozano.org.vaadin.crudui.*
+io.github.fluffycop.*
+io.github.fluid-cloudnative.*
+io.github.fluidcat.*
+io.github.flutterplayer.*
+io.github.fluxroot.*
+io.github.flybase1.*
+io.github.flyhero.*
+io.github.flyingdew.*
+io.github.flyinwind1.*
+io.github.flylib.*
+io.github.flynn-buc.*
+io.github.flynn-zhangyg.*
+io.github.flypiggy-stack.*
+io.github.flypple.*
+io.github.fmichel.*
+io.github.fmpfeifer.*
+io.github.fmusolino.*
+io.github.fmv1992.*
+io.github.foenicl2x.*
+io.github.fomin.*
+io.github.fomin.oas-gen.*
+io.github.fonhorst.*
+io.github.fontysvenlo.*
+io.github.fontysvenlo.alda.*
+io.github.foodiestudio.*
+io.github.footaku.*
+io.github.forevermgg.*
+io.github.forezp.*
+io.github.fornewid.*
+io.github.forohforerror.*
+io.github.forsyde.*
+io.github.fortescarlet.simple-robot-component.*
+io.github.fosstree.*
+io.github.fourlastor.gdx.*
+io.github.fozatkardouh.*
+io.github.fpleihub.*
+io.github.fragland.*
+io.github.fraj.*
+io.github.fran-abril.*
+io.github.francis200214.*
+io.github.franciscotun2.*
+io.github.frank-soon-team.*
+io.github.frankold.*
+io.github.franvis.pimpmyandroidxml.*
+io.github.franzgranlund.*
+io.github.frapples.javapinyin.*
+io.github.frawa.*
+io.github.frc-88.*
+io.github.freakchick.*
+io.github.freddielindsey.*
+io.github.freddyboucher.*
+io.github.freddychen.*
+io.github.fredia.*
+io.github.freedy001.*
+io.github.freya022.*
+io.github.fritsvanlieshout.*
+io.github.frizzleliu.*
+io.github.frko.*
+io.github.frogif.*
+io.github.frontify.*
+io.github.frostingwolf.*
+io.github.frshdn.*
+io.github.fsgjlp.*
+io.github.fsixteen.*
+io.github.fslev.*
+io.github.fssantana.*
+io.github.fstaudt.helm.*
+io.github.ftc-enforcers-7149.*
+io.github.fu-hui.*
+io.github.fucusy.*
+io.github.fuguangli.*
+io.github.fun-stack.*
+io.github.funaihui.*
+io.github.funcfoo.*
+io.github.functionscompanion.*
+io.github.fungrim.nimbus.*
+io.github.funicornframework.*
+io.github.funkatronics.*
+io.github.funnydevs.*
+io.github.funpad.*
+io.github.fuquanming.*
+io.github.furrrlo.*
+io.github.furstenheim.*
+io.github.furutuki.*
+io.github.furutuki.android-svg-transcoder.*
+io.github.fushioncode.*
+io.github.fvarrui.*
+io.github.fvarrui.javapackager.plugin.*
+io.github.fxboy.*
+io.github.fykidwai.*
+io.github.fykrel.*
+io.github.fyro-ing.*
+io.github.fzdwx.*
+io.github.fzhinkin.*
+io.github.g00fy2.*
+io.github.g00fy2.quickie.*
+io.github.g0dkar.*
+io.github.g42cloud-sdk.*
+io.github.g5zhu5896.*
+io.github.gabrielrodriguesrocha.*
+io.github.gabrielshanahan.*
+io.github.gabrielxsuarez.*
+io.github.gabsouza98.*
+io.github.gaeljw.*
+io.github.gaelrenoux.*
+io.github.gaeqs.*
+io.github.gageallencarpenter.*
+io.github.gagechan.*
+io.github.gagessele.*
+io.github.gaius-qi.*
+io.github.gajendragusain.*
+io.github.galbiston.*
+io.github.galid1-hem.*
+io.github.galliaproject.*
+io.github.gameover-fwk.*
+io.github.gamepubcorp.*
+io.github.gamercatorg.*
+io.github.gaming32.*
+io.github.ganadist.sqlite4java.*
+io.github.ganchix.*
+io.github.ganeshnikumbh.*
+io.github.gao746700783.*
+io.github.gaojizhou.*
+io.github.gaol.*
+io.github.gaol.slides.*
+io.github.gaol.vertx.ext.*
+io.github.gaol.vertx.test.ebridge.*
+io.github.gaoqianZ.*
+io.github.gaozuo.*
+io.github.gaplotech.*
+io.github.gargle-blender.*
+io.github.gari-network.*
+io.github.gasches.archetypes.*
+io.github.gasparbarancelli.*
+io.github.gate-org-br.*
+io.github.gatling-cql.*
+io.github.gautambishal.*
+io.github.gautamchibde.*
+io.github.gcdd1993.*
+io.github.gciatto.*
+io.github.gciatto.gradle-mock-service.*
+io.github.gciatto.kt-mpp.bug-finder.*
+io.github.gciatto.kt-mpp.documentation.*
+io.github.gciatto.kt-mpp.js-only.*
+io.github.gciatto.kt-mpp.jvm-only.*
+io.github.gciatto.kt-mpp.linter.*
+io.github.gciatto.kt-mpp.maven-publish.*
+io.github.gciatto.kt-mpp.multi-project-helper.*
+io.github.gciatto.kt-mpp.multiplatform.*
+io.github.gciatto.kt-mpp.npm-publish.*
+io.github.gciatto.kt-mpp.versions.*
+io.github.gconnect.*
+io.github.gdbranco.*
+io.github.gdiazs.*
+io.github.gdiegel.*
+io.github.gdpl2112.*
+io.github.gdutxiaoxu.*
+io.github.gearpump.*
+io.github.geek5nan.*
+io.github.geekcarl.*
+io.github.geeksforge-inc.*
+io.github.gekoramy.*
+io.github.gemingjia.*
+io.github.gemingsong.*
+io.github.geniot.*
+io.github.geniusrus.*
+io.github.genne23v.*
+io.github.gentle-hilt.*
+io.github.georgberky.maven.plugins.depsupdate.*
+io.github.georgwittberger.*
+io.github.geotecinit.*
+io.github.geraldnguyen.*
+io.github.gerardpi.easy-jpa-entities.*
+io.github.gerrykwok.*
+io.github.gershnik.*
+io.github.getblok-io.*
+io.github.getouo.*
+io.github.getyourguide.*
+io.github.gf666.*
+io.github.gfelbing.*
+io.github.gfrmoretti.*
+io.github.gfzy9876.*
+io.github.gg-gy.*
+io.github.gh138312.*
+io.github.gh6497.*
+io.github.ghackenberg.*
+io.github.ghkvud2.*
+io.github.ghokun.*
+io.github.ghostbuster91.*
+io.github.ghostbuster91.pgnparser.*
+io.github.ghostbuster91.scalafix-unified.*
+io.github.ghostbuster91.sttp-openapi.*
+io.github.ghsdk.*
+io.github.ghusta.retrofit2.*
+io.github.gianluigip.*
+io.github.giansluca.*
+io.github.giggals-s-people.*
+io.github.giis-uniovi.*
+io.github.gilbertojrequena.*
+io.github.gilbertoowen.*
+io.github.gilbertparreno.*
+io.github.ginkgocity.*
+io.github.ginvavilon.traghentto.*
+io.github.giovannilamarmora.utils.*
+io.github.git-commit-id.*
+io.github.git-fudge.*
+io.github.git-leon.*
+io.github.git80.*
+io.github.gitbucket.*
+io.github.gitchenjh.*
+io.github.gitflow-incremental-builder.*
+io.github.gitgabrio.*
+io.github.githgf.*
+io.github.github-brijframework.*
+io.github.github-yoyo.*
+io.github.githublaohu.*
+io.github.githubshah.*
+io.github.gitlqr.*
+io.github.gitterrost4.*
+io.github.gitzq.*
+io.github.giuliodalbono.*
+io.github.giulong.*
+io.github.givesocialmovement.*
+io.github.givimad.*
+io.github.gkashmy.*
+io.github.gkatzioura.*
+io.github.gkojiv.*
+io.github.glailton.expandabletextview.*
+io.github.glandais-eptica.*
+io.github.gldiazcardenas.*
+io.github.gleidsonmt.*
+io.github.glj381413362.*
+io.github.globaltcad.*
+io.github.glytching.*
+io.github.gmazzo.codeowners.*
+io.github.gmcristiano.*
+io.github.gmerinojimenez.*
+io.github.gmvalentino8.*
+io.github.gmvalentino8.cyklone.*
+io.github.gnuf0rce.*
+io.github.goallpay.*
+io.github.goatfanboi23.*
+io.github.gobpe-sdks.*
+io.github.gobsex.*
+io.github.gocartpay.*
+io.github.goddb.*
+io.github.godenji.*
+io.github.godfather1103.*
+io.github.goetschalckx.*
+io.github.gokulakrishnan3099.*
+io.github.goldenstrawberry.*
+io.github.gollyhu.*
+io.github.gonalez.uptodatechecker.*
+io.github.gonesun.*
+io.github.gongbox.*
+io.github.gonguasp.*
+io.github.gonzih.*
+io.github.good-good-study.*
+io.github.goodcom6.*
+io.github.goodees.*
+io.github.goodgoodjm.*
+io.github.goodudetheboy.*
+io.github.goodyuanwei.*
+io.github.gordonmu.*
+io.github.goto1134.*
+io.github.goudai.*
+io.github.gouthamkumarpagadala.*
+io.github.gowhyral.*
+io.github.gowrish9595.*
+io.github.gpalaciosopen.*
+io.github.gpc.*
+io.github.gpczekailo.*
+io.github.gpein.*
+io.github.gpr-indevelopment.*
+io.github.gr8-solutions.*
+io.github.gracker.*
+io.github.gradomm.*
+io.github.grails-spring-security-saml.*
+io.github.grakhell.*
+io.github.graphglue.*
+io.github.graphmk.*
+io.github.graphql-java.*
+io.github.graphqly.*
+io.github.gravitymatrix.*
+io.github.graybytes.*
+io.github.greatgarlic.*
+io.github.green4j.*
+io.github.greencode-cz.*
+io.github.greencode-cz.phraseapp.*
+io.github.greenleafoss.*
+io.github.greenn-lab.*
+io.github.greensoftwarelab.*
+io.github.greycode.*
+io.github.greyp9.*
+io.github.greyplane.*
+io.github.grigory-rylov.*
+io.github.grillbaer.*
+io.github.grizzi91.*
+io.github.grom33.*
+io.github.group-robot.*
+io.github.grrolland.*
+io.github.gsidhu900.*
+io.github.gstojsic.bitcoin.*
+io.github.gstojsic.test.*
+io.github.gstsgy.*
+io.github.guaishoun.*
+io.github.guangxian.*
+io.github.guanxwei.*
+io.github.guardjo.*
+io.github.guchdes.*
+io.github.gugalnikov.*
+io.github.gui-yom.*
+io.github.guitar-scale.*
+io.github.guitar123.*
+io.github.guitaro.*
+io.github.gujingjing.*
+io.github.guocjsh.*
+io.github.guohao.*
+io.github.guor1.*
+io.github.guoshiqiufeng.*
+io.github.guosuweidev.*
+io.github.guoyixing.*
+io.github.guoyongsheng.*
+io.github.guoyu511.*
+io.github.guozheng.*
+io.github.guqiyao.*
+io.github.gustafah.*
+io.github.gustavoleitao.*
+io.github.gustiks.*
+io.github.guttenbase.*
+io.github.guvense.*
+io.github.guwan.*
+io.github.guyincognito1986.*
+io.github.guyko.*
+io.github.guymers.*
+io.github.guyuefeng2016.*
+io.github.gvtcy.*
+io.github.gwtplus.gin.*
+io.github.gxd523.*
+io.github.gxhunter.*
+io.github.gxszone.*
+io.github.gybguohao.*
+io.github.gycold.*
+io.github.gyurix.*
+io.github.gyyst.*
+io.github.gzaccaroni.smartparking.*
+io.github.h-ayat.*
+io.github.h-haddad.*
+io.github.h-haddad.hello.*
+io.github.h-schan.*
+io.github.h07000223.*
+io.github.h3nrique.*
+io.github.h4j4x.codegen.*
+io.github.h5jan.*
+io.github.h8000572003.*
+io.github.hWorblehat.*
+io.github.habeebcycle.*
+io.github.hacket.*
+io.github.hadiljr.*
+io.github.hadix-lin.*
+io.github.hadiyarajesh.*
+io.github.hadiyarajesh.flower-core.*
+io.github.hadiyarajesh.flower-ktorfit.*
+io.github.hadiyarajesh.flower-retrofit.*
+io.github.hadymic.*
+io.github.hagay3.*
+io.github.hahahazzz.*
+io.github.haidubogdan.netbeans.modules.jflex.*
+io.github.haidubogdan.netbeans.modules.php.blade.*
+io.github.haifeng303.*
+io.github.hailtondecastro.*
+io.github.haiyangcode.*
+io.github.haiyanghan.*
+io.github.haiyangwu.*
+io.github.hakkelt.*
+io.github.hakky54.*
+io.github.halfweight.*
+io.github.halibobor.*
+io.github.haloer111.*
+io.github.hamawhitegg.*
+io.github.hamurcuabi.*
+io.github.hamzabidi.*
+io.github.hamzamemon.*
+io.github.hamzashoukat94.*
+io.github.hanbikan.*
+io.github.handakumbura.*
+io.github.handharbeni.*
+io.github.handofgod94.*
+io.github.handsomecoder.*
+io.github.hanhankj.*
+io.github.hanpijun-buhanpi.*
+io.github.hantsy.*
+io.github.hanwang1995.*
+io.github.hanxiaofeng.*
+io.github.haodongling.*
+io.github.haopenge.*
+io.github.haoyubihai.*
+io.github.haozi2015.*
+io.github.hap-java.*
+io.github.happybavarian07.*
+io.github.happylishang.*
+io.github.happynomad810.*
+io.github.happysnaker.*
+io.github.happytimor.*
+io.github.hardik-dadhich.*
+io.github.hardycheng-github.*
+io.github.hariprasanths.*
+io.github.harishb2k.*
+io.github.harishb2k.easy.*
+io.github.harishb2k.tools.java.maven.*
+io.github.haross.*
+io.github.harshilsharma63.*
+io.github.harshitjee.*
+io.github.harunobot.*
+io.github.harveyhaha.*
+io.github.harvies.*
+io.github.harvies.charon.*
+io.github.hashiprobr.*
+io.github.hassanalwizrah.*
+io.github.hatchbed.*
+io.github.hayes-roach.*
+io.github.haz00.*
+io.github.hbase4s.*
+io.github.hbmartin.*
+io.github.hboutemy.*
+io.github.hbz.*
+io.github.hcoona.*
+io.github.hdfeng123.*
+io.github.hdfg159.*
+io.github.hdszylcd19.*
+io.github.hdwang123.*
+io.github.hdwhill.*
+io.github.heartalborada-del.*
+io.github.hebamoustafa.horizontallist.*
+io.github.hebeiliang.mipush.*
+io.github.hectorbst.*
+io.github.hedoncz.*
+io.github.hejie12hj.*
+io.github.helbing.astrojsaws.*
+io.github.hele-jeremy.*
+io.github.helio-ecosystem.*
+io.github.helium-cloud.*
+io.github.hellcrowandrey.*
+io.github.hello-cqq.*
+io.github.hellocuriosity.*
+io.github.helpermethod.*
+io.github.hemajoo.foundation.*
+io.github.hengyunabc.*
+io.github.hengyunabc.xdiamond.*
+io.github.henrikbulldog.*
+io.github.henryssondaniel.teacup.*
+io.github.henryssondaniel.teacup.engine.*
+io.github.henryssondaniel.teacup.protocol.*
+io.github.henryssondaniel.teacup.report.*
+io.github.henryssondaniel.teacup.service.report.*
+io.github.henryssondaniel.teacup.service.visualization.*
+io.github.henryssondaniel.teacup.visualization.*
+io.github.henryzhu-dev.*
+io.github.henusen.*
+io.github.hephaestus-metrics.*
+io.github.heqichang.*
+io.github.heqizhengya.*
+io.github.herbertgao.*
+io.github.herui119110.*
+io.github.hexagonframework.boot.*
+io.github.hexagonframework.data.*
+io.github.hexagonnico.*
+io.github.hexhacking.*
+io.github.hextriclosan.*
+io.github.heykb.*
+io.github.heyuch.*
+io.github.heyvital.*
+io.github.hezd.*
+io.github.hezhipengzipp.*
+io.github.hfitp.*
+io.github.hhymason.*
+io.github.hibaldo.*
+io.github.hidou7.*
+io.github.hierarchical-csv.*
+io.github.high-stakes.*
+io.github.highright1234.*
+io.github.hijamoya.*
+io.github.hikari-dev.*
+io.github.hilinzy.*
+io.github.himanshithakur.*
+io.github.himanshusinha-accenture.*
+io.github.hindigarv.*
+io.github.hiperbou.phaser.*
+io.github.hiperbou.ue.*
+io.github.hippah.*
+io.github.hiroyuki-sato.*
+io.github.hishidama.embulk.*
+io.github.hiskrtapps.*
+io.github.histogrammar.*
+io.github.hitechco.*
+io.github.hiverunner.*
+io.github.hj12hj.*
+io.github.hjcenry.*
+io.github.hjhhjhhjh.*
+io.github.hjhhjhhjh.strategyfactory.*
+io.github.hjqiaho.*
+io.github.hkarthik7.*
+io.github.hl845740757.*
+io.github.hlder.proxy.*
+io.github.hlfsousa.*
+io.github.hlg212.*
+io.github.hlg212.fcf.*
+io.github.hligaty.*
+io.github.hmiyado.*
+io.github.hmnshgpt455.*
+io.github.hmvictor.*
+io.github.hnaderi.*
+io.github.hnistzdk.*
+io.github.hnuuhc.*
+io.github.hoangbv15.*
+io.github.hoangchungk53qx1.*
+io.github.hoangdat6353.*
+io.github.hoaucommon.*
+io.github.hoc081098.*
+io.github.hoijui.rezipdoc.*
+io.github.hokofly.*
+io.github.holleymcfly.*
+io.github.holmofy.*
+io.github.holo314.*
+io.github.home4j.*
+io.github.homeant.*
+io.github.homebeaver.*
+io.github.honeycomb-cheesecake.*
+io.github.honeycomb-crypto.core.*
+io.github.hongjinqiu.*
+io.github.honyariot.*
+io.github.hoocen.*
+io.github.hoodihub.*
+io.github.hoplers.*
+io.github.horoc.*
+io.github.horvee.storylog.*
+io.github.hossensyedriadh.*
+io.github.hotcoinblockchain.*
+io.github.hotstu.aspect4a.*
+io.github.hotstu.jsbridge.*
+io.github.hotstu.maotai.*
+io.github.hotstu.moui.*
+io.github.hotstu.rxfetch.*
+io.github.hotstu.soumatou.*
+io.github.houchaofan-s.*
+io.github.houssemba.*
+io.github.houxinlin.*
+io.github.houyijun.*
+io.github.howardjohn.*
+io.github.howardpang.*
+io.github.howinfun.*
+io.github.hpcat432.*
+io.github.hpehl.*
+io.github.hpuhsp.*
+io.github.hq112415.*
+io.github.hqktech.*
+io.github.hrdlotom.*
+io.github.hsci-r.*
+io.github.hse-eolang.*
+io.github.hse-project.*
+io.github.hsicen.*
+io.github.hsiehshujeng.*
+io.github.hslightdb.*
+io.github.hsnket.*
+io.github.hsongxian.*
+io.github.htjywl.*
+io.github.htools.*
+io.github.http-builder-ng.*
+io.github.huacnlee.*
+io.github.huangjie0515.*
+io.github.huangwenge.*
+io.github.huangzhuhua666.*
+io.github.huangziy.*
+io.github.huashijun.*
+io.github.huaweicloud.*
+io.github.hubozhi.*
+io.github.huckhuang.*
+io.github.huerfano-jerson.*
+io.github.hughsimpson.*
+io.github.hugomario.*
+io.github.huguojia.*
+io.github.huherto.*
+io.github.huhu2008.*
+io.github.huhuang03.*
+io.github.huhx.*
+io.github.huiaong.*
+io.github.huisunan.*
+io.github.huiveloper.*
+io.github.hukumister.*
+io.github.humbinal.*
+io.github.humbleui.*
+io.github.humbleui.jwm.*
+io.github.humbleui.skija.*
+io.github.humorsmith.*
+io.github.hunimeizi.*
+io.github.hunterstrategy.*
+io.github.hurelhuyag.*
+io.github.hushenghao.*
+io.github.husnjak.*
+io.github.hussienfahmy.*
+io.github.huynhduy9988.*
+io.github.hvantran.*
+io.github.hvmerode.*
+io.github.hwolf.kvalidation.*
+io.github.hy-liuyuzhe.*
+io.github.hydrawisk793.*
+io.github.hyerica-bdml.*
+io.github.hyfsy.*
+io.github.hylexus.*
+io.github.hylexus.jt.*
+io.github.hylexus.oaks.*
+io.github.hyp712.*
+io.github.hyperbid.*
+io.github.hyperchessbot.*
+io.github.hypernova1.*
+io.github.hypr2771.*
+io.github.hyq0719.*
+io.github.hysting.*
+io.github.hyunikn.*
+io.github.hyxl520.*
+io.github.hyzhan43.*
+io.github.hzpz.spring.boot.*
+io.github.i49.*
+io.github.i4xx.*
+io.github.i7mist.*
+io.github.iac-m.*
+io.github.ialegor.*
+io.github.iamaldren.*
+io.github.iamazy.elasticsearch.dsl.*
+io.github.iamnicknack.simple-lucene.*
+io.github.iamr0s.*
+io.github.iamsurajgharat.*
+io.github.iamthevoid.batteryview.*
+io.github.iamthevoid.extensions.*
+io.github.iamthevoid.mediapicker.*
+io.github.iamthevoid.reactivebinding.*
+io.github.iamyours.*
+io.github.iamzexy.*
+io.github.ian-hoyle.*
+io.github.iangabrielsanchez.*
+io.github.ibenabdallah.*
+io.github.ibony.*
+io.github.ibrahimyilmaz.*
+io.github.ibramsou.*
+io.github.ibuildthecloud.*
+io.github.ibustami.*
+io.github.ice13140167960.*
+io.github.iceCola7.*
+io.github.icedland.iced.*
+io.github.icefrozen.*
+io.github.icemachined.*
+io.github.icemap.*
+io.github.icepring.*
+io.github.icesnowsunhi.*
+io.github.ichizhov.*
+io.github.icloudmap.*
+io.github.icloudthink.*
+io.github.icodegarden.*
+io.github.icusystem.*
+io.github.idata-shopee.*
+io.github.idgobpe-sdk.*
+io.github.idisfkj.*
+io.github.idolofidles.*
+io.github.idolyx.*
+io.github.idonans.appcontext.*
+io.github.idonans.backstack.*
+io.github.idonans.core.*
+io.github.idonans.dynamic.*
+io.github.idonans.lang.*
+io.github.idonans.systeminsets.*
+io.github.idonans.uniontype.*
+io.github.idpbg-it.*
+io.github.iffanmajid.*
+io.github.ifropc.kotomo.*
+io.github.ift-gftc.*
+io.github.igreenwood.loupe.*
+io.github.ihermandev.*
+io.github.iifly.*
+io.github.ikaros0503.*
+io.github.ikegami-yukino.*
+io.github.ikeyat.tools.javadoc2xls.*
+io.github.ikstewa.*
+io.github.ileler.*
+io.github.iliapolo.*
+io.github.illumi.*
+io.github.illyohs.binaryappender.*
+io.github.ilnurnasybullin.*
+io.github.ilonako.*
+io.github.ilpanda.teemo.*
+io.github.iltotore.*
+io.github.ilvdoc.*
+io.github.ilya-rochev.*
+io.github.ilyapavlovskii.*
+io.github.imablanco.*
+io.github.imagineDevit.*
+io.github.imandolatkia.*
+io.github.imanfz.*
+io.github.imashtak.*
+io.github.imchina.*
+io.github.imdb8wrapper.*
+io.github.imdmp.*
+io.github.immort-zyliu.*
+io.github.imongo.*
+io.github.implistarry.*
+io.github.imrobin.*
+io.github.imsejin.*
+io.github.imurx.*
+io.github.imurx.localizedbrowser.*
+io.github.imzix.*
+io.github.in-toto.*
+io.github.inabajunmr.*
+io.github.inahiki-dev.*
+io.github.incight.*
+io.github.incplusplus.*
+io.github.indianghost.*
+io.github.indyaah.*
+io.github.infeez.kotlin-mock-server.*
+io.github.inflationx.*
+io.github.infobip-community.*
+io.github.infoqoch.*
+io.github.informalin.framework.*
+io.github.infotech-group.*
+io.github.ing-vesper.*
+io.github.ing8ar.metrics-common-tags.*
+io.github.inggameteam.*
+io.github.ingmargoudt.*
+io.github.ingrowthly.*
+io.github.ingvard.*
+io.github.innovativeqalab.*
+io.github.innovatorcl.*
+io.github.inpefess.*
+io.github.interacto.*
+io.github.interestinglab.waterdrop.*
+io.github.interestream.*
+io.github.invince.*
+io.github.invvk.*
+io.github.ioanngolovko.*
+io.github.iodevblue.*
+io.github.iosephknecht.*
+io.github.iotclouddeveloper.*
+io.github.iotxc.*
+io.github.ipplus360.*
+io.github.iqosjay.*
+io.github.iquote.*
+io.github.ir-uam.*
+io.github.irajbnarabi.*
+io.github.iredtea.*
+io.github.irevive.*
+io.github.irgaly.kfswatch.*
+io.github.irgaly.kottage.*
+io.github.irgaly.xml.*
+io.github.irobin520.*
+io.github.iron-software.*
+io.github.iruzhnikov.*
+io.github.isMrxxx.*
+io.github.isa-group.*
+io.github.ischca.*
+io.github.isgarlo.*
+io.github.ishaileshmishra.*
+io.github.isharipov.*
+io.github.ishtiaque-pial.*
+io.github.isky123.*
+io.github.isliqian.*
+io.github.ismailbaskin.quarkus.*
+io.github.ismailfakir.*
+io.github.isning.andserver.*
+io.github.isoteriktech.*
+io.github.isotes.*
+io.github.isoulgh.*
+io.github.israiloff.*
+io.github.israiloff.broker.*
+io.github.it-gorillaz.*
+io.github.it-syn.*
+io.github.it346.*
+io.github.italbytz.*
+io.github.italbytz.adapters.meal.*
+io.github.italbytz.infrastructure.*
+io.github.italbytz.ports.*
+io.github.itamarc.*
+io.github.itest-apm.*
+io.github.itfinally.*
+io.github.itguang.*
+io.github.ititus.*
+io.github.itliwei.*
+io.github.itliwei.vboot.*
+io.github.itliwei.vboot.vorm.*
+io.github.itning.*
+io.github.itomych-android.*
+io.github.itroadlabs.*
+io.github.itsaky.*
+io.github.itsxtt.*
+io.github.itzikshiva.*
+io.github.ivanespitiac.*
+io.github.ivanshafran.*
+io.github.ivetech.auxiliaries.*
+io.github.ivnik.*
+io.github.ivy-rew.*
+io.github.ivyiot.*
+io.github.ixinglan.*
+io.github.iyadfawwaz.*
+io.github.iyado.*
+io.github.iyouw.*
+io.github.izachwei.*
+io.github.izerui.*
+io.github.izharahmd.*
+io.github.izpakla.*
+io.github.izuiyou.*
+io.github.izycorp.*
+io.github.j-fooo.*
+io.github.j4ckofalltrades.*
+io.github.j8spec.*
+io.github.jabau.*
+io.github.jaceed.*
+io.github.jackchen365.*
+io.github.jackdaw-cell.*
+io.github.jackdevlab.*
+io.github.jackie-zjw.*
+io.github.jacksontwu.*
+io.github.jacksonwen001.*
+io.github.jackyw.*
+io.github.jackzhou0.*
+io.github.jacob-briscoe.*
+io.github.jadarma.aockt.*
+io.github.jaeseung-bae.sdk.*
+io.github.jagodevreede.*
+io.github.jahrim.*
+io.github.jahrim.chess.*
+io.github.jahrim.wartremover.*
+io.github.jairo91.*
+io.github.jakaarl.*
+io.github.jakey-jp.*
+io.github.jakobwilms.*
+io.github.jam01.*
+io.github.jameschun7.*
+io.github.jamesfchen.*
+io.github.jamgu996.*
+io.github.jamgudev.*
+io.github.jamiees2.*
+io.github.jamoamo.*
+io.github.jamsesso.*
+io.github.jan-tennert.*
+io.github.jan-tennert.discordkm.*
+io.github.jan-tennert.dnsplugin.*
+io.github.jan-tennert.rediskm.*
+io.github.jan-tennert.supabase.*
+io.github.jan-tennert.supacompose.*
+io.github.janderssonse.*
+io.github.janhalasa.*
+io.github.janhicken.*
+io.github.janlely.*
+io.github.janlisse.*
+io.github.jant009.*
+io.github.japharr.*
+io.github.jaqat.*
+io.github.jaqat.remoterobot.*
+io.github.jaredpetersen.*
+io.github.jarent.*
+io.github.jaroslawkula.*
+io.github.jartool.*
+io.github.jarvisjin.*
+io.github.jas34.*
+io.github.jasmingrbo.*
+io.github.jason-apache.lazy-cat.*
+io.github.jason-lang.*
+io.github.jason-wj.*
+io.github.jason5lee.*
+io.github.jasonwu1111.*
+io.github.jaspeen.*
+io.github.jaspercloud.*
+io.github.jasperroel.*
+io.github.jast90.*
+io.github.jav.*
+io.github.java-diff-utils.*
+io.github.java-graphics.*
+io.github.java-native.*
+io.github.java-repeat.*
+io.github.javactrl.*
+io.github.javader.*
+io.github.javaeden.orchid.*
+io.github.javaezlib.*
+io.github.javaf.*
+io.github.javalin.*
+io.github.javasemantic.*
+io.github.javathought.commons.*
+io.github.javaunit.*
+io.github.javernaut.*
+io.github.javiercanillas.*
+io.github.javiercanillas.temporal.newrelic.*
+io.github.javiertuya.*
+io.github.javthon.*
+io.github.jaxer-in.*
+io.github.jay-choe.*
+io.github.jay-g-mehta.*
+io.github.jayanthjj.*
+io.github.jaycetung.*
+io.github.jaychang0917.*
+io.github.jayfella.*
+io.github.jayjieh.*
+io.github.jayyuz.core.*
+io.github.jayyuz.dynamic.*
+io.github.jayzhang.*
+io.github.jazorp.*
+io.github.jbellassai.koncentric.*
+io.github.jbock-java.*
+io.github.jbonifay.*
+io.github.jbsooter.*
+io.github.jbwheatley.*
+io.github.jccdex.*
+io.github.jcechace.*
+io.github.jchapuis.*
+io.github.jcharm.*
+io.github.jcohy.*
+io.github.jcohy.gradle.aliyun-oss.*
+io.github.jcohy.gradle.aliyun-publishing.*
+io.github.jcohy.gradle.asciidoctor-conventions.*
+io.github.jcohy.gradle.convention.*
+io.github.jcohy.gradle.gradle-plugin-publishing.*
+io.github.jcohy.gradle.javadoc-aggregate.*
+io.github.jcohy.gradle.javadoc-conventions.*
+io.github.jcohy.gradle.javadoc.*
+io.github.jcohy.gradle.nexus-publishing.*
+io.github.jcohy.gradle.nexus-s01-publishing.*
+io.github.jcohy.gradle.optional-dependencies.*
+io.github.jcohy.gradle.test-failures.*
+io.github.jcs-ci.*
+io.github.jdbctemplatemapper.*
+io.github.jdbcx.*
+io.github.jdcmp.*
+io.github.jdevhl.*
+io.github.jdevlibs.*
+io.github.jdiscordbots.*
+io.github.jdlopez.*
+io.github.jdpxiaoming.*
+io.github.jeancnasc.testando.*
+io.github.jeancnasc.testando.testando-maven-release.*
+io.github.jeancsanchez.jcplayer.*
+io.github.jeancsanchez.photoviewslider.*
+io.github.jeanls.*
+io.github.jebeaudet.*
+io.github.jebl01.*
+io.github.jeddict.*
+io.github.jeec.*
+io.github.jeemv.springboot.vuejs.*
+io.github.jeff-zou.*
+io.github.jeffersono7.*
+io.github.jeffery0628.*
+io.github.jefferyeven.*
+io.github.jeffskj.cdversions.*
+io.github.jeffskj.flock.*
+io.github.jefshi.*
+io.github.jensdietrich.saflate.*
+io.github.jenyaatnow.*
+io.github.jeqo.*
+io.github.jeqo.dropwizard.*
+io.github.jeqo.kafka.*
+io.github.jeqo.micrometer.*
+io.github.jeqo.zipkin.*
+io.github.jeremyliao.*
+io.github.jeremylong.*
+io.github.jeremyrsmith.*
+io.github.jeroenherczeg.*
+io.github.jeromevdl.awscdk.*
+io.github.jerrychin.*
+io.github.jerryliuinfo.*
+io.github.jervenbolleman.*
+io.github.jesushai.*
+io.github.jethronap.*
+io.github.jetkai.*
+io.github.jevanlingen.*
+io.github.jeyhung.*
+io.github.jfermat.*
+io.github.jffiorillo.*
+io.github.jgkamat.JayLayer.*
+io.github.jglrxavpok.hephaistos.*
+io.github.jhannes.*
+io.github.jhannes.openapi.*
+io.github.jhauffa.*
+io.github.jhdcruz.*
+io.github.jheinzel.*
+io.github.jhipster.*
+io.github.jhipster.loaded.*
+io.github.jhstatewide.*
+io.github.jiahui90.*
+io.github.jiangeeq.*
+io.github.jiangjm424.*
+io.github.jiangxincode.*
+io.github.jiangyongyuan.*
+io.github.jianjianghui.*
+io.github.jianzhichun.*
+io.github.jiaonliao.*
+io.github.jiaozi789.tool.*
+io.github.jiashunx.*
+io.github.jiawade.*
+io.github.jiayuliang1314.*
+io.github.jica98.*
+io.github.jiefeiguanyu.*
+io.github.jiefenn8.graphloom.*
+io.github.jiemakel.*
+io.github.jieniyou.*
+io.github.jieny.*
+io.github.jiinwoo.*
+io.github.jimmy-j.*
+io.github.jimmyd-be.*
+io.github.jimregan.*
+io.github.jincheol5.*
+io.github.jinchunzhao.comparator.*
+io.github.jinchunzhao.trim.*
+io.github.jinghui70.*
+io.github.jingweiwang.library.*
+io.github.jinlongliao.*
+io.github.jinrunheng.*
+io.github.jintelligent.*
+io.github.jintin.*
+io.github.jinxiyang.*
+io.github.jiopay-help.*
+io.github.jiopay.*
+io.github.jiri-meluzin.*
+io.github.jisheyu675.*
+io.github.jistol.*
+io.github.jisungbin.*
+io.github.jitendrakumar2006.*
+io.github.jitendrakumar2006.automaticrelease.*
+io.github.jitendrakumar2006.demo.*
+io.github.jitendrakumar2006.demo7.*
+io.github.jitendrakumar2006.demofromprivaterepo.*
+io.github.jitwxs.*
+io.github.jiusiz.*
+io.github.jixiaoxin-5844.*
+io.github.jixiongxu.*
+io.github.jja08111.*
+io.github.jjeewan.*
+io.github.jjldxz.*
+io.github.jjxliu306.*
+io.github.jkhantechnophile.*
+io.github.jkindwall.*
+io.github.jklingsporn.*
+io.github.jkobejs.*
+io.github.jkrauze.*
+io.github.jkrauze.enumgen.*
+io.github.jlguenego.*
+io.github.jlike.*
+io.github.jlmc.*
+io.github.jlynchsd.androidxtensions.*
+io.github.jmatsu.*
+io.github.jmcardon.*
+io.github.jmcleodfoss.*
+io.github.jmformenti.*
+io.github.jmisabella.*
+io.github.jmseb3.*
+io.github.jna4usb.*
+io.github.jnan88.*
+io.github.jnasmartcardio.*
+io.github.joacovela16.*
+io.github.joafalves.*
+io.github.joakim-eriksson.*
+io.github.joakimkistowski.*
+io.github.joana-team.*
+io.github.joangtsq.*
+io.github.joblo2213.*
+io.github.jocelynmutso.*
+io.github.jodavimehran.*
+io.github.joealisson.*
+io.github.joecqupt.imitate.*
+io.github.joeiot.*
+io.github.joel-jeremy.deezpatch.*
+io.github.joel-jeremy.externalized-properties.*
+io.github.joeljeremy7.deezpatch.*
+io.github.joeljeremy7.externalizedproperties.*
+io.github.joelromanpr.*
+io.github.joelzhu.*
+io.github.joerg-pfruender.*
+io.github.joergreichert.*
+io.github.joesteven.*
+io.github.joeweh.*
+io.github.joeybling.*
+io.github.joeyscat.*
+io.github.jogold.*
+io.github.johannesbuchholz.*
+io.github.johendeng.*
+io.github.joheras.*
+io.github.johnhungerford.generic.schema.*
+io.github.johnhungerford.rbac.*
+io.github.johnjcool.*
+io.github.johnkil.*
+io.github.johnlinp.*
+io.github.johnqxu.*
+io.github.johnshazhu.*
+io.github.joht.alias.*
+io.github.joke.*
+io.github.joke.spring-factory.*
+io.github.joker-fu.*
+io.github.joker-pper.*
+io.github.joker1007.*
+io.github.jokoroukwu.*
+io.github.jolasjoe.*
+io.github.jonanorman.android.*
+io.github.jonas.*
+io.github.jonaskoelker.*
+io.github.jonasschaub.*
+io.github.jonathanlink.*
+io.github.jonathanxd.*
+io.github.jonestimd.*
+io.github.jongmin92.*
+io.github.jonrmar.*
+io.github.jools-uk.*
+io.github.jopatai.*
+io.github.jopenlibs.*
+io.github.joramkimata.*
+io.github.jordond.voyager.*
+io.github.joreilly.*
+io.github.jorgekue.fm.ext.*
+io.github.jorgerojasdev.*
+io.github.jos12580.*
+io.github.josecarlosbran.*
+io.github.joseerodrigues.utils.*
+io.github.joselion.*
+io.github.josephrodriguez.*
+io.github.josevjunior.*
+io.github.joshuazhan.*
+io.github.joshwycuff.*
+io.github.joveval.bots.*
+io.github.joveval.util.*
+io.github.jpasearch.*
+io.github.jpcasas.ibm.plugin.*
+io.github.jpcasas.ibm.plugin.assemblies.*
+io.github.jpcasas.ibm.plugin.pom.*
+io.github.jpenren.*
+io.github.jpmorganchase.fusion.*
+io.github.jponge.*
+io.github.jrestclients.*
+io.github.jrlucier.xoro.*
+io.github.jrosenkranz.opts.*
+io.github.jrsolomon.*
+io.github.jsappsugar.*
+io.github.jsarni.*
+io.github.jsfrench.*
+io.github.jsfwa.*
+io.github.jshalaby510.*
+io.github.jsoagger.*
+io.github.jsoladur.*
+io.github.json-snapshot.*
+io.github.jsonms.*
+io.github.jspinak.*
+io.github.jsssk.*
+io.github.jsteinich.*
+io.github.jswk.ms.*
+io.github.jsx112.*
+io.github.jto.*
+io.github.juan-carlos-duarte.*
+io.github.juanimoli.strictmode.notifier.*
+io.github.jubongoh.*
+io.github.judegpinto.*
+io.github.juffrou.*
+io.github.juhaku.*
+io.github.juicemx.*
+io.github.jujube-framework.*
+io.github.julian-alarcon.*
+io.github.julianfalcionelli.*
+io.github.juliano.*
+io.github.julianobrl.*
+io.github.julianrueck.*
+io.github.juliantcook.*
+io.github.juliengalet.*
+io.github.julucinho.*
+io.github.julwas797.*
+io.github.julwas797.esaapi.*
+io.github.julystars.*
+io.github.jun1983.*
+io.github.jun1orchan.*
+io.github.junbaor.*
+io.github.juneau001.*
+io.github.junhuhdev.*
+io.github.junicorn.*
+io.github.juniqlim.*
+io.github.junjiejack.*
+io.github.junxworks.*
+io.github.jupf.staticlog.*
+io.github.jupf.staticonf.*
+io.github.juphoon-app.*
+io.github.jusebandtec.*
+io.github.just0119.*
+io.github.justdooooit.*
+io.github.justin-lewis.*
+io.github.justinalucard.*
+io.github.justinnk.masonssa.*
+io.github.justinwjq.*
+io.github.justinwlin-amazon.*
+io.github.justlel.*
+io.github.justtimki.*
+io.github.juuxel.*
+io.github.jvm-build-service-test-data.maven-external-parent.*
+io.github.jvm-build-service-test-data.maven-version-from-parent-enforce-version.*
+io.github.jvmartinez.*
+io.github.jvmusin.naked.*
+io.github.jvrni.*
+io.github.jwdeveloper.exaple.*
+io.github.jwdeveloper.spigot.*
+io.github.jwdeveloper.spigot.tester.*
+io.github.jxnflzc.*
+io.github.jxnflzc.jtools.*
+io.github.jxnflzc.kotlin.*
+io.github.jxnu-liguobin.*
+io.github.jxy96.*
+io.github.jyllands-posten.*
+io.github.jyrkioraskari.*
+io.github.jzdayz.*
+io.github.k-bachilo-work.*
+io.github.k-bachilo.*
+io.github.k-singh.*
+io.github.k3nn.*
+io.github.k7t3.*
+io.github.kag0.*
+io.github.kaginawa.*
+io.github.kailaisi.*
+io.github.kailaisi.vmserviceurilib.*
+io.github.kaiso.relmongo.*
+io.github.kaixindeken.*
+io.github.kakaocup.*
+io.github.kakyire.*
+io.github.kalac2232.*
+io.github.kalextaday.*
+io.github.kali-client.*
+io.github.kalin-rudnicki.*
+io.github.kalumcode.*
+io.github.kamaravichow.*
+io.github.kamarias.*
+io.github.kamiloj.*
+io.github.kamilszewc.*
+io.github.kamilszewc.resourcewatcher.*
+io.github.kamilszewc.tabulator.*
+io.github.kamismile.*
+io.github.kangarooxin.*
+io.github.kangdp.*
+io.github.kangjianqun.*
+io.github.kanglong1023.*
+io.github.kangyee.*
+io.github.kangzhengwei.*
+io.github.kaposke.*
+io.github.karadia10.*
+io.github.karamvsingh.backend-framework.*
+io.github.karanshah-browserstack.*
+io.github.kare.*
+io.github.karimagnusson.*
+io.github.karlatemp.*
+io.github.karlatemp.jhf.*
+io.github.karlatemp.jvm-hook-framework.*
+io.github.karlatemp.mxlib.*
+io.github.karols.*
+io.github.karstenspang.*
+io.github.kartashovaa.teddi.*
+io.github.karthikrathinavel.*
+io.github.karthyks.*
+io.github.karya-inc.*
+io.github.kascoder.*
+io.github.kashif-e.*
+io.github.kasiafi.*
+io.github.kasparthommen.codegen.*
+io.github.kaststream.*
+io.github.kasukusakura.*
+io.github.kasukusakura.authorization.*
+io.github.katarem.katapi.*
+io.github.katerinapetrova.*
+io.github.kaustubhpatange.*
+io.github.kavahub.*
+io.github.kawaiidango.kumo-android.*
+io.github.kawamuray.wasmtime.*
+io.github.kawaxte.*
+io.github.kawwik.*
+io.github.kaygenzo.*
+io.github.kayr.*
+io.github.kayr.gradle.ezyquery.*
+io.github.kayz666.*
+io.github.kazarf007.*
+io.github.kazemcodes.*
+io.github.kazumasa-kusaba.*
+io.github.kbkbqiang.*
+io.github.kbuntrock.*
+io.github.kc7bfi.*
+io.github.kcmvp.*
+io.github.kdatta21.*
+io.github.kdk96.*
+io.github.kdprog.*
+io.github.keetraxx.*
+io.github.keguoyu.*
+io.github.keirlawson.*
+io.github.keithjohn.*
+io.github.keks51.*
+io.github.kelvindev15.*
+io.github.ken-tune.*
+io.github.kenewstar.*
+io.github.kenix.*
+io.github.kennfalcon.*
+io.github.keonwangjw.*
+io.github.kerubistan.kroki.*
+io.github.kerwin612.*
+io.github.ketiko.*
+io.github.ketzalv.*
+io.github.kev1nst.*
+io.github.kevenzxd.*
+io.github.kevin4936.*
+io.github.kevinnzou.*
+io.github.kevinpan45.*
+io.github.kevinschildhorn.*
+io.github.kevinschildhorn.atomik.*
+io.github.kevinzhwl.*
+io.github.kevlar-kt.*
+io.github.kewei1.*
+io.github.keweize.*
+io.github.key-del-jeeinho.*
+io.github.key762.*
+io.github.keyintegrity.*
+io.github.keymaster65.*
+io.github.kezhenxu94.*
+io.github.kgress.scaffold-archetype.*
+io.github.kgress.scaffold.*
+io.github.kgsnipes.*
+io.github.kh0ma.*
+io.github.khalicki.*
+io.github.khangta.*
+io.github.khda91.*
+io.github.khda91.reportportal.cucumber.*
+io.github.khj-dev.*
+io.github.khm0651.*
+io.github.khoamt.*
+io.github.khoben.woff2-android.*
+io.github.kiambogo.*
+io.github.kiberStender.*
+io.github.kiberneticworm.*
+io.github.kicksolutions.*
+io.github.kidminks.*
+io.github.kientux.*
+io.github.kierendavies.*
+io.github.kigsmtua.*
+io.github.kijuky.*
+io.github.kikovalle.com.panxoloto.sharepoint.rest.*
+io.github.killbillsdev.*
+io.github.killergerbah.*
+io.github.kilmajster.*
+io.github.kimchi-dev.*
+io.github.kinasr.*
+io.github.kindred-app.*
+io.github.king-ma1993.*
+io.github.king-pep.*
+io.github.kingcjy.*
+io.github.kingpulse.*
+io.github.kings1990.*
+io.github.kingwang666.*
+io.github.kinjal-mc.*
+io.github.kiouri.*
+io.github.kirill5k.*
+io.github.kirinhorse.*
+io.github.kiritoko1029.*
+io.github.kisenhuang.*
+io.github.kishansital.*
+io.github.kiskae.*
+io.github.kislaykishore.*
+io.github.kiss4u.*
+io.github.kitlangton.*
+io.github.kivensolo.*
+io.github.kiwionly.*
+io.github.kjarrio.*
+io.github.kjens93.*
+io.github.kjens93.async.*
+io.github.kjens93.conversations.*
+io.github.kjens93.cs5200.hw4.*
+io.github.kjens93.edmunds.*
+io.github.kjens93.funkier.*
+io.github.kjens93.promises.*
+io.github.kjt0429.*
+io.github.kju2.languagedetector.*
+io.github.kkarnauk.*
+io.github.kkingso.*
+io.github.kkoshin.*
+io.github.klassenkonstantin.*
+io.github.klee-contrib.*
+io.github.klein-stein.*
+io.github.klindziukp.*
+io.github.kllkko.*
+io.github.kloping.*
+io.github.klover2.*
+io.github.klxair.*
+io.github.kmgowda.*
+io.github.kmgowda.sbk.*
+io.github.kmozsi.*
+io.github.kmp5.*
+io.github.knaw-huc.*
+io.github.knife-fish.*
+io.github.knight-zxw.*
+io.github.knightoneadmin.*
+io.github.knolduslabs.*
+io.github.knonm.*
+io.github.knowledgecaptureanddiscovery.*
+io.github.knowstack.*
+io.github.ko-devHong.*
+io.github.koalaplot.*
+io.github.kobylynskyi.*
+io.github.kochchy.*
+io.github.koder11.*
+io.github.kohsah.*
+io.github.kojiv.*
+io.github.kokecena.*
+io.github.kolesnikovm.*
+io.github.kolod.*
+io.github.konfork.*
+io.github.kongpf8848.*
+io.github.kongxiaoan.*
+io.github.konohiroaki.*
+io.github.koombea.*
+io.github.koory1st.*
+io.github.kordyukov.*
+io.github.kory33.*
+io.github.koryl.*
+io.github.kosik.*
+io.github.kosmonaffft.*
+io.github.kosmx.*
+io.github.kostaskougios.*
+io.github.kostjas.*
+io.github.kotlin-graphics.*
+io.github.kotlinbyte.*
+io.github.kotools.*
+io.github.kouchengjian.*
+io.github.kouleen.breadlib.*
+io.github.koushenhai.*
+io.github.koustavtub.*
+io.github.kozemirov.*
+io.github.kpeedosk.*
+io.github.kpihlblad.*
+io.github.kpn-dsh.*
+io.github.kpolley.*
+io.github.kranberry-io.*
+io.github.krasnoludkolo.*
+io.github.krishari2020.*
+io.github.krishna-elear.*
+io.github.krishp9.*
+io.github.kristineberg.*
+io.github.krupen.*
+io.github.krzys9876.*
+io.github.ks-shim.crf4j.*
+io.github.ks-shim.j-image-hash.*
+io.github.ks-shim.klay.*
+io.github.kscripting.*
+io.github.kshashov.*
+io.github.ksrainarthas.*
+io.github.ktakashi.oas.stub.*
+io.github.ktakashi.oas.stub.spring.*
+io.github.ktakashi.peg.*
+io.github.ktvipin27.*
+io.github.ku-quick.*
+io.github.kuangdaihu.*
+io.github.kubenext.*
+io.github.kubrickliu.*
+io.github.kuglblitz.*
+io.github.kuloud.*
+io.github.kumareshbabuns.*
+io.github.kunghsu1021.*
+io.github.kunpeng-io.*
+io.github.kuraun.*
+io.github.kurniawanrizzki.*
+io.github.kursor1337.*
+io.github.kushuis.*
+io.github.kuuuurt.*
+io.github.kvlabs.filemock.*
+io.github.kwahome.sopa.*
+io.github.kwai-apis.*
+io.github.kwaiappteam.*
+io.github.kwakiutlcs.*
+io.github.kwamekert.*
+io.github.kwbhatti.*
+io.github.kyay10.kotlin-all-static.*
+io.github.kyay10.kotlin-lambda-return-inliner.*
+io.github.kyay10.kotlin-null-defaults.*
+io.github.kylin-hunter.*
+io.github.kyuseok-oh.*
+io.github.kzmake.*
+io.github.l4digital.*
+io.github.l86400.*
+io.github.lab515.*
+io.github.lafladiens.assist.*
+io.github.laipi888.*
+io.github.lairdli.*
+io.github.lairdli.android.*
+io.github.lakehubo.*
+io.github.lakernote.*
+io.github.lambdadeltal.*
+io.github.lambdaprime.*
+io.github.lambig.*
+io.github.laminalfalah.*
+io.github.lamp-china.ledis.*
+io.github.lamtong.*
+io.github.lanace.*
+io.github.lancelothuxi.*
+io.github.landashu.*
+io.github.landerlyoung.*
+io.github.landgrafhomyak.itmo.*
+io.github.landrynorris.*
+io.github.landrynorris.analytiks.*
+io.github.landuo.*
+io.github.lanen.*
+io.github.lang-zh.*
+io.github.langqiang.*
+io.github.laniakeamly.*
+io.github.lanicc.*
+io.github.lansdialog.*
+io.github.lanshifu.*
+io.github.lant.maelstrom-java.*
+io.github.lanters10.*
+io.github.lanxinplus.*
+io.github.lao4j.*
+io.github.laoyouzhibo.*
+io.github.lapidus79.*
+io.github.lapism.*
+io.github.laplacedemon.*
+io.github.lapsushq.*
+io.github.larsid.*
+io.github.lasselindqvist.*
+io.github.lastincisor.*
+io.github.lastwhispers.*
+io.github.lavalike.*
+io.github.lavrov.src.*
+io.github.lawkai.*
+io.github.lazy-engineer.*
+io.github.lbellonda.*
+io.github.lcf-wmz.*
+io.github.lckjcnWq.*
+io.github.lcoder1024.*
+io.github.lcriadof.*
+io.github.lcrobotics.*
+io.github.ldelpino.libs.*
+io.github.ldh8267937.*
+io.github.ldhai99.*
+io.github.ldi-github.*
+io.github.leberkleber.ljcm.*
+io.github.lee1208.*
+io.github.leeds-beckett-digital-learning.*
+io.github.leeg4ng.*
+io.github.leegive.*
+io.github.leeigithub.*
+io.github.leejoker.*
+io.github.leeoohoo.*
+io.github.leeseojune53.*
+io.github.leetaehoon-android.*
+io.github.leeyxq.*
+io.github.leguan16.*
+io.github.leibniz2023.*
+io.github.leibnizhu.*
+io.github.leichtundkross.*
+io.github.leidenn2509.*
+io.github.leishui.*
+io.github.lelingv.*
+io.github.lematechx.*
+io.github.lemiones.*
+io.github.lemonxah.*
+io.github.lempel.*
+io.github.lenblazy.*
+io.github.lenglong.*
+io.github.lengmianshi.*
+io.github.lennertsoffers.*
+io.github.leobert-lan.*
+io.github.leofuso.*
+io.github.leofuso.columba.*
+io.github.leogitpub.*
+io.github.leoli233.*
+io.github.leon406.*
+io.github.leon406.android.*
+io.github.leonschreuder.*
+io.github.leonside.*
+io.github.leoprover.*
+io.github.leovr.*
+io.github.leslienan.*
+io.github.let-see.*
+io.github.letitb.*
+io.github.letmeno1.*
+io.github.leviysoft.*
+io.github.lex-geeker.*
+io.github.lex-geeker.runtime.*
+io.github.lexinda.*
+io.github.lf2a.*
+io.github.lgatodu47.*
+io.github.lgl48128244.*
+io.github.lgmn2018.jpa-plus.*
+io.github.lgp547.*
+io.github.lhg-vv.*
+io.github.lhogie.*
+io.github.lhotari.*
+io.github.lhoyong.*
+io.github.lhs8701.*
+io.github.lhug.*
+io.github.lhysin.*
+io.github.li-rixin.*
+io.github.li-xiaojun.*
+io.github.liangke21.*
+io.github.libedi.*
+io.github.libkodi.*
+io.github.libkodi.mdbs.*
+io.github.libktx.*
+io.github.libolf.*
+io.github.libpd.android.*
+io.github.librewsdl4j.*
+io.github.libsdl4j.*
+io.github.lichenaut.*
+io.github.licy5352.*
+io.github.licy5352.dagger.*
+io.github.licy5352.migratedb.*
+io.github.licy5352.test.*
+io.github.lidiagurieva.*
+io.github.lierabbit.*
+io.github.liewhite.*
+io.github.liflab.*
+io.github.ligasgr.blocks.*
+io.github.light0x00.*
+io.github.light2dev.*
+io.github.lightguard.documentation.*
+io.github.ligonghai.*
+io.github.lihaihong.*
+io.github.lihewei7.*
+io.github.lihongfeng0121.*
+io.github.lijheng.*
+io.github.lijiahangmax.*
+io.github.lijieqing.*
+io.github.lijing11.*
+io.github.lilongweidev.*
+io.github.limbo-world.*
+io.github.limengning.*
+io.github.limoxiao.*
+io.github.limsk1993.*
+io.github.limxtop1989.*
+io.github.linaje-projects.*
+io.github.linceln.*
+io.github.lindaifeng.*
+io.github.lineageco.*
+io.github.linfeng666.*
+io.github.linguaphylo.*
+io.github.linguaphylo.platforms.lphy-java.*
+io.github.linguaphylo.platforms.lphy-publish.*
+io.github.lingyun666.*
+io.github.linhelurking.*
+io.github.linlishui.*
+io.github.linmoure.*
+io.github.linpeilie.*
+io.github.linpopopo.*
+io.github.linsang21.*
+io.github.linsminecraftstudio.*
+io.github.linter-cn.*
+io.github.linus87.*
+io.github.linuxforhealth.*
+io.github.linwg1988.*
+io.github.linx-opennetwork.*
+io.github.linyimin0812.*
+io.github.linyxus.*
+io.github.linzengrui017.*
+io.github.linzesu.*
+io.github.linzy8888.*
+io.github.liqim.*
+io.github.liquibase4s.*
+io.github.lisa-analyzer.*
+io.github.lisi114.*
+io.github.lisim2023.*
+io.github.lissa-approach.lissa-core.*
+io.github.listaction.jacksonbean.*
+io.github.listenzz.*
+io.github.litao0621.*
+io.github.litmus-benchmark-suite.*
+io.github.littlenag.*
+io.github.liu-chang-an.*
+io.github.liuchao0206.*
+io.github.liudaolunboluo.tracer.*
+io.github.liuetengsheng.*
+io.github.liujiaxin1314.*
+io.github.liukai2530533.*
+io.github.liukaizhen.*
+io.github.liuruinian.*
+io.github.liusir008.*
+io.github.liuwb2001.*
+io.github.liuweile.*
+io.github.liuwenlovecoding.simplecommons.*
+io.github.liuye744.*
+io.github.liuyuns.*
+io.github.liuyuyu.*
+io.github.liuziyuan.*
+io.github.liveisgood8.*
+io.github.livingdocumentation.*
+io.github.livk-cloud.*
+io.github.liwei0903nn.*
+io.github.lix511.*
+io.github.lixhbs.*
+io.github.liyang920716.*
+io.github.liyinan2333.*
+io.github.liyuzheng.*
+io.github.liyze09.*
+io.github.lizhixin1992.twittered.*
+io.github.lizonezhi.*
+io.github.lizongying.*
+io.github.ljezio.*
+io.github.ljnelson.*
+io.github.ljwlgl.*
+io.github.ljwx.*
+io.github.lkapitman.*
+io.github.lkl22.lint.*
+io.github.ll-sanmu-ll.*
+io.github.llamalad7.*
+io.github.llewvallis.*
+io.github.llh4github.*
+io.github.lll-666.*
+io.github.llnancy.*
+io.github.llxxbb.*
+io.github.lmikoto.*
+io.github.lmjssjj.*
+io.github.lmlx66.*
+io.github.lmm1990.*
+io.github.lmxy1990.*
+io.github.lnguyen99.*
+io.github.lni-dev.*
+io.github.lnsantos.*
+io.github.loatchi.tiktok.*
+io.github.lock-free.*
+io.github.locke-chappel.oss.*
+io.github.locke-chappel.oss.app.*
+io.github.locke-chappel.oss.commons.*
+io.github.logback-classmate.*
+io.github.logging-context.*
+io.github.logix-digital-solutions.*
+io.github.lognet.*
+io.github.lognet.grpc-spring-boot.*
+io.github.logrecorder.*
+io.github.logtube.*
+io.github.lokarzz.*
+io.github.lollipok.*
+io.github.lomom.*
+io.github.lomtalay.*
+io.github.lonelypluto.*
+io.github.long117long.*
+io.github.long76.*
+io.github.longan-studio.*
+io.github.longbridgeapp.*
+io.github.longdt57.*
+io.github.longluo.*
+io.github.longphamduc.*
+io.github.longwa.*
+io.github.longxu0509.*
+io.github.longyg.*
+io.github.loom.*
+io.github.loongzh.*
+io.github.lordakkarin.*
+io.github.lordanaku.*
+io.github.loren-moon.*
+io.github.lorenzobettini.edelta.*
+io.github.lorenzobettini.jbase.*
+io.github.lorenzobettini.klaim.*
+io.github.lorenzobettini.xtextutils.*
+io.github.lostmsu.*
+io.github.lostoy0.*
+io.github.loudrascal.*
+io.github.loushi135.*
+io.github.lovelyswallow.*
+io.github.lovelz.*
+io.github.lowcode-tools.*
+io.github.lowes.*
+io.github.lpicanco.*
+io.github.lprakashv.*
+io.github.lqj155.*
+io.github.ls1110924.view.*
+io.github.lsd-consulting.*
+io.github.lshaci.*
+io.github.lsoares.*
+io.github.ltttttttttttt.*
+io.github.ltyro.*
+io.github.luca992.*
+io.github.luca992.cash.z.ecc.android.*
+io.github.luca992.com.alialbaali.kamel.*
+io.github.luca992.dev.icerock.moko.*
+io.github.luca992.getenv-kt.*
+io.github.luca992.multiplatform-swiftpackage.*
+io.github.lucacirillo2738.*
+io.github.lucanicoladebiasi.*
+io.github.lucapiccinelli.*
+io.github.lucasepe.*
+io.github.lucasmdjl96.*
+io.github.lucasstarsz.*
+io.github.lucasstarsz.fastj.*
+io.github.lucasstarsz.slopeecs.*
+io.github.lucasxu01.*
+io.github.lucavinci.*
+io.github.luccaflower.*
+io.github.luckcz.*
+io.github.lucklike.*
+io.github.lucksiege.*
+io.github.ludifeixingyuan.*
+io.github.ludo05.*
+io.github.ludongrong.*
+io.github.ludorival.*
+io.github.ludvigwesterdahl.*
+io.github.lufm0628.*
+io.github.luiing.*
+io.github.luiinge.*
+io.github.luismibarcos.*
+io.github.luiziffer.*
+io.github.lujian213.*
+io.github.lukalike.*
+io.github.lukasaslt.*
+io.github.lukasdylan.*
+io.github.lukebemish.brainfrick.*
+io.github.lukehutch.*
+io.github.lumnitzf.*
+io.github.lunasaw.*
+io.github.luneo7.*
+io.github.lunkes-apps.*
+io.github.luo-zhan.*
+io.github.luodash.*
+io.github.luohaohaha.*
+io.github.luojianping168.*
+io.github.luojilab.*
+io.github.luokangyuan.*
+io.github.luons.engine.*
+io.github.luoqqsh.*
+io.github.luoxuwei.*
+io.github.luqinx.*
+io.github.luraframework.*
+io.github.lurenman.*
+io.github.lusis.dropwizard.*
+io.github.luversof.*
+io.github.luyeloveyou.*
+io.github.luyiisme.*
+io.github.luyw520.*
+io.github.luzzu.*
+io.github.lvalkenberg.javaTourOptimizer.*
+io.github.lvdkooi.*
+io.github.lvivco.*
+io.github.lvyahui8.*
+io.github.lwcla.*
+io.github.lwj2333.*
+io.github.lwj2333.hepler.*
+io.github.lwjfork.*
+io.github.lwjweiqi.*
+io.github.lwlee2608.*
+io.github.lwq497539389.*
+io.github.lx865712528.*
+io.github.lxgaming.*
+io.github.lxlfpeng.*
+io.github.lxwdg.*
+io.github.lyc8503.*
+io.github.lydxy.*
+io.github.lygttpod.*
+io.github.lygttpod.android-local-service.*
+io.github.lygttpod.monitor.*
+io.github.lyh200.*
+io.github.lyousan.*
+io.github.lyrric.*
+io.github.lyvoc.*
+io.github.lywbh.*
+io.github.lyxnx.*
+io.github.lyxnx.android-catalogs-config.*
+io.github.lyxnx.android-compose-config.*
+io.github.lyxnx.android-firebase-config.*
+io.github.lyxnx.android-hilt-config.*
+io.github.lyxnx.android-room-config.*
+io.github.lyxnx.compodals.*
+io.github.lyxnx.gradle.*
+io.github.lyxnx.gradle.android.*
+io.github.lza1047771038.*
+io.github.lzh0379.*
+io.github.lzhiyong.*
+io.github.lzyang187.*
+io.github.m-ds.inssutils.*
+io.github.m-hromov.*
+io.github.m-m-m.*
+io.github.m-moris.*
+io.github.m0coding.*
+io.github.m2ci-msp.*
+io.github.m4gr3d.*
+io.github.m942890653.*
+io.github.ma-jian.*
+io.github.ma1uta.matrix.*
+io.github.maafk.*
+io.github.maamissiniva.*
+io.github.maanaim.*
+io.github.macaque0.*
+io.github.maciabit.*
+io.github.mackimaow.*
+io.github.macster110.*
+io.github.maczikasz.*
+io.github.madtechlab.*
+io.github.mafei6827.*
+io.github.magic-core.*
+io.github.magical-xian.*
+io.github.magicpenproject.*
+io.github.magicpluginteam.*
+io.github.magicstar7213.*
+io.github.magrifle.*
+io.github.mahdibohloul.*
+io.github.mahieddine.*
+io.github.maichanchinh.*
+io.github.maicolantali.*
+io.github.maicolantali.clashj.*
+io.github.mainakb.*
+io.github.mainstringargs.*
+io.github.mainstringargs.alphavantagescraper.*
+io.github.maitrungduc1410.*
+io.github.majianzheng.*
+io.github.maju-blogs.*
+io.github.majusko.*
+io.github.makar1031.*
+io.github.makhnevvitalik.*
+io.github.makhosh.*
+io.github.makingme.*
+io.github.makingthematrix.*
+io.github.makintsian.*
+io.github.maksymdolgykh.dropwizard.*
+io.github.maldil.*
+io.github.maliangnansheng.*
+io.github.maliangxue.*
+io.github.malikzh.*
+io.github.malteseduck.springframework.data.*
+io.github.malyszaryczlowiek.*
+io.github.mamonovd.*
+io.github.manbucy.*
+io.github.manedev79.*
+io.github.mangkyu.*
+io.github.manhtu1997.*
+io.github.manjitthind.*
+io.github.mankamolnar.*
+io.github.manmeet-vtnetzwelt.*
+io.github.manojpawar94.*
+io.github.manson-chen.*
+io.github.manuelarte.spring.*
+io.github.manusant.*
+io.github.manzurola.*
+io.github.maodua.*
+io.github.maoer33.*
+io.github.maoqiqi.*
+io.github.maowimpl.*
+io.github.maoxianglong.*
+io.github.mapstream.*
+io.github.maqing-programmer.*
+io.github.maratangsoft.*
+io.github.marcelorubim.*
+io.github.marcelosantosti.*
+io.github.marchliu.*
+io.github.marcinzh.*
+io.github.marcocrasso.*
+io.github.marcopotok.*
+io.github.marcoslimaqa.*
+io.github.marcperez06.*
+io.github.marianovarela.*
+io.github.mariazevedo88.*
+io.github.mario-s.*
+io.github.marioalvial.*
+io.github.mariomatheus.*
+io.github.marionete-data.*
+io.github.marioparrilla.*
+io.github.maritims.*
+io.github.mariuscaa.*
+io.github.markixy.*
+io.github.markosski.*
+io.github.markrileybot.*
+io.github.markrmullan.*
+io.github.markyav.*
+io.github.markyav.drawbox.*
+io.github.marmer.testutils.*
+io.github.maroodb.*
+io.github.maropu.*
+io.github.marquezproject.*
+io.github.marsianer.*
+io.github.martbogdan.*
+io.github.martinffx.*
+io.github.martinheywang.*
+io.github.martinhh.*
+io.github.martinmcclintock.sample.*
+io.github.martinschneider.*
+io.github.martinszigas.*
+io.github.martinvisser.*
+io.github.martinwitt.*
+io.github.martydashp.*
+io.github.martydashp.java_codegen.*
+io.github.martylinzy.*
+io.github.maruko0411.*
+io.github.maruko0411.plugin.apkrename.*
+io.github.marvinspring.*
+io.github.marwa-eltayeb.*
+io.github.marwin1991.*
+io.github.masamonoke.rangelib.*
+io.github.maskvvv.*
+io.github.maso-os.*
+io.github.massimosiani.*
+io.github.massita99.*
+io.github.masterarbeit-2023.*
+io.github.masterfans.*
+io.github.matadorr.*
+io.github.matafokka.*
+io.github.mataku.*
+io.github.matchup-ir.*
+io.github.mateo767.*
+io.github.material-ui-swing.*
+io.github.materiiapps.*
+io.github.materiiapps.panels.*
+io.github.matf.*
+io.github.mathcoach.*
+io.github.matheus-corregiari.*
+io.github.mathiasmah.unik.*
+io.github.mathiassonderfeld.*
+io.github.mathieusoysal.*
+io.github.maticooads.*
+io.github.matrei.*
+io.github.matrixainetwork.*
+io.github.mattcarrier.metrics.transport.*
+io.github.matteobertozzi.*
+io.github.matteosilv.*
+io.github.matthewmarkose.*
+io.github.matthieun.*
+io.github.mattisonchao.*
+io.github.mattjp.*
+io.github.mattvass.*
+io.github.matwein.*
+io.github.matyrobbrt.*
+io.github.matzoliv.*
+io.github.maukaim.*
+io.github.mauriciojovel.*
+io.github.mauriciophysics.*
+io.github.mauriciophysics.graficos.*
+io.github.mausamyede.*
+io.github.maven-rep.*
+io.github.mavenreposs.*
+io.github.mavlianov.*
+io.github.maxar-corp.*
+io.github.maximgorbunov.*
+io.github.maxnz.*
+io.github.maxwainer.*
+io.github.maybe4u.*
+io.github.mayconcardoso.*
+io.github.mayohn.*
+io.github.mayuce.*
+io.github.mayzs.*
+io.github.mazixi.*
+io.github.mbannour.*
+io.github.mbenincasa.*
+io.github.mbigger.*
+io.github.mbql.*
+io.github.mcgizzle.*
+io.github.mcgrady-dev.*
+io.github.mcgrady911.*
+io.github.mcroteau.*
+io.github.mcsim4s.*
+io.github.mcwarman.*
+io.github.mcyustc.*
+io.github.md2conf.*
+io.github.mdanish98.keycloakmock.*
+io.github.mdaubie.*
+io.github.mdaubie.coloroffilm.*
+io.github.mdauthentic.*
+io.github.mddanishansari.*
+io.github.mderevyankoaqa.*
+io.github.meanvalue.*
+io.github.meanvalue.lanmapping.*
+io.github.mecanicaldragon.*
+io.github.medianik5.*
+io.github.mediastream.*
+io.github.meditator-wen.*
+io.github.medusar.*
+io.github.medyo.*
+io.github.meetsl.*
+io.github.megabobik.*
+io.github.megahoneybadger.*
+io.github.megolden.*
+io.github.mehmetozanguven.*
+io.github.meikaixin9009.*
+io.github.meinders.*
+io.github.meiskalt7.*
+io.github.meituan-dianping.*
+io.github.melangad.*
+io.github.melin.*
+io.github.melin.superior.*
+io.github.melin.superior.sql.formatter.*
+io.github.melonless.*
+io.github.melozzola.*
+io.github.memo33.*
+io.github.memoeslink.*
+io.github.memorydoc.*
+io.github.mengfly.*
+io.github.mengwang0211.*
+io.github.menostos.*
+io.github.mentegy.*
+io.github.meowkita.*
+io.github.mercurievv.minuscles.*
+io.github.merlinths.*
+io.github.merseyside.*
+io.github.mertceyhan.*
+io.github.mervehosol.*
+io.github.mervey0324.*
+io.github.metadew.*
+io.github.metarank.*
+io.github.metheax.*
+io.github.methrat0n.*
+io.github.metinilhan.*
+io.github.mezatsong.*
+io.github.mfisme.*
+io.github.mfoo.*
+io.github.mfulton26.ctrl4testng.*
+io.github.mfvanek.*
+io.github.mgraciano.plugins.*
+io.github.mgtvmobile.*
+io.github.mhagnumdw.*
+io.github.mhmmedinan.*
+io.github.mholzer85.wicket-fullcalendar.*
+io.github.mhqz.*
+io.github.miamtech.*
+io.github.mianalysis.*
+io.github.michaelliv.lucene4k.*
+io.github.michaelt293.*
+io.github.michaldo.*
+io.github.michaljonko.*
+io.github.michelin.*
+io.github.micheljung.*
+io.github.mickle-ak.mockobor.*
+io.github.micro164.*
+io.github.microcks.*
+io.github.microcks.quarkus.*
+io.github.microportal.*
+io.github.microservice-api-patterns.*
+io.github.microutils.*
+io.github.microvibe.*
+io.github.microvibe.dependencies.*
+io.github.mictaege.*
+io.github.micwan88.*
+io.github.middleware-labs.*
+io.github.middolsundear.stork.*
+io.github.mightguy.*
+io.github.mighty-tech.*
+io.github.miguelcarrasco.*
+io.github.migule-noob.*
+io.github.mihaijulien.*
+io.github.mihaildemidoff.*
+io.github.mihaita-tinta.*
+io.github.mihodihasan.chuck-no-op.*
+io.github.mihodihasan.chuck.*
+io.github.mikederban.selenium.webhelper.*
+io.github.mikeysasse.*
+io.github.mikhail-petrov.supertal-test.*
+io.github.mikheevshow.*
+io.github.mikla.*
+io.github.mikovali.android.*
+io.github.milis92.kotlin_markdown.*
+io.github.milkwangstudio.*
+io.github.millibyte1.*
+io.github.millij.*
+io.github.milobotdev.*
+io.github.milobotdev.discordoauth2api.*
+io.github.mimidesunya.*
+io.github.mimoguz.*
+io.github.min1854.*
+io.github.mind-boot.*
+io.github.mineflash07.*
+io.github.ming4762.*
+io.github.mingyang66.*
+io.github.mingyifei.*
+io.github.minhhoangvn.*
+io.github.mini-mo.*
+io.github.miniclem.*
+io.github.miniclip.*
+io.github.miniplaceholders.*
+io.github.ministryofjustice.bichard7.*
+io.github.minkainc.*
+io.github.minliuhua.*
+io.github.minorg.*
+io.github.mintinglabs.*
+io.github.minxiangnan.*
+io.github.minyushov.*
+io.github.minze25.*
+io.github.mioxs.*
+io.github.miracelwhipp.net.*
+io.github.miracelwhipp.net.common.*
+io.github.miracelwhipp.net.cs.compiler.nuget.*
+io.github.miracelwhipp.net.cs.plugin.*
+io.github.miracelwhipp.net.nuget.*
+io.github.miracelwhipp.net.nuget.plugin.*
+io.github.miracelwhipp.net.provider.*
+io.github.miracelwhipp.net.xunit.*
+io.github.miracelwhipp.net.xunit.runner.*
+io.github.miracelwhipp.resource.bunch.*
+io.github.miracelwhipp.resource.bunch.client.*
+io.github.miracelwhipp.resource.bunch.collector.*
+io.github.miracelwhipp.resource.bunch.common.*
+io.github.miracelwhipp.resource.bunch.plugin.*
+io.github.miracozkan.*
+io.github.mirko-felice.dronesecurity.*
+io.github.mirko-felice.testkit.*
+io.github.mirrormingzz.*
+io.github.mishakanai.*
+io.github.mishaoshuai.*
+io.github.missett.*
+io.github.missioncommand.*
+io.github.missu263.*
+io.github.misszgdzdx.*
+io.github.misterassm.*
+io.github.misterchangray.*
+io.github.misterfifi1.*
+io.github.mistletoe5215.*
+io.github.mitchelltech5.*
+io.github.mitre.*
+io.github.mivek.*
+io.github.mixpush.*
+io.github.mj-youn.*
+io.github.mjcro.*
+io.github.mjdivan.*
+io.github.mjfryc.*
+io.github.mjhaugsdal.*
+io.github.mjkim737.*
+io.github.mjourard.*
+io.github.mkfl3x.*
+io.github.mkhanal.*
+io.github.mkhytarmkhoian.*
+io.github.mkjung.*
+io.github.mkohm.*
+io.github.mkoncek.*
+io.github.mkotsur.*
+io.github.mkpaz.*
+io.github.mletkin.*
+io.github.mlniang.*
+io.github.mlytics.*
+io.github.mmalygin.*
+io.github.mmarco94.*
+io.github.mmbishop.*
+io.github.mmccuiston.*
+io.github.mmdai.*
+io.github.mmhelloworld.*
+io.github.mmihira.*
+io.github.mmobin789.pixel.*
+io.github.mmolosay.*
+io.github.mmstarry.*
+io.github.mngsk.*
+io.github.moacchain.*
+io.github.moacirrf.*
+io.github.mobile-development-group.*
+io.github.mobility-university.*
+io.github.mobon.*
+io.github.mocanjie.*
+io.github.mockitoplus.*
+io.github.mocreates.*
+io.github.model4s.*
+io.github.modelsvgu.*
+io.github.mods4j.*
+io.github.mofa3.*
+io.github.mofazhe.*
+io.github.mofei100.*
+io.github.mohabmohie.*
+io.github.mohakgupta53.*
+io.github.mohamadojail.*
+io.github.mohem-appium.*
+io.github.mohitkumar.*
+io.github.mohsen-mahmoudi.*
+io.github.mojtabaj.*
+io.github.moke926.*
+io.github.mokka88.*
+io.github.molamolaxxx.*
+io.github.molarmanful.*
+io.github.moleike.*
+io.github.molihuan.*
+io.github.moltenjson.*
+io.github.molumn.*
+io.github.molysulfur.*
+io.github.momo-wallet.*
+io.github.monamewind.*
+io.github.monero-ecosystem.*
+io.github.montanizstills.*
+io.github.montara-io.*
+io.github.montu376.*
+io.github.monull.*
+io.github.monun.*
+io.github.mooe1215.*
+io.github.mooney-code.*
+io.github.moonlightsuite.*
+io.github.moonsky-all.*
+io.github.moor-soft.*
+io.github.mopinion-com.*
+io.github.moraesdelima.*
+io.github.moreirasantos.*
+io.github.morganxf.*
+io.github.morgaroth.*
+io.github.morichan.*
+io.github.morningk.*
+io.github.morphy76.*
+io.github.morten-m-olsen.*
+io.github.mortezanedaei.*
+io.github.morux2.*
+io.github.morven11.*
+io.github.mosence.sba.*
+io.github.mosssi.*
+io.github.mostafamohajeri.*
+io.github.mosup16.*
+io.github.mottljan.*
+io.github.mouadj92.*
+io.github.moudjames23.*
+io.github.mountainest.*
+io.github.mouriya-emma.*
+io.github.mouseleftkey.plugin.*
+io.github.mouxie.*
+io.github.mouzt.*
+io.github.moyada.*
+io.github.moyifengxue.*
+io.github.mpontoc.*
+io.github.mportilho.*
+io.github.mqcodedev.*
+io.github.mqwerm98.*
+io.github.mqzn.*
+io.github.mr-tolmach.*
+io.github.mr0xf00.*
+io.github.mrdaios.*
+io.github.mrdear.*
+io.github.mrexplode.*
+io.github.mrherintsoahasina.*
+io.github.mridx.*
+io.github.mrjiangdong.*
+io.github.mrjino.*
+io.github.mrliuxuhui.*
+io.github.mrocigno.*
+io.github.mrpanupat.*
+io.github.mrsamudio.*
+io.github.mrsaraira.*
+io.github.mrschyzo.*
+io.github.mrshoenel.*
+io.github.mrslimediamond.*
+io.github.mrsnix.*
+io.github.mrspock182.*
+io.github.mrsweeter.*
+io.github.mrvanish97.kbnsext.*
+io.github.mryzhou.*
+io.github.ms100.*
+io.github.ms5984.libraries.*
+io.github.ms5984.retrox.*
+io.github.msaf9.*
+io.github.msalaslo.*
+io.github.msantarsiere.*
+io.github.mscaldas2012.*
+io.github.mscheong01.*
+io.github.mschonaker.*
+io.github.mschout.*
+io.github.msdk.*
+io.github.msg134.*
+io.github.msid256.*
+io.github.msidolphin.*
+io.github.msiegemund.*
+io.github.msilemsile.*
+io.github.mstachniuk.*
+io.github.msteinhoff.*
+io.github.msyysoft.*
+io.github.mtaylatte.*
+io.github.mthebaud.*
+io.github.mtj956052456.*
+io.github.mtjsoft.*
+io.github.mtrevisan.*
+io.github.muddz.*
+io.github.mudphilo.*
+io.github.muehmar.*
+io.github.muellerj2.*
+io.github.mufenge.*
+io.github.muhammadfarazahmed.*
+io.github.muhammadkarbalaee.*
+io.github.muhammednadeeretp.*
+io.github.muizmahdi.*
+io.github.mulesoft-consulting.*
+io.github.multicatch.*
+io.github.multimachinebuilder.*
+io.github.munan56.*
+io.github.mupsnc.*
+io.github.muqhc.*
+io.github.murdos.*
+io.github.murfffi.*
+io.github.murongshian.*
+io.github.murphp15.*
+io.github.murzagalin.*
+io.github.musk.semver.*
+io.github.mussaops.*
+io.github.muthuishere.*
+io.github.muthuraj57.*
+io.github.muto86.*
+io.github.mutsuhiro6.*
+io.github.muxiaobai.*
+io.github.muxiaolin.*
+io.github.mvamsichaitanya.*
+io.github.mvertl.*
+io.github.mvillafuertem.*
+io.github.mvn-hungtruong-dn.*
+io.github.mvpotter.*
+io.github.mvrozanti.*
+io.github.mweirauch.*
+io.github.mwlon.*
+io.github.mwrod453.*
+io.github.mwttg.*
+io.github.mxd888.*
+io.github.mxd888.socket.*
+io.github.mxudong.*
+io.github.my-digi-id.*
+io.github.my-workforce.*
+io.github.myasuka.*
+io.github.mybatisSpPlus.*
+io.github.mysticfall.*
+io.github.mysto.*
+io.github.mytianya.*
+io.github.myui.*
+io.github.myungpyo.*
+io.github.myusernamehsw.*
+io.github.myvideoyun.*
+io.github.mzanalyticst.*
+io.github.mzfkr97.*
+io.github.mzgreen.*
+io.github.n34t0.*
+io.github.n34t0.compose.*
+io.github.nabhosal.*
+io.github.nackily.*
+io.github.nadjannn.*
+io.github.nafg.*
+io.github.nafg.cloudlogging.*
+io.github.nafg.css-dsl.*
+io.github.nafg.dialogue-state.*
+io.github.nafg.grist.*
+io.github.nafg.jewish-date.*
+io.github.nafg.mergify.*
+io.github.nafg.millbundler.*
+io.github.nafg.scala-phonenumber.*
+io.github.nafg.scalac-options.*
+io.github.nafg.scalajs-facades.*
+io.github.nafg.scalajs-react-util.*
+io.github.nafg.scheduler.*
+io.github.nafg.simple-router.*
+io.github.nafg.simpleivr.*
+io.github.nafg.slick-migration-api.*
+io.github.nagavikram.*
+io.github.nageshks.kmnumbers.*
+io.github.nageshks.mad.*
+io.github.nageshks.materialsheet.*
+io.github.nageshks.roundedletterview.*
+io.github.nailik.*
+io.github.nainapetkar.*
+io.github.naivekook.zodiacview.*
+io.github.naivor.*
+io.github.nakuls426.*
+io.github.nalbion.*
+io.github.nalocal.*
+io.github.nambach.*
+io.github.nambers.*
+io.github.nameyuan.*
+io.github.namini40.*
+io.github.nanchenyang.*
+io.github.nangongkuo.*
+io.github.nanhu-lab.*
+io.github.nanquanyuhao.*
+io.github.narutobratishka.*
+io.github.nasmedia-tech.*
+io.github.nassimus26.*
+io.github.natanfudge.*
+io.github.nathanmeade.*
+io.github.nathanmeade.connectionerrorjoke.*
+io.github.natty-parser.*
+io.github.natural-intelligence.*
+io.github.naturalett.*
+io.github.naushadh.*
+io.github.nave-cohen.*
+io.github.naveen17797.*
+io.github.naveenthontepu.*
+io.github.naverz.*
+io.github.naverz.pinocchio.*
+io.github.navi-cloud.*
+io.github.navid1981.*
+io.github.navidjalali.*
+io.github.naviud.*
+io.github.nawaman.*
+io.github.nayanapetkar.*
+io.github.nayanapetkar123.*
+io.github.nayanapetkar49.*
+io.github.nazarovctrl.*
+io.github.nbaars.*
+io.github.nbase-io.*
+io.github.nbl77.*
+io.github.nblxa.*
+io.github.nbox1989.*
+io.github.ncasaux.*
+io.github.ncc0706.*
+io.github.ncipollo.tix.*
+io.github.ndsev.*
+io.github.ndviet.*
+io.github.nearbirds.*
+io.github.neas-neas.*
+io.github.neas-neas.alibuildcache.*
+io.github.needle4k.*
+io.github.nefilim.*
+io.github.nefilim.githubactions.*
+io.github.nefilim.gradle.*
+io.github.nefilim.gradle.github-actions-generator-plugin.*
+io.github.nefilim.gradle.semver-plugin.*
+io.github.nefilim.http4s.*
+io.github.nefilim.http4s.common.*
+io.github.nefilim.kjwt.*
+io.github.nefilim.mill.*
+io.github.neilwangweili.*
+io.github.nejckorasa.*
+io.github.nemesismate.*
+io.github.neo1125.*
+io.github.neo4s.*
+io.github.neodix42.*
+io.github.neofreko.*
+io.github.neojay0705.*
+io.github.neonSonOfXenon.JXmodem.*
+io.github.neondeep.*
+io.github.neonorbit.*
+io.github.neontty.*
+io.github.neotypes.*
+io.github.nestigogroup.*
+io.github.net-a-porter.*
+io.github.netcosports.compositeadapter.*
+io.github.nethibernate.*
+io.github.netmikey.logunit.*
+io.github.netmikey.testprocesses.*
+io.github.netvl.ecoji.*
+io.github.netvl.picopickle.*
+io.github.netwolf712.*
+io.github.neurodyne.*
+io.github.neutronstarer.*
+io.github.nevgeniev.zig.*
+io.github.new-mikha.*
+io.github.newagewriter.*
+io.github.newbeegpt.*
+io.github.newpanjing.*
+io.github.newrelickk.*
+io.github.newur.*
+io.github.newzhn.*
+io.github.nexipayments.*
+io.github.nextgis.*
+io.github.nextpaygroup.*
+io.github.neybertech.*
+io.github.ngbinh.*
+io.github.ngchinhow.*
+io.github.nghiandd84.*
+io.github.ngmatthew227.*
+io.github.ngoanh2n.*
+io.github.nguyenphuc22.*
+io.github.nhk-news-web-easy.*
+io.github.nhsconnect.*
+io.github.nianien.*
+io.github.nianna.*
+io.github.nibiruos.afip.*
+io.github.nibiruos.async.*
+io.github.nibiruos.mobile.*
+io.github.nibiruos.model.*
+io.github.nibiruos.oauth.*
+io.github.nibiruos.retrosoap.*
+io.github.nibiruos.ui.*
+io.github.nibnait.*
+io.github.nichetoolkit.*
+io.github.nickd3000.*
+io.github.nickgibbon.*
+io.github.nickid2018.*
+io.github.nickmacdon.*
+io.github.nickngn.*
+io.github.nickshoe.*
+io.github.nicolas-van.*
+io.github.nicolasstucki.*
+io.github.nicolkathe.*
+io.github.niemals-stop.*
+io.github.nier6088.*
+io.github.nifty10m.*
+io.github.night-crawler.*
+io.github.nightgoat.*
+io.github.nihirash.*
+io.github.nik9000.*
+io.github.nikartm.*
+io.github.nikolatx.*
+io.github.nikosrig.*
+io.github.nikunj-wissen.*
+io.github.nikunj1312.*
+io.github.nilinjie.*
+io.github.nillerr.*
+io.github.nilscoding.*
+io.github.nilshoffmann.*
+io.github.nilwurtz.*
+io.github.ningpp.*
+io.github.ningyuv.*
+io.github.ninjaenterprise.*
+io.github.ninobomba.*
+io.github.niqrs.*
+io.github.nirashasewwandi.*
+io.github.nirro01.*
+io.github.nishadchayanakhawa.*
+io.github.nishain-de-silva.*
+io.github.nishkarsh.*
+io.github.nitesh7.*
+io.github.nithyanandauniversity.content_server.*
+io.github.nitinb-v2solutions.*
+io.github.nitinpraksash9911.*
+io.github.nitish111.*
+io.github.nixiantongxue.*
+io.github.nixtabyte.telegram.*
+io.github.niyiomotoso.*
+io.github.njain51.test.*
+io.github.nkaaf.*
+io.github.nkbai.*
+io.github.nkxrb.*
+io.github.nlbuescher.*
+io.github.nlbwqmz.*
+io.github.nmaslukov.*
+io.github.nmodule.*
+io.github.nniikkoollaaii.*
+io.github.no-dumps.*
+io.github.no-such-company.*
+io.github.no-today.*
+io.github.noahshen.*
+io.github.nobodynext.*
+io.github.nobuglady.*
+io.github.nodens2k.*
+io.github.nomeyho.*
+io.github.nomisrev.*
+io.github.nomizodiac.*
+io.github.noncat-lang.*
+io.github.nondeepshit.*
+io.github.nonononoki.*
+io.github.noobdogcloud.*
+io.github.nooshhub.*
+io.github.nopol10.*
+io.github.nopol10.alpha-movie.*
+io.github.normandesjr.*
+io.github.nortthon.*
+io.github.notaphplover.*
+io.github.notifir.*
+io.github.nouvell.*
+io.github.nov-moon.*
+io.github.nov11.*
+io.github.nova-wallet.*
+io.github.novacrypto.*
+io.github.novakov-alexey.*
+io.github.novareseller.*
+io.github.novotnyradek.*
+io.github.nowshad-hasan.*
+io.github.npetkar48.*
+io.github.nqhuydev.*
+io.github.nremond.*
+io.github.nsacyber.hirs.*
+io.github.nsacyber.paccor.*
+io.github.nscuro.*
+io.github.nsforth.*
+io.github.nsingla.*
+io.github.nsk90.*
+io.github.nstdio.*
+io.github.nterry.*
+io.github.nuclominus.*
+io.github.numichi.*
+io.github.nunopalma.*
+io.github.nunumao.*
+io.github.nuonuoOkami.*
+io.github.nur858.*
+io.github.nurture-farm.*
+io.github.nurujjamanpollob.androidmailer.*
+io.github.nusphere.*
+io.github.nuzigor.*
+io.github.nvest-solutions.*
+io.github.nvivanov.*
+io.github.nwokafor-choongsaeng.*
+io.github.nyk93.*
+io.github.nylon009.*
+io.github.nylon009.reinject-plugin.*
+io.github.nymroad.*
+io.github.o1i0.*
+io.github.oak.*
+io.github.obaid-rehman.*
+io.github.obimp.*
+io.github.objektif.*
+io.github.obscure1910.*
+io.github.ocean9914.*
+io.github.odalabasmaz.awsgenie.*
+io.github.odepax.*
+io.github.odidere.*
+io.github.odys-z.*
+io.github.oemergenc.*
+io.github.oewntk.*
+io.github.offeristasdk.*
+io.github.officiallysingh.*
+io.github.offlinebrain.*
+io.github.offvanhooijdonk.*
+io.github.og-abdul-mateen.*
+io.github.oguzkeremyildiz.*
+io.github.ohltao.*
+io.github.ohmry.*
+io.github.ohoussein.*
+io.github.ohuo133233.*
+io.github.oit-org.*
+io.github.oitstack.*
+io.github.ojauch.*
+io.github.okex.*
+io.github.okohub.*
+io.github.oktayalizada.*
+io.github.okvee.*
+io.github.olajhidey.*
+io.github.olamy.maven.skins.*
+io.github.olamy.ua-parser.*
+io.github.olasubomi4.*
+io.github.oldmanpushcart.jpromisor.*
+io.github.olegmozhei.lablibrary.*
+io.github.olegych.*
+io.github.oleksandrbalan.*
+io.github.oleksandrpodoliako.*
+io.github.oleksiihorbenko.*
+io.github.oleksivio.*
+io.github.oleksivio.tl.kbot.*
+io.github.olib963.*
+io.github.oliverliy.*
+io.github.oliviercailloux.*
+io.github.oliviercailloux.jmcda.*
+io.github.oliviercailloux.y2018.*
+io.github.olivierlemasle.maven.*
+io.github.ollls.*
+io.github.ololx.*
+io.github.ololx.cranberry.*
+io.github.ololx.moonshine.*
+io.github.olugbokikisemiu.*
+io.github.olxmute.*
+io.github.omaraloraini.*
+io.github.omarben1.*
+io.github.omarchenko4j.*
+io.github.omoby.*
+io.github.omzz15.*
+io.github.onecx.*
+io.github.onecx.quarkus.*
+io.github.oneincase.*
+io.github.onemancrew.*
+io.github.oneorder-tech.*
+io.github.ones1kk.*
+io.github.oneteme.*
+io.github.oneteme.assertapi.*
+io.github.oneteme.traceapi.*
+io.github.oneuiproject.*
+io.github.oneuiproject.sesl.*
+io.github.onlyeat3.*
+io.github.onqlave-cesc.*
+io.github.onqlavelabs.*
+io.github.onreg.*
+io.github.ooknight.*
+io.github.ooknight.ui.*
+io.github.ooyyaa656.*
+io.github.opardor.*
+io.github.opcoral.*
+io.github.open-accelerators.*
+io.github.open-coap.*
+io.github.open-creation.*
+io.github.open-developer.*
+io.github.open-source-release-demo.*
+io.github.open-src-code.*
+io.github.open-util.*
+io.github.openJames.*
+io.github.openai4s.*
+io.github.openapi-sdks.*
+io.github.openconnectors.*
+io.github.opendataio.*
+io.github.opendglab.*
+io.github.openfeign.*
+io.github.openfeign.cdi.*
+io.github.openfeign.experimental.*
+io.github.openfeign.form.*
+io.github.openfeign.opentracing.*
+io.github.openfrog.*
+io.github.openguava.*
+io.github.openleveragedev.*
+io.github.openlg.*
+io.github.openmaqs.*
+io.github.openmaqs.accessibility.*
+io.github.openmaqs.appium.*
+io.github.openmaqs.base.*
+io.github.openmaqs.cucumber.*
+io.github.openmaqs.database.*
+io.github.openmaqs.playwright.*
+io.github.openmaqs.selenium.*
+io.github.openmaqs.utilities.*
+io.github.openmaqs.webservices.*
+io.github.opensabre.*
+io.github.opensanca.*
+io.github.openunirest.*
+io.github.openvega.*
+io.github.openwebnet4j.*
+io.github.openzonedy.*
+io.github.optimumcode.*
+io.github.orange-3.*
+io.github.orange1438.*
+io.github.oranshuster.*
+io.github.orbsynated.*
+io.github.orczykowski.*
+io.github.ordinarykai.*
+io.github.orgyflame.*
+io.github.oriedita.*
+io.github.orienteering-oss.*
+io.github.origami1203.*
+io.github.origin-energy.*
+io.github.orionlibs.*
+io.github.orixent.*
+io.github.orkunkocyigit.*
+io.github.orpolyzos.*
+io.github.osakila.*
+io.github.osamabmaq.*
+io.github.osbeorn.*
+io.github.oscarduartt.*
+io.github.oshai.*
+io.github.osinn.*
+io.github.osipxd.*
+io.github.oskin1.*
+io.github.oskworker.*
+io.github.osobolev.*
+io.github.osobolev.app-delivery.*
+io.github.osobolev.sqlg3.*
+io.github.oss-slu.*
+io.github.ossnass.*
+io.github.osvalda.*
+io.github.osvaldjr.*
+io.github.otaka.*
+io.github.otang45.*
+io.github.otavia-projects.*
+io.github.otpless-tech.*
+io.github.ouchangxin.*
+io.github.ouest-france.*
+io.github.oujibakei.*
+io.github.oun.*
+io.github.out2null.*
+io.github.outscale.*
+io.github.outwatch.*
+io.github.ouyang1596.*
+io.github.over-run.*
+io.github.overpas.*
+io.github.overstart.*
+io.github.ovidiusimionica.*
+io.github.owen-q.*
+io.github.owenbharrison.*
+io.github.oxayotl.*
+io.github.oyama-oyama.*
+io.github.oybek.*
+io.github.oyeprashar.*
+io.github.ozankyncu.*
+io.github.ozyl.*
+io.github.ozzyozbourne.*
+io.github.p-org.*
+io.github.p-org.solvers.*
+io.github.pablichjenkov.*
+io.github.pablobastidasv.*
+io.github.pablodxcode.*
+io.github.pablof036.fileops.*
+io.github.pablof036.tellosdk.*
+io.github.pablotecheraa.*
+io.github.pabloubal.*
+io.github.pacdaemon.*
+io.github.pactstart.*
+io.github.padaiyal.*
+io.github.padaiyal.libs.*
+io.github.padreati.*
+io.github.pagalaxylab.*
+io.github.paichinger.*
+io.github.pak3nuh.util.*
+io.github.pak3nuh.util.lang.compiler.*
+io.github.pak3nuh.util.lang.compiler.delegates.*
+io.github.pak3nuh.util.lang.compiler.enum-expression.*
+io.github.pak3nuh.util.lang.compiler.sealed.*
+io.github.pakistancan.*
+io.github.pakorner.*
+io.github.paladitya.*
+io.github.palanga.*
+io.github.palex65.*
+io.github.palexdev.*
+io.github.palexdev.playwright.*
+io.github.pan3793.*
+io.github.pandulapeter.beagle.*
+io.github.panghy.lionrock.*
+io.github.pangju666.*
+io.github.pangzixiang.whatsit.*
+io.github.pangzixiang.whatsit.vertx.*
+io.github.pankajmaurya.*
+io.github.panlicun.*
+io.github.panpf.activitymonitor.*
+io.github.panpf.androidsheller.*
+io.github.panpf.assemblyadapter.*
+io.github.panpf.assemblyadapter4.*
+io.github.panpf.jsonx.*
+io.github.panpf.liveevent.*
+io.github.panpf.maven-publish.*
+io.github.panpf.pagerindicator.*
+io.github.panpf.sketch.*
+io.github.panpf.sketch3.*
+io.github.panpf.spiderwebscoreview.*
+io.github.panpf.stickyitemdecoration.*
+io.github.panpf.stickyrecycleritemdecoration.*
+io.github.panpf.tools4a.*
+io.github.panpf.tools4j.*
+io.github.panpf.tools4k.*
+io.github.panpf.viewexpander.*
+io.github.panpf.zoomimage.*
+io.github.pantheooon.*
+io.github.panxiaochao.*
+io.github.panyiyiyi.*
+io.github.pao11.*
+io.github.paohaijiao.*
+io.github.paoloboni.*
+io.github.paopaosecret.*
+io.github.par-government.*
+io.github.paradisehell.middleware.logger.*
+io.github.paranara.*
+io.github.parcelx.*
+io.github.pardeepmg.*
+io.github.parentpom.*
+io.github.pareshdb67.*
+io.github.pareshvpatil.*
+io.github.parj.*
+io.github.parsingk.*
+io.github.parsix.*
+io.github.parthappm.*
+io.github.parubok.*
+io.github.parzival3.*
+io.github.parzivalexe.*
+io.github.pascals-ager.*
+io.github.pashashiz.*
+io.github.pasteleiros.*
+io.github.patarapolw.*
+io.github.patceev.*
+io.github.pathus90.*
+io.github.patrick-choe.*
+io.github.patrickdoc.*
+io.github.patrickxu1986.*
+io.github.patrykrudnicki.*
+io.github.patxibocos.*
+io.github.paul-hernandez99.*
+io.github.paulingzhou.*
+io.github.paulklauser.*
+io.github.paullo612.mlfx.*
+io.github.paullo612.mlfx.api.*
+io.github.paullo612.mlfx.compiler.*
+io.github.paulushcgcj.*
+io.github.paulusxu.*
+io.github.pavan2you.*
+io.github.pavansharma36.*
+io.github.pavel-corsaghin.*
+io.github.pavelicii.*
+io.github.pavleprica.*
+io.github.pavlozorya.*
+io.github.pawansharmawissen.*
+io.github.pawansk214.*
+io.github.paweljaworski.*
+io.github.paxel.*
+io.github.pchain-org.*
+io.github.pckhoi.keycloak.*
+io.github.pcmind.*
+io.github.pcrnkovic.*
+io.github.pdjohe.*
+io.github.pdkst.*
+io.github.pdmuinck.*
+io.github.pduy99.*
+io.github.pdvrieze.matrixlib.*
+io.github.pdvrieze.xmlutil.*
+io.github.peacock05.*
+io.github.peak-c.*
+io.github.peakerbee.*
+io.github.peakmain.*
+io.github.pearstack.*
+io.github.pedegie.*
+io.github.pedro-bachiega.*
+io.github.pedrolobo98.*
+io.github.pelenthium.*
+io.github.pelletier197.*
+io.github.pellse.*
+io.github.pelmenstar1.*
+io.github.pendula95.*
+io.github.peng49.*
+io.github.pengfeicheng.*
+io.github.penggle.*
+io.github.penghaojie.*
+io.github.pengjunke1996.*
+io.github.pengpan.*
+io.github.pengw0048.*
+io.github.pengxurui.*
+io.github.penkee.*
+io.github.penn-live.*
+io.github.peopletech-sdk.*
+io.github.pepperkit.*
+io.github.peralhuang.*
+io.github.percontmx.cfdi.*
+io.github.pereduromega.*
+io.github.pereduromega.npm.plugin.*
+io.github.perf-tool.*
+io.github.periskop-dev.*
+io.github.perplexhub.*
+io.github.perry-fan.*
+io.github.petertrr.*
+io.github.petesta.*
+io.github.petitcl.*
+io.github.petretiandrea.*
+io.github.petrostick.*
+io.github.pettywing.*
+io.github.pftx.*
+io.github.pg-liudong.*
+io.github.pgalbraith.*
+io.github.pgwiazdowskispyro.*
+io.github.phantom0103.*
+io.github.phantomstr.testing-tools.*
+io.github.phantran.*
+io.github.phaserep.*
+io.github.pheerathach.*
+io.github.philkes.*
+io.github.phillima.*
+io.github.phillipuniverse.*
+io.github.phonydata.*
+io.github.photoncoder.*
+io.github.phymbert.*
+io.github.pianpu.*
+io.github.pickey-tech.*
+io.github.picnicml.*
+io.github.pierre-development.*
+io.github.pierresj.*
+io.github.pietrek777.*
+io.github.piitw.*
+io.github.pilgr.*
+io.github.pillisan42.*
+io.github.pilougit.security.*
+io.github.pinkolik.*
+io.github.pinorobotics.*
+io.github.pintowar.*
+io.github.pinyin-search.*
+io.github.piotrkav.*
+io.github.piratenetwork.*
+io.github.pirocks.*
+io.github.piruin.*
+io.github.pismute.*
+io.github.piszmog.*
+io.github.pitagoras3.*
+io.github.piterrus0102.*
+io.github.pityka.*
+io.github.pitzzahh.*
+io.github.pixee.*
+io.github.pixee.maven.*
+io.github.pixelbin-dev.*
+io.github.pixerena.*
+io.github.pizhicheng.*
+io.github.pizihao.*
+io.github.pjazdzyk.*
+io.github.pknujsp.*
+io.github.plastic-metal.*
+io.github.platinprotocol.*
+io.github.play-swagger.*
+io.github.playsafe.*
+io.github.playtech-ezpush.*
+io.github.plecesne.*
+io.github.plemont.*
+io.github.pleuvoir.*
+io.github.plipp.*
+io.github.plmmilove.*
+io.github.pluginloader.*
+io.github.pluginloader.gradle.*
+io.github.plz-no-anr.*
+io.github.pm-dungeon.*
+io.github.pmamico.*
+io.github.pmckeown.*
+io.github.pme123.*
+io.github.pmeheut.*
+io.github.pnoker.*
+io.github.pnzeml.*
+io.github.poa1024.*
+io.github.podigua.*
+io.github.podile.*
+io.github.pojul.*
+io.github.poklakni.paddle.*
+io.github.polobustillo.*
+io.github.polymorphicpanther.*
+io.github.polysantiago.*
+io.github.pony1991.*
+io.github.poo0054.*
+io.github.popularlzp.*
+io.github.portaldalaran.*
+io.github.portlek.*
+io.github.portlek.smol-plugin-gradle.*
+io.github.portree-kid.*
+io.github.porum.*
+io.github.poshjosh.*
+io.github.poulpogaz.*
+io.github.povder.unipool.*
+io.github.powerbotkit.*
+io.github.ppalazon.*
+io.github.ppav.*
+io.github.ppav.analytics.*
+io.github.ppav.analyticshub.*
+io.github.ppdzm.*
+io.github.ppio-make.*
+io.github.ppissias.*
+io.github.pquiring.*
+io.github.pr0methean.betterrandom.*
+io.github.prakashiit.*
+io.github.prakharr.*
+io.github.pramod-khalkar.*
+io.github.prashant-ramcharan.*
+io.github.prashant564.*
+io.github.prashantrajput1612.*
+io.github.prashants0.*
+io.github.prateek1105.*
+io.github.prathameshmm02.themeEngine.*
+io.github.pravsonawane.*
+io.github.prbrios.*
+io.github.preafixed.*
+io.github.prettyclown.*
+io.github.primelib.*
+io.github.primelib.primecodegenlib.java.*
+io.github.primepotato.*
+io.github.privatik.*
+io.github.privettoli.*
+io.github.priyanandrai.firstMavenUpload.*
+io.github.priyanhsu10.*
+io.github.productboardlabs.*
+io.github.professionalaf.*
+io.github.project-openubl.*
+io.github.project-snail.*
+io.github.projectclean.*
+io.github.projecturutau.*
+io.github.prolobjectlink.*
+io.github.prom3th3us.*
+io.github.pronchakov.*
+io.github.propactive.*
+io.github.proto4j.*
+io.github.protobuf-x.*
+io.github.protocol-laboratory.*
+io.github.proubatsis.*
+io.github.provaauto.*
+io.github.przybandrzej.*
+io.github.pseudomuto.*
+io.github.psmorandi.*
+io.github.psyanite.*
+io.github.ptc-alm.*
+io.github.pturczyk.*
+io.github.pubcodetools.*
+io.github.pubiqq.*
+io.github.pudo58.*
+io.github.pulledtim.*
+io.github.pulquero.halyard.*
+io.github.pulquero.lubm.*
+io.github.pulquero.tinkerpopstar.*
+io.github.pulsar-eco.*
+io.github.punchplatform.*
+io.github.pure-bits.*
+io.github.pureaway.*
+io.github.pushpalroy.*
+io.github.pustike.*
+io.github.putao520.*
+io.github.pwszpl.*
+io.github.pwszpl.maven.*
+io.github.pxzxj.*
+io.github.pzstorm.*
+io.github.q1sj.*
+io.github.q3769.*
+io.github.q3769.qlib.*
+io.github.q707172686.*
+io.github.q7w8e9123456.*
+io.github.q843705423.*
+io.github.qamarelsafadi.*
+io.github.qaralotte.*
+io.github.qaz4042.*
+io.github.qbast.*
+io.github.qbosst.*
+io.github.qcjwq.craftsman.logstash.logback.*
+io.github.qdsfdhvh.*
+io.github.qianlixy.*
+io.github.qianxingchuan.framework.*
+io.github.qihuan92.activitystarter.*
+io.github.qingbaomeng.*
+io.github.qingguox.*
+io.github.qinglengdeweifeng.*
+io.github.qingmo.*
+io.github.qingwei91.*
+io.github.qinweiforandroid.*
+io.github.qiunet.*
+io.github.qiwang97.*
+io.github.qkcoder.*
+io.github.qq877693928.*
+io.github.qqlizhn.*
+io.github.qqnp1100.*
+io.github.qsy7.*
+io.github.qsy7.java.*
+io.github.qsy7.java.aspects.*
+io.github.qsy7.java.aspects.delay.*
+io.github.qsy7.java.aspects.heartbeat.*
+io.github.qsy7.java.aspects.logging.*
+io.github.qsy7.java.aspects.timeout.*
+io.github.qsy7.java.aspects.transform.*
+io.github.qsy7.java.aspects.transform.modules.*
+io.github.qsy7.java.browser.plugins.crawler.*
+io.github.qsy7.java.browser.plugins.pnc.modules.*
+io.github.qsy7.java.browser.plugins.prudential.modules.*
+io.github.qsy7.java.browser.plugins.vanguard.modules.*
+io.github.qsy7.java.browser.plugins.voya.modules.*
+io.github.qsy7.java.configuration.*
+io.github.qsy7.java.configuration.cli.*
+io.github.qsy7.java.dependencies.*
+io.github.qsy7.java.examples.*
+io.github.qsy7.java.examples.SPI.*
+io.github.qsy7.java.infrastructure.*
+io.github.qsy7.java.infrastructure.datastore.*
+io.github.qsy7.java.infrastructure.datastore.api.*
+io.github.qsy7.java.infrastructure.datastore.modules.*
+io.github.qsy7.java.infrastructure.datastore.modules.jdbc-run.*
+io.github.qsy7.java.infrastructure.datastore.modules.jdbc-run.modules.*
+io.github.qsy7.java.infrastructure.datastore.modules.jdbc-run.modules.cli.*
+io.github.qsy7.java.infrastructure.datastore.modules.jdbc-run.modules.cli.providers.*
+io.github.qsy7.java.infrastructure.datastore.modules.jdbc-run.providers.*
+io.github.qsy7.java.infrastructure.datastore.providers.*
+io.github.qsy7.java.infrastructure.datastore.providers.jdo.*
+io.github.qsy7.java.infrastructure.datastore.providers.jdo.providers.*
+io.github.qsy7.java.infrastructure.datastore.providers.jpa.*
+io.github.qsy7.java.infrastructure.datastore.providers.jpa.modules.*
+io.github.qsy7.java.infrastructure.datastore.providers.jpa.providers.*
+io.github.qsy7.java.infrastructure.inject.*
+io.github.qsy7.java.infrastructure.inject.modules.*
+io.github.qsy7.java.infrastructure.inject.modules.cli.*
+io.github.qsy7.java.infrastructure.inject.modules.cli.providers.*
+io.github.qsy7.java.infrastructure.inject.modules.web.*
+io.github.qsy7.java.infrastructure.inject.modules.web.providers.*
+io.github.qsy7.java.infrastructure.inject.modules.web.providers.guice.*
+io.github.qsy7.java.infrastructure.inject.modules.web.providers.guice.modules.*
+io.github.qsy7.java.infrastructure.inject.modules.web.providers.jetty.*
+io.github.qsy7.java.infrastructure.inject.modules.web.providers.jetty.modules.*
+io.github.qsy7.java.infrastructure.inject.providers.*
+io.github.qsy7.java.infrastructure.metrics.*
+io.github.qsy7.java.infrastructure.metrics.modules.*
+io.github.qsy7.java.infrastructure.metrics.modules.elastic.*
+io.github.qsy7.java.infrastructure.metrics.modules.elastic.providers.*
+io.github.qsy7.java.infrastructure.metrics.modules.netflix-atlas.*
+io.github.qsy7.java.infrastructure.metrics.modules.netflix-atlas.providers.*
+io.github.qsy7.java.infrastructure.metrics.modules.prometheus.*
+io.github.qsy7.java.infrastructure.metrics.modules.prometheus.providers.*
+io.github.qsy7.java.infrastructure.property.*
+io.github.qsy7.java.infrastructure.property.modules.*
+io.github.qsy7.java.modules.*
+io.github.qsy7.java.modules.amazon.*
+io.github.qsy7.java.modules.amazon.modules.*
+io.github.qsy7.java.modules.authorization.*
+io.github.qsy7.java.modules.authorization.api.*
+io.github.qsy7.java.modules.browser.*
+io.github.qsy7.java.modules.browser.api.*
+io.github.qsy7.java.modules.browser.drivers.*
+io.github.qsy7.java.modules.browser.modules.*
+io.github.qsy7.java.modules.browser.modules.jbrowserdriver.*
+io.github.qsy7.java.modules.browser.modules.jbrowserdriver.providers.*
+io.github.qsy7.java.modules.browser.modules.web.*
+io.github.qsy7.java.modules.browser.modules.web.financial.*
+io.github.qsy7.java.modules.browser.modules.web.financial.impl.*
+io.github.qsy7.java.modules.browser.plugins.*
+io.github.qsy7.java.modules.browser.plugins.discover.*
+io.github.qsy7.java.modules.browser.plugins.discover.modules.*
+io.github.qsy7.java.modules.browser.plugins.discover.providers.*
+io.github.qsy7.java.modules.browser.plugins.pnc.*
+io.github.qsy7.java.modules.browser.plugins.pnc.providers.*
+io.github.qsy7.java.modules.browser.plugins.prudential.*
+io.github.qsy7.java.modules.browser.plugins.prudential.providers.*
+io.github.qsy7.java.modules.browser.plugins.vanguard.*
+io.github.qsy7.java.modules.browser.plugins.vanguard.providers.*
+io.github.qsy7.java.modules.browser.plugins.voya.*
+io.github.qsy7.java.modules.calendar.*
+io.github.qsy7.java.modules.calendar.api.*
+io.github.qsy7.java.modules.calendar.modules.*
+io.github.qsy7.java.modules.compression.*
+io.github.qsy7.java.modules.compression.api.*
+io.github.qsy7.java.modules.compression.modules.*
+io.github.qsy7.java.modules.compression.modules.xz.*
+io.github.qsy7.java.modules.compression.modules.xz.providers.*
+io.github.qsy7.java.modules.contact.*
+io.github.qsy7.java.modules.contact.api.*
+io.github.qsy7.java.modules.contact.modules.*
+io.github.qsy7.java.modules.csv.*
+io.github.qsy7.java.modules.csv.modules.*
+io.github.qsy7.java.modules.csv.modules.apache-commons-csv.*
+io.github.qsy7.java.modules.csv.modules.apache-commons-csv.providers.*
+io.github.qsy7.java.modules.csv.modules.apache-poi.*
+io.github.qsy7.java.modules.csv.modules.univocity-csv.*
+io.github.qsy7.java.modules.csv.plugins.*
+io.github.qsy7.java.modules.csv.plugins.index.*
+io.github.qsy7.java.modules.download.*
+io.github.qsy7.java.modules.download.api.*
+io.github.qsy7.java.modules.download.providers.*
+io.github.qsy7.java.modules.download.providers.commons-io.*
+io.github.qsy7.java.modules.download.providers.commons-io.providers.*
+io.github.qsy7.java.modules.email.*
+io.github.qsy7.java.modules.email.api.*
+io.github.qsy7.java.modules.email.modules.*
+io.github.qsy7.java.modules.email.modules.exchange.*
+io.github.qsy7.java.modules.email.modules.exchange.providers.*
+io.github.qsy7.java.modules.email.modules.javamail.*
+io.github.qsy7.java.modules.email.modules.javamail.providers.*
+io.github.qsy7.java.modules.email.modules.organization.*
+io.github.qsy7.java.modules.email.modules.organization.modules.*
+io.github.qsy7.java.modules.email.modules.organization.modules.cli.*
+io.github.qsy7.java.modules.email.modules.organization.modules.cli.providers.*
+io.github.qsy7.java.modules.email.modules.organization.plugins.*
+io.github.qsy7.java.modules.email.modules.organzation.*
+io.github.qsy7.java.modules.email.modules.organzation.providers.*
+io.github.qsy7.java.modules.email.modules.template.*
+io.github.qsy7.java.modules.email.providers.*
+io.github.qsy7.java.modules.email.providers.javamail.*
+io.github.qsy7.java.modules.email.providers.javamail.modules.*
+io.github.qsy7.java.modules.encryption.*
+io.github.qsy7.java.modules.encryption.modules.*
+io.github.qsy7.java.modules.encryption.modules.cli.*
+io.github.qsy7.java.modules.encryption.modules.cli.providers.*
+io.github.qsy7.java.modules.encryption.providers.*
+io.github.qsy7.java.modules.feed.*
+io.github.qsy7.java.modules.feed.api.*
+io.github.qsy7.java.modules.file.*
+io.github.qsy7.java.modules.file.api.*
+io.github.qsy7.java.modules.file.modules.*
+io.github.qsy7.java.modules.file.modules.tar-directory-copier.*
+io.github.qsy7.java.modules.file.modules.tar-directory-copier.providers.*
+io.github.qsy7.java.modules.file.providers.*
+io.github.qsy7.java.modules.file.providers.local.*
+io.github.qsy7.java.modules.file.providers.local.providers.*
+io.github.qsy7.java.modules.financial.*
+io.github.qsy7.java.modules.financial.api.*
+io.github.qsy7.java.modules.identity.*
+io.github.qsy7.java.modules.identity.api.*
+io.github.qsy7.java.modules.identity.modules.*
+io.github.qsy7.java.modules.index.*
+io.github.qsy7.java.modules.index.modules.*
+io.github.qsy7.java.modules.index.modules.datastore.*
+io.github.qsy7.java.modules.index.modules.datastore.providers.*
+io.github.qsy7.java.modules.index.providers.*
+io.github.qsy7.java.modules.index.providers.elasticsearch.*
+io.github.qsy7.java.modules.index.providers.elasticsearch.providers.*
+io.github.qsy7.java.modules.ip.*
+io.github.qsy7.java.modules.ip.api.*
+io.github.qsy7.java.modules.linux-builder.*
+io.github.qsy7.java.modules.linux-builder.api.*
+io.github.qsy7.java.modules.linux-builder.modules.*
+io.github.qsy7.java.modules.linux-builder.modules.cli.*
+io.github.qsy7.java.modules.linux-builder.modules.cli.providers.*
+io.github.qsy7.java.modules.notification.*
+io.github.qsy7.java.modules.notification.providers.*
+io.github.qsy7.java.modules.person.*
+io.github.qsy7.java.modules.person.api.*
+io.github.qsy7.java.modules.pipe.*
+io.github.qsy7.java.modules.pipe.modules.*
+io.github.qsy7.java.modules.planning.*
+io.github.qsy7.java.modules.planning.api.*
+io.github.qsy7.java.modules.planning.modules.*
+io.github.qsy7.java.modules.print.*
+io.github.qsy7.java.modules.print.api.*
+io.github.qsy7.java.modules.print.providers.*
+io.github.qsy7.java.modules.queue.*
+io.github.qsy7.java.modules.queue.api.*
+io.github.qsy7.java.modules.queue.modules.*
+io.github.qsy7.java.modules.queue.modules.event.*
+io.github.qsy7.java.modules.queue.modules.external.*
+io.github.qsy7.java.modules.queue.modules.external.providers.*
+io.github.qsy7.java.modules.queue.providers.*
+io.github.qsy7.java.modules.queue.providers.datastore.*
+io.github.qsy7.java.modules.queue.providers.datastore.providers.*
+io.github.qsy7.java.modules.remote.*
+io.github.qsy7.java.modules.remote.api.*
+io.github.qsy7.java.modules.remote.impl.*
+io.github.qsy7.java.modules.remote.impl.plugins.*
+io.github.qsy7.java.modules.remote.modules.*
+io.github.qsy7.java.modules.scm.*
+io.github.qsy7.java.modules.scm.api.*
+io.github.qsy7.java.modules.scm.providers.*
+io.github.qsy7.java.modules.scm.providers.git-cli.*
+io.github.qsy7.java.modules.scm.providers.git-cli.providers.*
+io.github.qsy7.java.modules.serialization.*
+io.github.qsy7.java.modules.serialization.api.*
+io.github.qsy7.java.modules.serialization.modules.*
+io.github.qsy7.java.modules.serialization.modules.jackson-databind.*
+io.github.qsy7.java.modules.serialization.modules.jackson-databind.providers.*
+io.github.qsy7.java.modules.serialization.modules.snakeyaml.*
+io.github.qsy7.java.modules.serialization.modules.snakeyaml.providers.*
+io.github.qsy7.java.modules.serialization.providers.*
+io.github.qsy7.java.modules.shell.*
+io.github.qsy7.java.modules.shell.api.*
+io.github.qsy7.java.modules.shell.providers.*
+io.github.qsy7.java.modules.ssh.*
+io.github.qsy7.java.modules.ssh.api.*
+io.github.qsy7.java.modules.ssh.providers.*
+io.github.qsy7.java.modules.template.*
+io.github.qsy7.java.modules.template.api.*
+io.github.qsy7.java.modules.template.providers.*
+io.github.qsy7.java.modules.web-service.*
+io.github.qsy7.java.modules.workflow.*
+io.github.qsy7.java.modules.workflow.api.*
+io.github.qsy7.java.modules.workflow.examples.*
+io.github.qtkun.*
+io.github.quafadas.*
+io.github.quaide.*
+io.github.qualersoft.robotframework.*
+io.github.qualtagh.swing.table.*
+io.github.quanquan1996.*
+io.github.quantimb-lab.*
+io.github.qudtlib.*
+io.github.quellatalo.*
+io.github.quellatalo.fx.*
+io.github.queukat.*
+io.github.quickmsg.*
+io.github.quickprotocol.*
+io.github.quillraven.fleks.*
+io.github.quitsmile.*
+io.github.qurben.*
+io.github.quyetmvhust.*
+io.github.qwbarch.*
+io.github.qwefgh90.*
+io.github.qxcnwu.*
+io.github.qxtx244.build.*
+io.github.qxtx244.gradle.*
+io.github.qxtx244.http.*
+io.github.qxtx244.recyclerview.*
+io.github.qy-tech.*
+io.github.qy8502.*
+io.github.qycr.*
+io.github.qyg2297248353.*
+io.github.qyvlik.*
+io.github.qzbaozi.*
+io.github.r0bb3n.*
+io.github.raamcosta.compose-destinations.*
+io.github.rabbitcontrol.*
+io.github.rabobank.*
+io.github.racka98.*
+io.github.radRares1.*
+io.github.radamus.*
+io.github.radium0028.*
+io.github.radkovo.*
+io.github.rafaelsramos.*
+io.github.rafafrdz.*
+io.github.rafal-laskowski.*
+io.github.rafhael-s-p.*
+io.github.rafsanjani.*
+io.github.raggedycoder.android.*
+io.github.raggedycoder.preference.*
+io.github.raghav-chandra.*
+io.github.raghavsatyadev.*
+io.github.ragin-lundf.*
+io.github.rahulbsw.*
+io.github.rahulrajsonu.*
+io.github.rahulsinghai.*
+io.github.rain9155.*
+io.github.raindev.*
+io.github.raineye.*
+io.github.raineye.archetypes.*
+io.github.raisalam.*
+io.github.raiseyang.*
+io.github.raissi.*
+io.github.raistlintao.*
+io.github.rajesh2015.*
+io.github.rajeshguptan.*
+io.github.rajjobwork.*
+io.github.rajparsaniya.*
+io.github.rakeshchander.*
+io.github.rakuten-advertising-developers.*
+io.github.rakutentech.inappmessaging.*
+io.github.rakutentech.manifestconfig.*
+io.github.rakutentech.miniapp.*
+io.github.rakutentech.rekotlin.*
+io.github.rakutentech.sdkutils.*
+io.github.ralfkonrad.quantlib_for_maven.*
+io.github.ralphhuang.*
+io.github.ramblerchris.*
+io.github.ramerf.*
+io.github.ramidzkh.*
+io.github.ramimanaf.*
+io.github.ranSprd.*
+io.github.ranchordo.*
+io.github.randomito.*
+io.github.randy-blancett.*
+io.github.randydpoe45.*
+io.github.randyridgley.*
+io.github.randyridgley.cdk.datalake.constructs.*
+io.github.ranga543.*
+io.github.raniagus.*
+io.github.ranlee1.*
+io.github.raonigabriel.*
+io.github.rapha149.signgui.*
+io.github.raphael28.*
+io.github.raphasil.rest-client-generator.*
+io.github.raphiz.*
+io.github.rapid-queue.*
+io.github.raptros.*
+io.github.rascaler.*
+io.github.raulgf92.*
+io.github.raven-source.*
+io.github.ravichaturvedi.*
+io.github.ravichaturvedi.exceptionhandler.*
+io.github.ravichaturvedi.retrier.*
+io.github.ravwojdyla.*
+io.github.rawqing.*
+io.github.rayexpress-libraries.*
+io.github.raytw.*
+io.github.razerdp.*
+io.github.rb958.*
+io.github.rbajek.*
+io.github.rbehjati.*
+io.github.rblessings.*
+io.github.rburgst.*
+io.github.rcapraro.*
+io.github.rcarlosdasilva.*
+io.github.rchowell.*
+io.github.rciovati.tools.*
+io.github.rcraig14.*
+io.github.rctcwyvrn.*
+io.github.rcvaram.*
+io.github.rczyzewski.*
+io.github.rdelfino.*
+io.github.rdlopes.*
+io.github.react-native-tvos.*
+io.github.reactivecircus.app-versioning.*
+io.github.reactivecircus.appversioning.*
+io.github.reactivecircus.blueprint.*
+io.github.reactivecircus.cache4k.*
+io.github.reactivecircus.composelint.*
+io.github.reactivecircus.firestorm.*
+io.github.reactivecircus.flowbinding.*
+io.github.reactiveclown.*
+io.github.readonlycoll.*
+io.github.realdengziqi.*
+io.github.realtimetech-solution.*
+io.github.realyusufismail.*
+io.github.reandroid.*
+io.github.reata.*
+io.github.reatiny.*
+io.github.recheck-io.*
+io.github.redhat-appstudio.jvmbuild.*
+io.github.redick01.*
+io.github.rediscala.*
+io.github.redouane59.twitter.*
+io.github.redroy44.*
+io.github.redstoneboy0509.*
+io.github.redteamobile.*
+io.github.reflekt.*
+io.github.reggert.*
+io.github.reginald-yoeng-lee.*
+io.github.reha2408.*
+io.github.reinershir.auth.*
+io.github.relateddigital.*
+io.github.relaxng.*
+io.github.relbraun.*
+io.github.relvl.*
+io.github.remisbaima.*
+io.github.remod-studios.*
+io.github.remotelog.*
+io.github.renbangjie.*
+io.github.renestel.*
+io.github.renlov.*
+io.github.renxiaole001.*
+io.github.reonaore.*
+io.github.repir.*
+io.github.reporting-solutions.*
+io.github.reporting-solutions.UI.*
+io.github.reporting-solutions.birt-packages.birt-charts.*
+io.github.reporting-solutions.build.*
+io.github.reporting-solutions.build.package.*
+io.github.reporting-solutions.build.package.nl.*
+io.github.reporting-solutions.chart.*
+io.github.reporting-solutions.common.*
+io.github.reporting-solutions.core.*
+io.github.reporting-solutions.data.*
+io.github.reporting-solutions.docs.*
+io.github.reporting-solutions.engine.*
+io.github.reporting-solutions.features.*
+io.github.reporting-solutions.model.*
+io.github.reporting-solutions.nl.*
+io.github.reporting-solutions.testsuites.*
+io.github.reporting-solutions.viewer.*
+io.github.reporting-solutions.xtab.*
+io.github.repozoo.*
+io.github.rerorero.*
+io.github.resilience4j.*
+io.github.reskimulud.*
+io.github.restdocsext.*
+io.github.reugn.*
+io.github.revfactory.*
+io.github.rewheeldev.*
+io.github.rexmtorres.android.*
+io.github.reyerizo.gradle.*
+io.github.rezaiyan.*
+io.github.rgamba.*
+io.github.rgbrizzlehizzle.*
+io.github.rhacs.*
+io.github.rhames07.*
+io.github.rhdunn.*
+io.github.rhkiswani.*
+io.github.rhwayfun.*
+io.github.ricall.junit5-sftp.*
+io.github.ricall.junit5-wiremock.*
+io.github.ricardorlg.*
+io.github.rice456.*
+io.github.rich-is-cat.*
+io.github.richpurba.*
+io.github.richpurba.amazonaws.*
+io.github.richpurba.libraries.*
+io.github.ricnorr.*
+io.github.ricoapon.*
+io.github.riddhi-jani123.*
+io.github.ridiekel.*
+io.github.rieske.dbtest.*
+io.github.rih-carv.livecallback.*
+io.github.riicarus.*
+io.github.rikkimongoose.*
+io.github.ringcentral.*
+io.github.riseclipse.*
+io.github.rishikeshdarandale.*
+io.github.riskidentdms.*
+io.github.ritikchanna.*
+io.github.ritonglue.*
+io.github.ritty27.*
+io.github.rituagrawal1384.*
+io.github.rjaiswal180.*
+io.github.rjs5613.*
+io.github.rk700.*
+io.github.rkamradt.*
+io.github.rkbalgi.*
+io.github.rkonovalov.*
+io.github.rmaiun.*
+io.github.rmuhamedgaliev.*
+io.github.rmuhamedgaliev.errorresolver.*
+io.github.rmuhamedgaliev.yams.*
+io.github.ro4.*
+io.github.robalmeister.*
+io.github.robbilie.*
+io.github.robert-guangzhou.*
+io.github.roberto-marcello.*
+io.github.roberto-marcello.injectmodel.*
+io.github.robertograham.*
+io.github.robin-code.*
+io.github.robin132929.*
+io.github.robinnunkesser.*
+io.github.robocup-logistics.*
+io.github.robothy.*
+io.github.robvanderleek.*
+io.github.robwin.*
+io.github.robzsaunders.*
+io.github.rockerhieu.*
+io.github.rocketk.*
+io.github.rocketmadev.*
+io.github.rocketmix.*
+io.github.rockfireredmoon.*
+io.github.rockitconsulting.*
+io.github.rockscloud.*
+io.github.rocsg.*
+io.github.rodrigocananea.*
+io.github.roger-wernersson.*
+io.github.rogerkeays.*
+io.github.rogerluoz.opslog.*
+io.github.roguedog.*
+io.github.rohitchavan7.*
+io.github.rohitverma882.*
+io.github.rohitverma882.ndk.*
+io.github.rojae.*
+io.github.rollenholt.*
+io.github.roman-mityukov.*
+io.github.romans-weapon.*
+io.github.romansavka-mq.*
+io.github.romeh.*
+io.github.rongaru.*
+io.github.ronghuaxueleng.*
+io.github.rongjianrun.*
+io.github.roofroot.*
+io.github.rool78.*
+io.github.rorp.*
+io.github.ross-oreto.gungnir.*
+io.github.ross-oreto.jackson5.*
+io.github.ross-oreto.latte4j.*
+io.github.rossetti.*
+io.github.rotbolt.*
+io.github.rothschil.*
+io.github.route250.*
+io.github.route4me.*
+io.github.rovingsea.utilityframework.*
+io.github.rovner.*
+io.github.rowak.*
+io.github.royyy1.*
+io.github.rpcheung.*
+io.github.rperez93.gradle-utils.*
+io.github.rqrjc.*
+io.github.rroohit.*
+io.github.rsaavedraf.*
+io.github.rsemlal.*
+io.github.rsotosan.lib.*
+io.github.rsshekhawat.*
+io.github.rsv-code.*
+io.github.rtambun.*
+io.github.rtkaczyk.*
+io.github.rtmigo.*
+io.github.rubenchristoffer.*
+io.github.ruedigerk.contractfirst.generator.*
+io.github.rui8832.*
+io.github.ruieduardosoares.*
+io.github.rukins.*
+io.github.runants.*
+io.github.runedata.*
+io.github.runedata.cache.*
+io.github.running-libo.*
+io.github.ruozhuochen.*
+io.github.rupinderjeet.*
+io.github.rus1f1kat0r.*
+io.github.ruschecker.*
+io.github.rushsky518.*
+io.github.rushuat.*
+io.github.russellfrancis.*
+io.github.rust-nostr.*
+io.github.rwqwr.*
+io.github.rxf113.*
+io.github.rxxy.*
+io.github.ryan-za.*
+io.github.ryanddu.*
+io.github.rybalkinsd.*
+io.github.rygeltang.*
+io.github.rysefoxx.*
+io.github.rysefoxx.anvilgui.*
+io.github.rysefoxx.api.*
+io.github.rysefoxx.examples.*
+io.github.rysefoxx.hologram.plugin.*
+io.github.rysefoxx.inventory.*
+io.github.rysefoxx.npc.plugin.*
+io.github.rysefoxx.v1_16.*
+io.github.rysefoxx.v1_17.*
+io.github.ryunen344.tink.*
+io.github.rzqx.*
+io.github.s-sathish.*
+io.github.s0nicyouth.*
+io.github.s3ns3iw00.*
+io.github.s3s3l.*
+io.github.sa1nt.*
+io.github.saadahmedscse.*
+io.github.sabbib-chowdhury.*
+io.github.sabgilhun.*
+io.github.sabinmj.*
+io.github.sabroe.*
+io.github.sabroe.topp-grind.*
+io.github.sabroe.topp.*
+io.github.sabujak-sabujak.*
+io.github.sachankapil.*
+io.github.sachinnagpal.*
+io.github.sachinnagpal.checking.*
+io.github.sachinnagpal.local.check.*
+io.github.sachinnagpal.paise.*
+io.github.sachinnagpal.pythonscript.*
+io.github.sachinnagpal.pythonscript1.*
+io.github.sachinnagpal.script.check.*
+io.github.sachinnagpal.single.file.*
+io.github.sachinnagpal.testing.*
+io.github.safe-ending.*
+io.github.safeuq.*
+io.github.sagar-viradiya.*
+io.github.sagarvns2003.*
+io.github.saggcs.abebc.*
+io.github.sagifogel.*
+io.github.sahilsonkar.*
+io.github.sahinegilmez.*
+io.github.saic-ismart-api.*
+io.github.saigu.*
+io.github.saintgray.*
+io.github.sakata1222.*
+io.github.saktools.*
+io.github.sakulk.*
+io.github.sakurajimamaii.*
+io.github.salamahin.*
+io.github.salat-23.*
+io.github.saligrama.*
+io.github.sambatech.*
+io.github.sambhav37.*
+io.github.samburi.*
+io.github.samdev313.*
+io.github.samgarasx.*
+io.github.samkelsey.*
+io.github.sammyo.*
+io.github.samnjugu.*
+io.github.samokhodkin.*
+io.github.sampaiodias.*
+io.github.samuel-davis.*
+io.github.samuel-rufi.*
+io.github.samuel-unknown.*
+io.github.samueleresca.*
+io.github.samuelzhaoy.*
+io.github.samyssmile.*
+io.github.sanctuuary.*
+io.github.sandroisu.*
+io.github.sang-hyeon.*
+io.github.sangcomz.*
+io.github.sangdee.*
+io.github.sanggunpark.*
+io.github.sangkeon.*
+io.github.sangsoonam.*
+io.github.sangx123.*
+io.github.sanilborkar.*
+io.github.santhoshvernekar.wordcounter.*
+io.github.sanvibyfish.*
+io.github.sanyarnd.*
+io.github.saoxuequ.*
+io.github.sapientpants.*
+io.github.sapirmedallia.*
+io.github.sapkotamadhusudan.*
+io.github.saqueebali.*
+io.github.saranya-sajeev.*
+io.github.sartner.*
+io.github.sasanlabs.*
+io.github.sashirestela.*
+io.github.sashok1353.*
+io.github.sasiperi.*
+io.github.satya64.*
+io.github.saucam.*
+io.github.saurabhchawla100.*
+io.github.saurabhspec.*
+io.github.sawors.*
+io.github.sb-ai-lab.*
+io.github.sbeausoleil.*
+io.github.sber-platformv.*
+io.github.sber-platformv.faas.*
+io.github.sberid.*
+io.github.sbobrov85.*
+io.github.scailio.*
+io.github.scala-bones.*
+io.github.scala-hamsters.*
+io.github.scala-jwt.*
+io.github.scala-loci.*
+io.github.scala-tessella.*
+io.github.scala-ts.*
+io.github.scalahub.*
+io.github.scalamania.*
+io.github.scalan.*
+io.github.scalapb-json.*
+io.github.scalaquest.*
+io.github.scamandrill.*
+io.github.scambon.*
+io.github.scapy.*
+io.github.scarecraw22.*
+io.github.scauzhangpeng.*
+io.github.sceneview.*
+io.github.schereradi.*
+io.github.scherzhaft.*
+io.github.schidaine.*
+io.github.schlotze.*
+io.github.schm1tz1.kafka.*
+io.github.schneiderlin.*
+io.github.schneidermichael.*
+io.github.schoeberl.*
+io.github.schorcher.stringInterpolator.*
+io.github.schs-robotics.*
+io.github.schwarzit.*
+io.github.sckm.*
+io.github.scordio.*
+io.github.scottconway.*
+io.github.scottg489.*
+io.github.scottweaver.*
+io.github.scouter-project.*
+io.github.scrapy4j.*
+io.github.scrollsyou.*
+io.github.scru128.*
+io.github.scruz84.*
+io.github.scwang90.*
+io.github.sdacode.*
+io.github.sdrafahl.*
+io.github.sdwfqin.android.*
+io.github.seabow.*
+io.github.seagazer.*
+io.github.seal139.*
+io.github.seamapi.*
+io.github.searler.*
+io.github.seba244c.icespire.*
+io.github.sebasbaumh.*
+io.github.sebastian-toepfer.ddd.*
+io.github.sebastian-toepfer.json.rpc.*
+io.github.sebivenlo.*
+io.github.seblm.*
+io.github.secretquestion5.*
+io.github.secretx33.*
+io.github.sedinqa.*
+io.github.see-es-vee.*
+io.github.seirion.*
+io.github.seisuke.*
+io.github.seker.*
+io.github.selcompaytechltd.*
+io.github.selcukes.*
+io.github.selectdb.*
+io.github.selectorrr.*
+io.github.seleniumquery.*
+io.github.selevinia.*
+io.github.selvasuriyanadar.*
+io.github.semlink.*
+io.github.sending-network.*
+io.github.sendon1982.*
+io.github.senierr.*
+io.github.senierr.cobweb.*
+io.github.seniortesting.*
+io.github.senthilganeshs.*
+io.github.senyanwu.*
+io.github.sepgh.*
+io.github.september26.*
+io.github.september669.*
+io.github.serafo27.*
+io.github.sercasti.*
+io.github.seregaslm.*
+io.github.serg-maximchuk.*
+io.github.sergei-lapin.napt.*
+io.github.sergeivisotsky.metadata.*
+io.github.sergeshustoff.dikt.*
+io.github.sergey-melnychuk.*
+io.github.sergiman94.*
+io.github.sergiodeveloper.*
+io.github.sergkhram.*
+io.github.serhiikachan.*
+io.github.serpro69.*
+io.github.serverlesslife.*
+io.github.seshu126.*
+io.github.setchy.*
+io.github.sethyv.*
+io.github.setl-framework.*
+io.github.seuicapp.*
+io.github.seujorgenochurras.*
+io.github.sevdokimov.logviewer.*
+io.github.sevenparadigms.*
+io.github.sevenupup.*
+io.github.seyoungcho2.*
+io.github.sfeir-open-source.*
+io.github.sgpublic.*
+io.github.shabinder.*
+io.github.shadhinkhan.*
+io.github.shafthq.*
+io.github.shahzeb3939.*
+io.github.shakeit66.*
+io.github.shallowinggg.*
+io.github.shamo42.*
+io.github.shanepark.*
+io.github.shanhm1991.*
+io.github.shanmugapriya03.*
+io.github.shannon2014.*
+io.github.shanqiang-sq.*
+io.github.shaohaikkk.*
+io.github.shaohuizhe.*
+io.github.shaolongfei.*
+io.github.shaon2017.*
+io.github.shapley-value-java.*
+io.github.sharelison.*
+io.github.shashank02051997.*
+io.github.shashank1800.*
+io.github.shashankn.*
+io.github.shaunaksrivastava.*
+io.github.shawxingkwok.*
+io.github.shedrackgodson.*
+io.github.shelajev.*
+io.github.shelltea.*
+io.github.shenbinglife.*
+io.github.shengchaojie.*
+io.github.shengulong.*
+io.github.shengzhaotong.*
+io.github.shenqicheng100.*
+io.github.shenyuan122812.*
+io.github.shenyubao.*
+io.github.shenzhen2017.*
+io.github.sheralam.*
+io.github.sherlockeix.*
+io.github.sherlockshi.*
+io.github.shiaharfiyan.*
+io.github.shibabandit.*
+io.github.shichuanenhui.*
+io.github.shield-jaguar.*
+io.github.shijiawei110.*
+io.github.shinusuresh.*
+io.github.shinyshine90.*
+io.github.shiqing.*
+io.github.shirav121.*
+io.github.shirohoo.*
+io.github.shiromoji.*
+io.github.shiruka.*
+io.github.shitlib.*
+io.github.shitsurei.*
+io.github.shiveshnavin.*
+io.github.shiweibsw.*
+io.github.shixinzhang.*
+io.github.shiyd0516.lib.*
+io.github.shiyouping.*
+io.github.shiyusen.jmu.*
+io.github.shkitter.android-version-catalogs.*
+io.github.shmilyhe.*
+io.github.shmilyjxs.*
+io.github.shniu.*
+io.github.shoaky009.*
+io.github.shogowada.*
+io.github.shohiebsense.*
+io.github.shomeier.*
+io.github.shop0.*
+io.github.showthat.*
+io.github.shoy160.*
+io.github.shreeshasa.*
+io.github.shreyashsaitwal.*
+io.github.shreyashsaitwal.rush.*
+io.github.shroman.*
+io.github.shsmysore.fcmjava.*
+io.github.shubhamjha99.*
+io.github.shuigedeng.*
+io.github.shuihuaxiang.*
+io.github.shuliga.dropwizard.*
+io.github.shuogesha.*
+io.github.shuoros.*
+io.github.shusqn.*
+io.github.shuttlelang.*
+io.github.shyamz-22.*
+io.github.shygiants.*
+io.github.sichengtech.*
+io.github.sidcr7-likeminds.*
+io.github.siddarthsreeni.*
+io.github.siddhartha-gadgil.*
+io.github.siddharthgoel88.*
+io.github.sidmalani.*
+io.github.sidney3172.*
+io.github.siegfried0988.*
+io.github.signalwire-community.*
+io.github.sijuestg.*
+io.github.sika-code-cloud.*
+io.github.silencelwy.*
+io.github.silentaaa.*
+io.github.silidos.*
+io.github.silks-x.*
+io.github.simbest.boot.*
+io.github.simlife.*
+io.github.simone-bocca.*
+io.github.simplation.*
+io.github.simple4tests.*
+io.github.simplexdevelopment.*
+io.github.simplifier-ag.*
+io.github.simplyexample.spring.aws.*
+io.github.simukappu.*
+io.github.sinaweibosdk.*
+io.github.sinfull1.*
+io.github.singlerr.*
+io.github.singlewolf.*
+io.github.singond.*
+io.github.singpass.*
+io.github.sinnerlwu.*
+io.github.sinri.*
+io.github.siom79.jasyncapicmp.*
+io.github.siosio.*
+io.github.sirlennox.*
+io.github.sirll.*
+io.github.sisidra.*
+io.github.sitammatt.*
+io.github.sivalabs.*
+io.github.sivalabs.maven.archetypes.*
+io.github.sjanarth.*
+io.github.sjmyuan.*
+io.github.skat.*
+io.github.skauppin.maven.*
+io.github.skenvy.*
+io.github.skeptick.libres.*
+io.github.skhatri.*
+io.github.skolson.*
+io.github.skosijer.*
+io.github.skullper.*
+io.github.skyXingren.*
+io.github.skyjie6.*
+io.github.skylot.*
+io.github.skymw.*
+io.github.skyofsky.*
+io.github.skytasul.*
+io.github.slacesa.simpleSwiftClient.*
+io.github.slackapi4j.*
+io.github.slamduck.*
+io.github.slightlee.*
+io.github.slince.*
+io.github.sloppydaddy.*
+io.github.slothLabs.*
+io.github.slvwolf.*
+io.github.slyang520.*
+io.github.smallmarker.*
+io.github.smart-cloud.*
+io.github.smartandsplendid.*
+io.github.smarthawkeye.*
+io.github.smartsensesolutions.*
+io.github.smartshark.*
+io.github.smartsoftasia.*
+io.github.smaugfm.*
+io.github.smdawe.*
+io.github.smdi.*
+io.github.smecsia.*
+io.github.smeup.jariko.*
+io.github.smeup.reload.*
+io.github.smilexizheng.*
+io.github.smiley4.*
+io.github.smmousavi8872.*
+io.github.smmousavi8872.reactive-flow.*
+io.github.smmousavi8872.reactiveflow.*
+io.github.smufan.*
+io.github.snailrend.dictionary.*
+io.github.snapitch.*
+io.github.snapp-incubator.*
+io.github.snaps-eddy.*
+io.github.snehilrx.*
+io.github.snippet0809.*
+io.github.snowbldr.jooby.*
+io.github.snowbldr.ktor.*
+io.github.snowdrop.jester.*
+io.github.snower.*
+io.github.snowthinker.*
+io.github.snowythinker.*
+io.github.snpefk.*
+io.github.sobelek.*
+io.github.sobhanAhmadian.GameLibrary.*
+io.github.sobotkami.*
+io.github.sobotsdk.*
+io.github.soc-training-tool.*
+io.github.soc.*
+io.github.socketc0nnection.*
+io.github.soft-v.*
+io.github.soft4rchitecture.*
+io.github.softartdev.*
+io.github.softmedtanzania.*
+io.github.software-hardware-codesign.*
+io.github.software-hhao.*
+io.github.sogdata.*
+io.github.sogis.*
+io.github.sogis.archetype.*
+io.github.sokchanbo.*
+io.github.sokybot.mydoggy.*
+io.github.solf.*
+io.github.solneo.*
+io.github.solrudev.*
+io.github.solven-eu.cleanthat.*
+io.github.solven-eu.pepper.*
+io.github.somaiasaeed.*
+io.github.sombriks.*
+io.github.someja.*
+io.github.someshwar1.*
+io.github.sonar-next.*
+io.github.sonatype.sandbox.stargate.*
+io.github.songlonggithub.*
+io.github.songshijun900329.*
+io.github.songyao1987.*
+io.github.sonic-amiga.*
+io.github.soniccloudorg.*
+io.github.sonicdjgh.*
+io.github.sonmoosans.*
+io.github.sonphan12.corelib.*
+io.github.sooyoungjang.*
+io.github.sornerol.*
+io.github.sorokod.*
+io.github.soupedog.*
+io.github.space0o0.*
+io.github.spaceapi-community.*
+io.github.spafka.*
+io.github.spafka.p3c.*
+io.github.spair.*
+io.github.spark-dataprocessing.*
+io.github.spark-redshift-community.*
+io.github.sparsick.testcontainers.gitserver.*
+io.github.spartatech.*
+io.github.speedb-io.*
+io.github.speedbridgemc.*
+io.github.spekka.*
+io.github.spencerpark.*
+io.github.spenceuk.*
+io.github.spilne.*
+io.github.spinsie.*
+io.github.spitmaster.*
+io.github.splitit.*
+io.github.splotycode.mosaik.*
+io.github.spoqa.*
+io.github.sporklibrary.*
+io.github.sportstalk247.sdk-android-kotlin.*
+io.github.sportstalk247.sdk-multiplatform.*
+io.github.spotii-me.*
+io.github.spotim.*
+io.github.spring-cyber.*
+io.github.spring-tools.*
+io.github.springboot-addons.*
+io.github.springbootio.*
+io.github.springlayer.*
+io.github.springsocialmicrosoft.*
+io.github.springstudent.*
+io.github.springwolf.*
+io.github.sproket.*
+io.github.sqlunet.*
+io.github.sqsite.*
+io.github.srempfer.*
+io.github.srgaabriel.clubs.*
+io.github.srgaabriel.deck.*
+io.github.sridhar-sp.*
+io.github.sridharbandi.*
+io.github.sristi.*
+io.github.srjohnathan.*
+io.github.sroca3.*
+io.github.sropelato.*
+io.github.ssaltedfish.*
+io.github.sschrass.*
+io.github.ssddcodes.*
+io.github.sskorol.*
+io.github.sslwireless-mobile.*
+io.github.ssq-sdk.*
+io.github.ssrack.*
+io.github.ssseasonnn.*
+io.github.sstadick.*
+io.github.ssttkkl.*
+io.github.stackableregiments.*
+io.github.stackinfo.*
+io.github.stanch.*
+io.github.stanio.*
+io.github.starkinfra.*
+io.github.starktom256.*
+io.github.starlangsoftware.*
+io.github.stas29a.*
+io.github.stasgora.*
+io.github.stasoko.*
+io.github.stateofzhao.*
+io.github.stawirej.*
+io.github.stayfool.*
+io.github.stayli117.adbserver.*
+io.github.stcarolas.enriched-beans.*
+io.github.std-uritemplate.*
+io.github.steadon.*
+io.github.stefan-ka.*
+io.github.stefanfreitag.*
+io.github.stefankoppier.*
+io.github.stefanosiano.powerful_libraries.*
+io.github.steinerok.sealant.*
+io.github.steinshei.*
+io.github.steliospaps.*
+io.github.stepanovd.*
+io.github.stephankoelle.*
+io.github.stephanomehawej.*
+io.github.stephen-allen.cytosm.*
+io.github.stephenbellanger.kit.lint.*
+io.github.stephenc.*
+io.github.stephenc.avatar-factory.*
+io.github.stephenc.crypto.*
+io.github.stephenc.docker.*
+io.github.stephenc.maven.*
+io.github.stephenc.tmp-fork.*
+io.github.stepio.coffee-boots.*
+io.github.stepio.jgforms.*
+io.github.stepio.lambda.*
+io.github.stepping1st.*
+io.github.stevecrox.*
+io.github.stevecrox.geo.*
+io.github.stevecrox.maven.skins.*
+io.github.stevecrox.maven.skins.example.*
+io.github.steven-gueguen.*
+io.github.stevenjdh.*
+io.github.stevenjwest.*
+io.github.stevepham.*
+io.github.steveswinsburg.*
+io.github.stewforani.*
+io.github.stewseo.*
+io.github.stitelnet.*
+io.github.stoneream.*
+io.github.storix.*
+io.github.stormeye2000.*
+io.github.strange-qwq.*
+io.github.streetcontxt.*
+io.github.stringcare.*
+io.github.striped.*
+io.github.stripling-feng.*
+io.github.strongdm.*
+io.github.strongmore168.*
+io.github.stroppycow.*
+io.github.stscoundrel.*
+io.github.stuartwdouglas.hacbs-test.gradle.*
+io.github.stuartwdouglas.hacbs-test.shaded.*
+io.github.stuartwdouglas.hacbs-test.simple.*
+io.github.stuartwdouglas.supply-chain-security.cool-lib.*
+io.github.student9128.*
+io.github.studeyang.*
+io.github.studyandmasti.*
+io.github.stumper66.*
+io.github.stupidSoap.*
+io.github.stxyg.*
+io.github.stylesmile.*
+io.github.subhendushekhar.cjson.*
+io.github.subiyacryolite.*
+io.github.subsidian-financial-technology-ltd.*
+io.github.substate-tech.*
+io.github.subtlelib.*
+io.github.succlz123.*
+io.github.sudharsan-selvaraj.*
+io.github.sudharshan50.*
+io.github.sudo248.*
+io.github.sudokar.*
+io.github.suduide.*
+io.github.sufyankhanrao.*
+io.github.sugakandrey.*
+io.github.sugar-cubes.*
+io.github.suifenge.*
+io.github.sukgu.*
+io.github.sullis.*
+io.github.sumedhe.*
+io.github.sumitsutar.*
+io.github.summercattle.*
+io.github.sunbingchuan.*
+io.github.sunbird89629.*
+io.github.sundoggynew.*
+io.github.sungiant.*
+io.github.sungpeo.*
+io.github.sunilgulabani.*
+io.github.sunitsdk.*
+io.github.sunjc53yy.*
+io.github.sunjinxi1994.*
+io.github.sunningg.*
+io.github.sunnydsouza.*
+io.github.sunshaobei.*
+io.github.sunshine001.*
+io.github.sunwenjieIT.*
+io.github.suopovate.*
+io.github.superbigjian.base.*
+io.github.superbigjian.libs.*
+io.github.superbigjian.plugin.*
+io.github.superfive666.*
+io.github.supernova-team.*
+io.github.supersnager.*
+io.github.supertidus.*
+io.github.suppennudel.*
+io.github.suppierk.*
+io.github.surajs1n.*
+io.github.sureshnath.*
+io.github.surfantmedia.*
+io.github.suricsun.*
+io.github.suru33.*
+io.github.survival1sm.*
+io.github.susantkumarbhuyan.*
+io.github.susimsek.*
+io.github.suuirad.*
+io.github.suxil.*
+io.github.suyghur.dolin.*
+io.github.suzunshou.*
+io.github.svarzee.*
+io.github.sveryovka.*
+io.github.svndump-to-git.*
+io.github.swachter.*
+io.github.swagger2markup.*
+io.github.swalikh.*
+io.github.swamys123.*
+io.github.swapnilhuddar.*
+io.github.swati4star.*
+io.github.swatmobility.*
+io.github.swedishborgie.*
+io.github.sweehaw.*
+io.github.sweetd3v.*
+io.github.swim2sun.*
+io.github.swissclash79.*
+io.github.switchover.*
+io.github.swsk33.*
+io.github.swsw1005.*
+io.github.sy007.*
+io.github.sy007.debounce-plugin.*
+io.github.syex.*
+io.github.sylllys.*
+io.github.symonk.*
+io.github.synesso.*
+io.github.syrou.*
+io.github.szhittech.*
+io.github.szkiba.*
+io.github.szleaves.hadoop.*
+io.github.szrnka-peter.*
+io.github.t-bright.*
+io.github.t-crest.*
+io.github.t-regbs.*
+io.github.t12y.*
+io.github.t83714.*
+io.github.t894924815.*
+io.github.tabarakmohammed.*
+io.github.tabilzad.*
+io.github.tablestakes.*
+io.github.taciosd.*
+io.github.tacofan.*
+io.github.tadeuespindolapalermo.collectionutil.*
+io.github.taeyunha.*
+io.github.tag-sql.*
+io.github.taills.*
+io.github.takahirom.roborazzi.*
+io.github.takahirom.roborazzi.gradle.*
+io.github.takenet.*
+io.github.takke.*
+io.github.takusan23.*
+io.github.talelin.*
+io.github.tallencewassimakachi.*
+io.github.tamojuno.*
+io.github.tamurashingo.sqlanalyzer.*
+io.github.tangchaojian.*
+io.github.tangnuo.*
+io.github.tangtongda.*
+io.github.tangxiangan.*
+io.github.tanhuang2016.*
+io.github.tanin47.*
+io.github.tanky-zhang.*
+io.github.tans5.*
+io.github.tantantan277.*
+io.github.tanyaofei.*
+io.github.tanzhou2002.*
+io.github.tanzibiao.*
+io.github.taoguan.*
+io.github.taoguoliang.*
+io.github.taoqianqian.*
+io.github.taoweiji.*
+io.github.taoweiji.grouter.*
+io.github.taoweiji.image.*
+io.github.taoweiji.kvstorage.*
+io.github.taoweiji.quickjs.*
+io.github.taoweiji.single-activity-navigation.*
+io.github.taoweiji.webviewx.*
+io.github.taoyua.*
+io.github.tapprai.*
+io.github.taptappub.*
+io.github.taptime.*
+io.github.tapwithus.*
+io.github.tashilapathum.*
+io.github.taskexec.*
+io.github.tassun.*
+io.github.tatooinoyo.*
+io.github.tatools.*
+io.github.taylorxian.*
+io.github.tb-soft.*
+io.github.tblsoft.solr.*
+io.github.tbrown1979.*
+io.github.tdf4j.*
+io.github.tdwu.*
+io.github.tdxtxt.*
+io.github.team-xquare.*
+io.github.team6083.*
+io.github.teamcheeze.*
+io.github.teamx177.*
+io.github.teascloud.*
+io.github.teastman.*
+io.github.techacademy-curricula.*
+io.github.techgnious.*
+io.github.technologize.*
+io.github.technow-oficial.*
+io.github.techthird.*
+io.github.telegram4j.*
+io.github.telxs.*
+io.github.tempo-platform.*
+io.github.tencent.*
+io.github.tencentmusic.*
+io.github.tencentsm.*
+io.github.teoan.*
+io.github.teobaranga.viewbindingowner.*
+io.github.teodorov.*
+io.github.tequilacn.*
+io.github.terjouxanthony.*
+io.github.terloo.*
+io.github.terminological.*
+io.github.ternaryop.*
+io.github.terziele.swarz.*
+io.github.tessellator.*
+io.github.testplanb.*
+io.github.testra.*
+io.github.testsigma-eng.*
+io.github.testtemplate.*
+io.github.tetherless-world.*
+io.github.teuton-software.*
+io.github.tf2jaguar.micro.*
+io.github.tfahub.*
+io.github.tfedyanin.springframework.*
+io.github.tfriedrichs.*
+io.github.tfw-org.*
+io.github.thalescpl-io.cadp.*
+io.github.thanakorntr.*
+io.github.thanapon-bizone.*
+io.github.thang-uit.*
+io.github.thanglequoc.*
+io.github.thanh1912.*
+io.github.thanhduybk.*
+io.github.thanhj.*
+io.github.thanosfisherman.mayi.*
+io.github.thanosfisherman.wifiutils.*
+io.github.thats-what-im-talking-about.*
+io.github.theangrydev.*
+io.github.theangrydev.fluentbdd.*
+io.github.theangrydev.thinhttpclient.*
+io.github.thebabels.*
+io.github.thebesteric.framework.*
+io.github.thebesteric.framework.agile.*
+io.github.thebesteric.framework.mocker.*
+io.github.thebesteric.framework.switchlogger.*
+io.github.theborakompanioni.*
+io.github.thecodinglog.*
+io.github.thedrawingcoder-gamer.*
+io.github.theentropyshard.*
+io.github.thefolle.*
+io.github.thehamzarocks.*
+io.github.thehonesttech.*
+io.github.themegax.*
+io.github.themrmilchmann.curseforge-publish.*
+io.github.themrmilchmann.ecj.*
+io.github.themrmilchmann.gradle.ecj.*
+io.github.themrmilchmann.gradle.publish.curseforge.*
+io.github.themrmilchmann.gradle.toolchainswitches.*
+io.github.themrmilchmann.stash.*
+io.github.themrmilchmann.toolchain-switches.*
+io.github.thenovaworks.*
+io.github.theozhou.*
+io.github.theprez.*
+io.github.thepun.*
+io.github.therandomcrafter83.*
+io.github.therealarthurdent.*
+io.github.therealmone.*
+io.github.therealmone.tdf4j.*
+io.github.theskyblockman.*
+io.github.thewebcode.*
+io.github.thewildbunchpog.*
+io.github.thexxiv.*
+io.github.thiagolvlsantos.*
+io.github.thibaudledent.j8583.*
+io.github.thibaultbee.*
+io.github.thibaultmeyer.*
+io.github.thibseisel.identikon.*
+io.github.thingersoft.*
+io.github.thingsdb.*
+io.github.thinhndg.*
+io.github.thinkdiffw.*
+io.github.thirdparty-core.*
+io.github.thisdk.core.*
+io.github.thiyagu06.*
+io.github.thlee-alti.*
+io.github.thomaschant.*
+io.github.thomsontomy.*
+io.github.thongtpvinh3.*
+io.github.thoughtspot.*
+io.github.three-side.*
+io.github.threeten-jaxb.*
+io.github.thridparty-cloud2.*
+io.github.throwable.mdc4spring.*
+io.github.throyer.*
+io.github.thugrzz.*
+io.github.thunderrule.*
+io.github.thundzeng.*
+io.github.thunkware.*
+io.github.thxno.*
+io.github.tiagoadmstz.*
+io.github.tianjianzhihui.*
+io.github.tianshan20081.*
+io.github.tianshaokai.*
+io.github.tianshouzhi.*
+io.github.tianxing-ovo.*
+io.github.tibus29.*
+io.github.tick-taku.*
+io.github.ticktack.*
+io.github.tidal-code.*
+io.github.tiger822.*
+io.github.tiger822.netty.*
+io.github.tigerbrokers.*
+io.github.tikivn.*
+io.github.tilumi.*
+io.github.tim06.*
+io.github.timbotetsu.*
+io.github.timsetsfire.*
+io.github.timwspence.*
+io.github.tingbob.*
+io.github.tino1231.*
+io.github.tirth132.*
+io.github.tivrfoa.*
+io.github.tjheslin1.*
+io.github.tkasozi.*
+io.github.tkdlqh2.*
+io.github.tmac1024.*
+io.github.tmcreative1.*
+io.github.tno.*
+io.github.tobetwo.*
+io.github.tobi-laa.*
+io.github.tobi2k.*
+io.github.tobias-z.*
+io.github.tobiashochguertel.*
+io.github.tobsef.*
+io.github.toddburnside.*
+io.github.todo2088.*
+io.github.todokr.*
+io.github.toger2021.*
+io.github.together.*
+io.github.together.libraries.*
+io.github.together.modules.*
+io.github.toggery.*
+io.github.toiyeumayhoc.*
+io.github.tokenjan.*
+io.github.tokenyc.*
+io.github.tokgoronin.*
+io.github.tolisso.*
+io.github.tomalloc.*
+io.github.tomaslad.*
+io.github.tomaszstaniewicz.*
+io.github.tomboyo.lily.*
+io.github.tomdw.java.modules.*
+io.github.tomdw.java.modules.spring.*
+io.github.tomdw.java.modules.spring.samples.basicapplication.*
+io.github.tomhusky.*
+io.github.tommwq.*
+io.github.tommy-geenexus.*
+io.github.tomokinakamaru.silverchain.*
+io.github.tomoya0x00.*
+io.github.tompee26.*
+io.github.tomykaira.*
+io.github.tong12580.*
+io.github.tonnyl.*
+io.github.tontu89.*
+io.github.tonyandfriday.*
+io.github.tonyandjoin.*
+io.github.tonybro233.*
+io.github.tonycody.maven.plugins.*
+io.github.tonylituo.*
+io.github.tonyxyu.*
+io.github.toohandsome.*
+io.github.toolfactory.*
+io.github.toolgood.*
+io.github.tools1000.*
+io.github.tools1000.codesignjava.*
+io.github.tools1000.fx1000.*
+io.github.top-100-writer.*
+io.github.topicstudy.*
+io.github.topikachu.*
+io.github.toponteam.*
+io.github.toquery.*
+io.github.torocket.*
+io.github.torrentdam.bencode.*
+io.github.torrentdam.bittorrent.*
+io.github.torrentdam.server.*
+io.github.torresc24.*
+io.github.torrydo.*
+io.github.tors42.*
+io.github.toru0239.*
+io.github.tosmo5.*
+io.github.totomiz.*
+io.github.totoro-dev.*
+io.github.totorowow.*
+io.github.toukomine.*
+io.github.townyui.*
+io.github.toxa2033.saved-state.*
+io.github.tozmart.*
+io.github.tozmart.thirdparty.*
+io.github.tozyf.*
+io.github.tpataky.*
+io.github.tpnsPush.*
+io.github.tprado.*
+io.github.tquality.*
+io.github.traceunit.*
+io.github.track-asia.*
+io.github.tradeworks.*
+io.github.tradplus.*
+io.github.traeric.sirvia.*
+io.github.tramchamploo.*
+io.github.tranchitam.*
+io.github.trangntt-016.*
+io.github.tranngockhoa.*
+io.github.transcendent-ai-labs.*
+io.github.translate4j.*
+io.github.tree4free.*
+io.github.treebolic.*
+io.github.treech.*
+io.github.trendyol.*
+io.github.tri-omega.*
+io.github.trigunam.java.util.*
+io.github.trikorasolns.*
+io.github.trilobitsystems.*
+io.github.triniwiz.*
+io.github.triniwiz.fancycamera.*
+io.github.tristanjl.*
+io.github.troimaclure.*
+io.github.tronprotocol.*
+io.github.troungtam70.*
+io.github.truerss.*
+io.github.trunks2008.*
+io.github.trustedshops-public.*
+io.github.try-parser.*
+io.github.trycatchx.*
+io.github.tsabirgaliev.*
+io.github.tschut.*
+io.github.tsegismont.*
+io.github.tsg-ns-dev.*
+io.github.tssrikanth.*
+io.github.tsubhasha.*
+io.github.ttayaa.ttsql.*
+io.github.ttj4.*
+io.github.ttony.*
+io.github.tuannh982.*
+io.github.tuannq-0847.*
+io.github.tuanson.*
+io.github.tubaget.*
+io.github.tudo-aqua.*
+io.github.tudouyay.*
+io.github.tuean.*
+io.github.tuhe32.*
+io.github.tundeadetunji.*
+io.github.tunkko.*
+io.github.turansky.cesium.*
+io.github.turansky.kfc.*
+io.github.turansky.seskar.*
+io.github.turtleisaac.*
+io.github.turtlemonvh.*
+io.github.tushar-naik.*
+io.github.tutorialsandroid.*
+io.github.tuzon.*
+io.github.tvtechservice.*
+io.github.twinklekhj.*
+io.github.twinkling-cn.*
+io.github.twitch4j.streamlabs4j.*
+io.github.two-coders.*
+io.github.twonirwana.*
+io.github.twonote.*
+io.github.tyb-luoyun.*
+io.github.tyczj.*
+io.github.tyczj.lumberjack.*
+io.github.typebricks.*
+io.github.typelogic.*
+io.github.typemonkey.*
+io.github.typeness.*
+io.github.typesafeconfigops.*
+io.github.typesafegithub.*
+io.github.typhon0.*
+io.github.tzebrowski.*
+io.github.tzfun.jvmm.*
+io.github.tzizi5566.*
+io.github.tzssangglass.*
+io.github.u004.*
+io.github.ubapp.*
+io.github.uchagani.*
+io.github.ucl-ingi.*
+io.github.udarya.*
+io.github.udaychandra.*
+io.github.udaychandra.bdd.*
+io.github.udaychandra.susel.*
+io.github.udaysagar2177.*
+io.github.udhayarajan.*
+io.github.uedsonreis.*
+io.github.uf-developer.*
+io.github.ufukhalis.*
+io.github.ufukhalis.phoenix.*
+io.github.ugoevola.*
+io.github.ugolkov-sv.*
+io.github.uharaqo.*
+io.github.uigdwunm.*
+io.github.uinnn.*
+io.github.ujizin.*
+io.github.ulabsdevelopmentteam.*
+io.github.uladzimirosipchyk.*
+io.github.ulfs.*
+io.github.ulisse1996.*
+io.github.ulitol97.*
+io.github.ulyyyyyy.*
+io.github.ulzio.*
+io.github.umbranium.*
+io.github.umutayb.*
+io.github.unboundsecurity.*
+io.github.uncle-chan.*
+io.github.underwindfall.*
+io.github.ungle.*
+io.github.uni-cstar.*
+io.github.unickcheng.*
+io.github.unifycom.*
+io.github.unionj-cloud.*
+io.github.unitbean.*
+io.github.universeproject.*
+io.github.universityfinalprojects.*
+io.github.unknowncoder56.*
+io.github.unongmilkumk.*
+io.github.unredundant.*
+io.github.unseen-research.urwerk.*
+io.github.untactorder.*
+io.github.unveloper.*
+io.github.uoooo.*
+io.github.upmc-enterprises.*
+io.github.upstarts.*
+io.github.uptalent.*
+io.github.uptane.*
+io.github.uqix.*
+io.github.url-detector.*
+io.github.usamawizard.*
+io.github.usefulalgorithm.*
+io.github.usefulness.*
+io.github.usefulness.ktlint-gradle-plugin.*
+io.github.usefulness.screenshot-testing-plugin.*
+io.github.usernugget.*
+io.github.uspyt.*
+io.github.utsmannn.*
+io.github.uttam-kumar-tak.*
+io.github.uuverifiers.*
+io.github.v-ed.*
+io.github.v0ncent.*
+io.github.v2softwarehouse.*
+io.github.v3nd3774.uta2218.cse6324.s001.*
+io.github.vaa25.*
+io.github.vadimpikha.*
+io.github.vadimpikha.gradle.*
+io.github.vadimpikha.gradle.update4j.*
+io.github.vadimv.*
+io.github.vadiole.*
+io.github.vadymkykalo.*
+io.github.vahidhedayati.*
+io.github.vaimr.*
+io.github.valdemargr.*
+io.github.valdzx.*
+io.github.valtech-ch.*
+io.github.valtechmobility.*
+io.github.valters.*
+io.github.valters.build.*
+io.github.vamViolet.*
+io.github.vampireachao.*
+io.github.vampirendy.*
+io.github.vanbadasselt.*
+io.github.vanpra.compose-material-dialogs.*
+io.github.vantiv.*
+io.github.vantoozz.*
+io.github.vantoozz.kli.*
+io.github.vanzoosdk.*
+io.github.vaqxai.*
+io.github.varconf.*
+io.github.varoso.*
+io.github.vashilk.*
+io.github.vashishthask.*
+io.github.vashteera.*
+io.github.vasya-polyansky.*
+io.github.vatisteve.*
+io.github.vazand.*
+io.github.vbiloshkurskyi.*
+io.github.vbounyasit.*
+io.github.vcsdailiusrepo.*
+io.github.vdaburon.*
+io.github.vdaburon.jmeter.utils.*
+io.github.vdavidp.*
+io.github.veigara.*
+io.github.venafi.*
+io.github.venkataseshaiahudatha.*
+io.github.ventsea.*
+io.github.venturelabsbr.*
+io.github.verils.*
+io.github.verissimor.lib.*
+io.github.verygoodwlk.*
+io.github.verypossible.*
+io.github.vfhhu.*
+io.github.vfmunhoz.*
+io.github.vfreex.jenkins.plugins.*
+io.github.vfreex.perfcharts.*
+io.github.vftake5.*
+io.github.vgaj.*
+io.github.vgv.*
+io.github.vhoyon.*
+io.github.vhukze.*
+io.github.viacheslavbondarchuk.*
+io.github.viakiba.*
+io.github.vibrantbyte.*
+io.github.vichukano.*
+io.github.vicmikhailau.*
+io.github.victorkabata.*
+io.github.victoryckl.*
+io.github.victorzzzz.*
+io.github.vida-nyu.*
+io.github.viepovsky.*
+io.github.vigoo.*
+io.github.viifo.*
+io.github.vijayvepa.*
+io.github.vilaided.*
+io.github.vinayalodha.*
+io.github.vinaygaykar.*
+io.github.vinccool96.algorithms.*
+io.github.vinccool96.junit4.generator.*
+io.github.vinccool96.logging.*
+io.github.vinccool96.modifications.*
+io.github.vinccool96.observations.*
+io.github.vinccool96.ref.*
+io.github.vinccool96.uncaught.*
+io.github.vincent-series.*
+io.github.vincent0929.*
+io.github.vincentchuardi.*
+io.github.vincentvibe3.*
+io.github.vincenzobaz.*
+io.github.vincenzopalazzo.*
+io.github.viniarck.*
+io.github.vinicreis.*
+io.github.vinit15.*
+io.github.vinogradoff.*
+io.github.vinosimon.*
+io.github.vinrichard.*
+io.github.vip-test.*
+io.github.vipcxj.*
+io.github.vipvideo.*
+io.github.virelion.*
+io.github.virtualdogbert.*
+io.github.virusbear.trace.*
+io.github.vishalbhartips.*
+io.github.vision-consensus.*
+io.github.vistritium.*
+io.github.vitaliitilner.*
+io.github.vitalij3.*
+io.github.vitalyaoo.*
+io.github.vitorcezli.*
+io.github.vitorsalgado.puma4j.*
+io.github.vivtoum.*
+io.github.vkatz.*
+io.github.vlad-mk.*
+io.github.vladcar.*
+io.github.vladimirsergeevichfedorov.*
+io.github.vladislav-chetrari.*
+io.github.vladshyrokyi.*
+io.github.vlasentiy.*
+io.github.vlbaluk.*
+io.github.vldi01.*
+io.github.vlmiroshnikov.*
+io.github.vlsergey.*
+io.github.vlsi.kae.*
+io.github.vlsi.kotlin-argument-expression-base.*
+io.github.vlsi.kotlin-argument-expression.*
+io.github.vmzakharov.*
+io.github.vn7n24fzkq.cpower-controller.*
+io.github.voduku.*
+io.github.voidcontext.*
+io.github.voidzombie.*
+io.github.voilet0604.*
+io.github.voishion.*
+io.github.voitenkodev.*
+io.github.voltir.*
+io.github.volyx.*
+io.github.vonathar.*
+io.github.voofai.*
+io.github.vorvadoss.*
+io.github.votoanthuan.*
+io.github.vouched.*
+io.github.vovak.*
+io.github.voxelchamber.*
+io.github.voytech.*
+io.github.vreut.parser.*
+io.github.vsLoong.*
+io.github.vspiliop.monitoring.*
+io.github.vspiliop.testing.*
+io.github.vsukharew.*
+io.github.vtn-dev-ajay.*
+io.github.vungocbinh2009.*
+io.github.vvb2060.ndk.*
+io.github.vveird.*
+io.github.vvk78.perceptnet.commons.*
+io.github.vvk78.perceptnet.commons.restproxy.*
+io.github.vvvvvoin.*
+io.github.vwenx.*
+io.github.vyaslav.*
+io.github.vyo.*
+io.github.vzardlloo.*
+io.github.vzhn.*
+io.github.w-nowak.tools.*
+io.github.w-ping.*
+io.github.waas-api.*
+io.github.wadsg.*
+io.github.waduclay.*
+io.github.wafflestudio.*
+io.github.wafflestudio.base.*
+io.github.wafflestudio.springboot.*
+io.github.waibozi.*
+io.github.wairdell.*
+io.github.walker163.*
+io.github.waltercojal.*
+io.github.walterinkitchen.*
+io.github.wan-droid.*
+io.github.wand555.*
+io.github.wandering.*
+io.github.wang-guangcheng.maventest.*
+io.github.wang-xiaowu.*
+io.github.wangdingfu.*
+io.github.wanggit.*
+io.github.wanggy820.*
+io.github.wanghonglin.*
+io.github.wanghongzhou.*
+io.github.wanghuayao.*
+io.github.wanghui19970715.*
+io.github.wangjie-fourth.*
+io.github.wangjie0822.*
+io.github.wangjundev.*
+io.github.wangshuogit.*
+io.github.wangshuwen1107.*
+io.github.wangsrgit119.random.util.*
+io.github.wangtianruipopo.*
+io.github.wangxianzhuo.*
+io.github.wangxvdong.*
+io.github.wangzh13.*
+io.github.wangzhiwei1314.*
+io.github.wankey.mithril.*
+io.github.wannesvr.*
+io.github.wanniDev.*
+io.github.wannidev.*
+io.github.wanwenshuai.*
+io.github.warnotte.*
+io.github.warren1001.*
+io.github.warriorzz.*
+io.github.watayouxiang.*
+io.github.watayouxiang.3rd.*
+io.github.watayouxiang.tio.*
+io.github.watertao.*
+io.github.waxmoon.*
+io.github.wayn111.*
+io.github.waynejo.*
+io.github.wazoakarapace.*
+io.github.wcl9900.*
+io.github.wdeo3601.*
+io.github.wdream101.*
+io.github.we-ar.*
+io.github.weasley-j.*
+io.github.web3study.cns.*
+io.github.weblegacy.*
+io.github.webrtc-sdk.*
+io.github.webscrapingapi.*
+io.github.wechaty.*
+io.github.weeshin.*
+io.github.weibodip.*
+io.github.weiggle.*
+io.github.weihubeats.*
+io.github.weihuihuang.*
+io.github.weijun501.*
+io.github.weijunfeng.*
+io.github.weijunfeng.maven.publish.android.*
+io.github.weijunfeng.maven.publish.kmm.*
+io.github.weikaiyu-bit.*
+io.github.weilianyang.*
+io.github.weiliqiang.*
+io.github.weimin96.*
+io.github.weishuaidev.*
+io.github.weissmuster.*
+io.github.weiyijian.*
+io.github.weizhenyu0310.*
+io.github.weizhonzhen.*
+io.github.well410.*
+io.github.wellingtoncosta.*
+io.github.wendy512.*
+io.github.wengliuhu.*
+io.github.wenkiam.*
+io.github.wenlong-guo.*
+io.github.wenpanwenpan.*
+io.github.weresandstorm.*
+io.github.wernz0r.*
+io.github.wesleyone.*
+io.github.wesson88.*
+io.github.westonal.*
+io.github.wetestquality.*
+io.github.wflin2020.*
+io.github.wh8xx.*
+io.github.whaleal.*
+io.github.whatap.*
+io.github.whathecode.kotlinx.interval.*
+io.github.whazzabi.*
+io.github.wherby.*
+io.github.whilein.*
+io.github.whilein.wcommons.*
+io.github.whiliang.*
+io.github.whimthen.*
+io.github.whiskeysierra.*
+io.github.whitechen233.*
+io.github.whitedg.*
+io.github.whitemagic2014.*
+io.github.whitenoise0000.*
+io.github.whiteorganization.*
+io.github.whiterasbk.*
+io.github.whosmyqueen.*
+io.github.whutddk.*
+io.github.why-group.*
+io.github.why168.*
+io.github.whyareyousoseriously.*
+io.github.wickie73.*
+io.github.widok.*
+io.github.wikimore.*
+io.github.willena.*
+io.github.willhains.*
+io.github.william353.logger.*
+io.github.william353.systrace.*
+io.github.williamgufeng.*
+io.github.williamkwokx.*
+io.github.williankl.spinnable.*
+io.github.willianwd.*
+io.github.willing-xyz.parentpom.*
+io.github.wilson-he.*
+io.github.wimdeblauwe.*
+io.github.windedge.*
+io.github.windibreeze.*
+io.github.windysha.*
+io.github.winkeylucky.*
+io.github.wirednerd.*
+io.github.wisa-lab.*
+io.github.wisharetec.*
+io.github.wisser.*
+io.github.wistefan.*
+io.github.wiverson.*
+io.github.wiwi289.*
+io.github.wizzxu.*
+io.github.wj0410.*
+io.github.wjf510.*
+io.github.wjf510.complete-kotlin.*
+io.github.wjf510.fingerprint.change.*
+io.github.wjf510.kmmbridge.*
+io.github.wjf510.maven.publish.*
+io.github.wjh1984306683.*
+io.github.wjiajun.*
+io.github.wjur.*
+io.github.wkkdhr.*
+io.github.wldt.*
+io.github.wldt.test.*
+io.github.wlwoon.*
+io.github.wmaarts.*
+io.github.wmartinmimi.*
+io.github.wniemiec-component-java.*
+io.github.wniemiec-data-java.*
+io.github.wniemiec-io-java.*
+io.github.wniemiec-task-java.*
+io.github.wniemiec-util-data.*
+io.github.wniemiec-util-java.*
+io.github.wnjustdoit.*
+io.github.wnleao.*
+io.github.wnwnwang.*
+io.github.wolfendale.*
+io.github.wolfetti.*
+io.github.wolfraam.*
+io.github.wonderandroid.*
+io.github.wonderf.*
+io.github.woodenlock.*
+io.github.woodser.*
+io.github.woody230.*
+io.github.woody230.gradle.*
+io.github.woody230.gradle.internal.*
+io.github.woody230.gradle.internal.aboutlibraries.*
+io.github.woody230.gradle.internal.android-application.*
+io.github.woody230.gradle.internal.android-desugar.*
+io.github.woody230.gradle.internal.android-library.*
+io.github.woody230.gradle.internal.buildkonfig.*
+io.github.woody230.gradle.internal.bundled.*
+io.github.woody230.gradle.internal.composite-property.*
+io.github.woody230.gradle.internal.composite-publish.*
+io.github.woody230.gradle.internal.composite-test.*
+io.github.woody230.gradle.internal.jvm-publish.*
+io.github.woody230.gradle.internal.kotlininject.*
+io.github.woody230.gradle.internal.moko-resources.*
+io.github.woody230.gradle.internal.multiplatform-compose-test.*
+io.github.woody230.gradle.internal.multiplatform-compose.*
+io.github.woody230.gradle.internal.multiplatform-publish.*
+io.github.woody230.gradle.internal.multiplatform-test.*
+io.github.woody230.gradle.internal.multiplatform.*
+io.github.woody230.gradle.internal.plugin-publish.*
+io.github.woody230.gradle.internal.version-catalog.*
+io.github.woody230.gw2.*
+io.github.woody230.ktx.*
+io.github.wooenrico.*
+io.github.world-wide-development.*
+io.github.world93.*
+io.github.worldline-deepalimundaye.*
+io.github.woshihoujinxin.*
+io.github.wppcc.*
+io.github.wqbill.*
+io.github.wqr503.*
+io.github.ws723.*
+io.github.wsaaaqqq.*
+io.github.wsapm.*
+io.github.wsjuanve.*
+io.github.wslaimin.*
+io.github.wslxm.*
+io.github.wsz82.*
+io.github.wtfjoke.*
+io.github.wtog.*
+io.github.wu191287278.*
+io.github.wuare.*
+io.github.wuba.*
+io.github.wuda0112.*
+io.github.wufei-limit.*
+io.github.wufuqi123.*
+io.github.wuji-co.*
+io.github.wujun728.*
+io.github.wulinghui.*
+io.github.wulkanowy.*
+io.github.wulkanowy.sdk.*
+io.github.wuma2020.*
+io.github.wurensen.*
+io.github.wutongsh.*
+io.github.wuwei-apc.*
+io.github.wuwei01.*
+io.github.wuyan001.*
+io.github.wvkity.*
+io.github.wwhysohard.*
+io.github.wwwlike.*
+io.github.wx2331.*
+io.github.wxyzard.*
+io.github.wybosys.*
+io.github.wycliffmuriithi.*
+io.github.wycst.*
+io.github.wyp0596.*
+io.github.wz7982.*
+io.github.wzasd.*
+io.github.wzjing.walle.*
+io.github.wzw32768.*
+io.github.wzy911229.*
+io.github.x-englishwordnet.*
+io.github.x-funs.*
+io.github.x-gorn.*
+io.github.x-stream.*
+io.github.x-team-plus.*
+io.github.x2ge.*
+io.github.x950827.*
+io.github.xanderwang.*
+io.github.xanthic.cache.*
+io.github.xantorohara.*
+io.github.xatzipe.*
+io.github.xaviergomesmc.*
+io.github.xaxisplayz.reportplus.*
+io.github.xayahsususu.*
+io.github.xayahsususu.materialyoufileexplorer.*
+io.github.xbaank.*
+io.github.xbaank.simpleJson.*
+io.github.xbstar.*
+io.github.xcapdevila.*
+io.github.xch168.*
+io.github.xcmain.*
+io.github.xcr1234.*
+io.github.xdfaisupport.*
+io.github.xencura.*
+io.github.xenon245.*
+io.github.xenonview-com.*
+io.github.xerprojects.*
+io.github.xezzon.*
+io.github.xfournet.jconfig.*
+io.github.xgvlsdk.*
+io.github.xhaodev.*
+io.github.xhstormr.text-masker.*
+io.github.xhystc.*
+io.github.xiami0725.*
+io.github.xiane.*
+io.github.xiangtao946.*
+io.github.xianyao12.*
+io.github.xiao-organization.*
+io.github.xiaobogaga.*
+io.github.xiaochengzhen.*
+io.github.xiaoeteam.*
+io.github.xiaofeidev.*
+io.github.xiaofeng2233.*
+io.github.xiaofengshen.*
+io.github.xiaogangfan.*
+io.github.xiaojye.*
+io.github.xiaolutang.*
+io.github.xiaomanzijia.*
+io.github.xiaomaomi-xj.*
+io.github.xiaopdtext.*
+io.github.xiaoseee.*
+io.github.xiaoshen9404.*
+io.github.xiaoweiyo.*
+io.github.xiaoxiangyeyu123.*
+io.github.xiaoxuetu.*
+io.github.xiaoxunyao.*
+io.github.xiaoyi311.*
+io.github.xiaoyinxu.*
+io.github.xiaoyudeguang.*
+io.github.xiaoyuecai.*
+io.github.xiaoyvyv.*
+io.github.xiaozeiqwe8.*
+io.github.xiehai.*
+io.github.xiejinwei93.*
+io.github.xiesixian.*
+io.github.xieyinglin.*
+io.github.xilingit.*
+io.github.xingen13.*
+io.github.xinpengfei520.*
+io.github.xinshepherd.*
+io.github.xinyang-pan.*
+io.github.xinyang-pan.crypto4j.*
+io.github.xinyuan4android.*
+io.github.xiongzhao1217.*
+io.github.xit0c.*
+io.github.xiyousoa.*
+io.github.xizixuejie.*
+io.github.xjinyao.*
+io.github.xjrga.*
+io.github.xjunz.*
+io.github.xlffm3.*
+io.github.xllyll.*
+io.github.xlopec.*
+io.github.xlukew.*
+io.github.xmaihh.*
+io.github.xmcamera.*
+io.github.xmcda-modular.*
+io.github.xmfuncoding.*
+io.github.xmljim.json.*
+io.github.xmljim.service.*
+io.github.xn32.*
+io.github.xoanpardo.*
+io.github.xopenapi.*
+io.github.xpc1024.*
+io.github.xrfzh.cn.*
+io.github.xronoshft.*
+io.github.xs-parser.*
+io.github.xshadov.*
+io.github.xsinh.*
+io.github.xslczx.*
+io.github.xstefanox.*
+io.github.xsyntos.*
+io.github.xtherk.*
+io.github.xtomlj.*
+io.github.xtyuns.*
+io.github.xuanyangyang.*
+io.github.xuefm.*
+io.github.xuehuiniaoyu.*
+io.github.xuelong1991.*
+io.github.xueqiya.*
+io.github.xuexixuexijpg.*
+io.github.xuhai19901018.*
+io.github.xujianfen.pram.*
+io.github.xulinglin.*
+io.github.xumig.*
+io.github.xuwulin.*
+io.github.xuyao5.*
+io.github.xuyong1211.*
+io.github.xuzhijvn.*
+io.github.xuzhiyong017.*
+io.github.xxfast.*
+io.github.xxl6097.*
+io.github.xxxspring.*
+io.github.xxyopen.*
+io.github.xydrolase.*
+io.github.xyz-jphil.checksum.*
+io.github.xyz-jphil.patterns.*
+io.github.xyznaveen.*
+io.github.xzxiaoshan.*
+io.github.ya-b.*
+io.github.ya-betmen.*
+io.github.yacyet.*
+io.github.yaforster.*
+io.github.yagato.*
+io.github.yahiaangelo.markdownedittext.*
+io.github.yahyatinani.y.*
+io.github.yakami129.*
+io.github.yakovsirotkin.*
+io.github.yaml-path.*
+io.github.yan42685.*
+io.github.yanayita.*
+io.github.yanbrandao.*
+io.github.yanfeiwuji.*
+io.github.yang-central.yangkit.*
+io.github.yang-pingo.*
+io.github.yangfjiahl.*
+io.github.yanggx98.totem.*
+io.github.yangkeith.*
+io.github.yangl.*
+io.github.yangqingyuan.*
+io.github.yangshuo.*
+io.github.yangsk94.*
+io.github.yangxlei.*
+io.github.yangyouwang.*
+io.github.yangzai.*
+io.github.yangziwen.*
+io.github.yanhu32.*
+io.github.yankeguo.*
+io.github.yanlizhe.*
+io.github.yanndroid.*
+io.github.yannick-cw.*
+io.github.yanshenwei.*
+io.github.yanxing.*
+io.github.yanyonghua.*
+io.github.yanzhan91.*
+io.github.yao-wenbin.*
+io.github.yaogyao.*
+io.github.yaoina.*
+io.github.yaoshining.*
+io.github.yaphet17.*
+io.github.yas99en.*
+io.github.yashchenkon.*
+io.github.yasiekz.*
+io.github.yawenok.*
+io.github.ycg000344.*
+io.github.ydkd.*
+io.github.ydmmocoo.*
+io.github.ydq.*
+io.github.ydstar.*
+io.github.ydxlt.*
+io.github.ye-yu.*
+io.github.ye17186.*
+io.github.yeagy.*
+io.github.yeamy.*
+io.github.yearnlune.excel.*
+io.github.yearnlune.search.*
+io.github.yearnlune.search.example.*
+io.github.yedaxia.*
+io.github.yeghishe.*
+io.github.yeh35.*
+io.github.yelongframework.*
+io.github.yeluod.*
+io.github.yemingfeng.*
+io.github.yeszj.*
+io.github.yevheniikollektor.*
+io.github.yeweicong.*
+io.github.yewin-mm.*
+io.github.yexf66.*
+io.github.yeyuexia.*
+io.github.yezhihao.*
+io.github.yfblock.*
+io.github.yfcyfc123234.*
+io.github.yfykisssky.*
+io.github.yg0585.*
+io.github.ygcy.*
+io.github.yggdrasil80.*
+io.github.yglcode.cdkutils.aspects.resourcerename.*
+io.github.yhsj.*
+io.github.yida-lxw.*
+io.github.yidasanqian.*
+io.github.yidiansishiyi.*
+io.github.yidun.*
+io.github.yilengyao.*
+io.github.ying1dudu.*
+io.github.yinjiangyue.*
+io.github.yinweichao.*
+io.github.yinzhidong.*
+io.github.yiurhub.*
+io.github.yizhiru.*
+io.github.yjiace.*
+io.github.yjouyang.*
+io.github.ykalay.*
+io.github.ykayacan.*
+io.github.ykrenz.*
+io.github.yl172326.*
+io.github.ylcto.*
+io.github.ylpanda.*
+io.github.ymaskin.*
+io.github.ymcsoft.*
+io.github.ymwangzq.*
+io.github.yniklas.*
+io.github.yoda31217.*
+io.github.yogboot.*
+io.github.yogonza524.*
+io.github.yoheimuta.*
+io.github.yollpoll.*
+io.github.yom667.*
+io.github.yongce.*
+io.github.yongzheng7.*
+io.github.yoshikawaa.gfw.*
+io.github.yoshikawaa.gfw.spring.boot.*
+io.github.yoshikawaa.modelmapper.spring.boot.*
+io.github.you-opensource.*
+io.github.youads-global.*
+io.github.youads-global.ironsource.*
+io.github.youkale.*
+io.github.youmesdk.*
+io.github.youmi-obg.*
+io.github.young-datafan.*
+io.github.young-flash.*
+io.github.youngtaekh.*
+io.github.youngwm.*
+io.github.youngxinler.*
+io.github.your-clock.*
+io.github.youth5201314.*
+io.github.youtiaoguagua.*
+io.github.yoyama.*
+io.github.ypdieguez.*
+io.github.yqdm.*
+io.github.yrichika.*
+io.github.yrjyrj123.*
+io.github.ys-kalyakin.*
+io.github.ysgatesdk.*
+io.github.yskszk63.*
+io.github.ysmc-slg.*
+io.github.ysomeone.*
+io.github.yst1011.*
+io.github.yu31.*
+io.github.yuanfen7650.*
+io.github.yuanfengshan.*
+io.github.yuange86.*
+io.github.yuanrui-mdt-info.*
+io.github.yuanruomu.*
+io.github.yuanweiquan-007.*
+io.github.yuanyang1991.*
+io.github.yubyf.*
+io.github.yubyf.datastorepreferences.*
+io.github.yubyf.maven-offline.*
+io.github.yubyf.mavenoffline.*
+io.github.yuegod.starter.swagger.*
+io.github.yueliangrensheng.*
+io.github.yuemenglong.*
+io.github.yuenwk.*
+io.github.yuexunshi.*
+io.github.yufeixuan.*
+io.github.yuitosato.*
+io.github.yukimatsumura.*
+io.github.yumimobi.*
+io.github.yunbamboos.*
+io.github.yunherry.*
+io.github.yunhorn.*
+io.github.yunjaena.*
+io.github.yunjeongbaek.*
+io.github.yunli45.*
+io.github.yunxiaosheng181219.*
+io.github.yupd.*
+io.github.yupengver.*
+io.github.yurikpanic.*
+io.github.yurimarx.*
+io.github.yuriykulikov.*
+io.github.yushan-yaojin.*
+io.github.yusufsdiscordbot.*
+io.github.yusufsdiscordbot.realyusufismailcore.*
+io.github.yusufyilmazfr.*
+io.github.yutwoking.*
+io.github.yuyuzha0.*
+io.github.yuzhiqiang1993.*
+io.github.yuzurihainori.*
+io.github.yvescheung.*
+io.github.yx91490.*
+io.github.yxyl6125.*
+io.github.yxylemon.*
+io.github.yydzxz.*
+io.github.yyfcode.*
+io.github.yyxxgame.sdk.*
+io.github.yyxxhh.*
+io.github.yyzsdk.*
+io.github.yzeit.*
+io.github.yzilla.*
+io.github.yziwang.*
+io.github.yzw20110902.*
+io.github.z-song.*
+io.github.z2058550226.*
+io.github.z3r0x24.*
+io.github.z4kn4fein.*
+io.github.zabuzard.closy.*
+io.github.zabuzard.fastcdc4j.*
+io.github.zabuzard.maglev.*
+io.github.zabuzard.prototojson.*
+io.github.zackcd.*
+io.github.zacker330.es.*
+io.github.zagori.*
+io.github.zahichemaly.*
+io.github.zakiis.*
+io.github.zakolenko.*
+io.github.zalldata.*
+io.github.zalvari.*
+io.github.zamblauskas.*
+io.github.zanella.nomad.*
+io.github.zangp.*
+io.github.zapproject.*
+io.github.zaragozamartin91.*
+io.github.zardoz89.*
+io.github.zauther.*
+io.github.zawn.*
+io.github.zawn.contexts.*
+io.github.zawn.retrofit2.*
+io.github.zaze359.*
+io.github.zbll-cuber.enchantsapi.*
+io.github.zbo1997.*
+io.github.zbr-001.*
+io.github.zbvs.*
+io.github.zcsdk.*
+io.github.zcys12173.*
+io.github.zdstly.*
+io.github.zeal18.*
+io.github.zebalu.*
+io.github.zebraofjustice.*
+io.github.zegolibrary.*
+io.github.zelechos.*
+io.github.zemiak.*
+io.github.zemise.*
+io.github.zengkeming.*
+io.github.zenith-rahim.*
+io.github.zenliucn.*
+io.github.zenliucn.domain.*
+io.github.zenliucn.java.*
+io.github.zenliucn.units.*
+io.github.zentol.flink.*
+io.github.zentol.japicmp.*
+io.github.zenwave360.*
+io.github.zenwave360.jhipster.*
+io.github.zenwave360.zenwave-code-generator.*
+io.github.zenwave360.zenwave-code-generator.plugins.*
+io.github.zenwave360.zenwave-sdk.*
+io.github.zenwave360.zenwave-sdk.plugins.*
+io.github.zeqky.*
+io.github.zequnchen.*
+io.github.zero-deps.*
+io.github.zero88.*
+io.github.zero88.msa.bp.*
+io.github.zero88.msa.bp.http.*
+io.github.zero88.msa.bp.micro.*
+io.github.zero88.qwe.*
+io.github.zerobyteword.*
+io.github.zeroone3010.*
+io.github.zerotale.*
+io.github.zerthick.*
+io.github.zezeg2.*
+io.github.zfwkadmin.*
+io.github.zghurskyi.kafka.*
+io.github.zglgithubx.*
+io.github.zguop.*
+io.github.zh-cn-trio.*
+io.github.zh-efimenko.telesender.*
+io.github.zh-or.*
+io.github.zhamghaoran.*
+io.github.zhangMr123456.*
+io.github.zhangbaogithub.*
+io.github.zhangbinhub.acp.boot.*
+io.github.zhangbinhub.acp.cloud.*
+io.github.zhangbinhub.acp.core.*
+io.github.zhangbinhub.acp.dependency.*
+io.github.zhangchaojiong.*
+io.github.zhangcm.*
+io.github.zhangethan.*
+io.github.zhangguangxuan.*
+io.github.zhanghao1125.*
+io.github.zhangliangbo.*
+io.github.zhangqinhao.*
+io.github.zhangshengshan.*
+io.github.zhangt2333.*
+io.github.zhangxin139.*
+io.github.zhangxinmin528.androidutils.*
+io.github.zhangxinmin528.chuck.*
+io.github.zhangxinmin528.zxing.*
+io.github.zhangyu836.*
+io.github.zhanleshun.*
+io.github.zhao458114067.*
+io.github.zhaochengbei.*
+io.github.zhaochengjun.*
+io.github.zhaofawu.*
+io.github.zhaohaoh.*
+io.github.zhaojc1221.*
+io.github.zhaojfGithub.SVGView.*
+io.github.zhaopa.*
+io.github.zhaord.*
+io.github.zhdotm.*
+io.github.zhengchalei.*
+io.github.zhengjh2018.*
+io.github.zhijinkeji.*
+io.github.zhinushannan.*
+io.github.zhiqiang-series.*
+io.github.zhiweicoding.*
+io.github.zho.*
+io.github.zhongchao08.*
+io.github.zhonghang1993.*
+io.github.zhonglunsheng.*
+io.github.zhongwm.*
+io.github.zhongwm.commons.*
+io.github.zhongzichang.*
+io.github.zhou-dong.*
+io.github.zhou-jun-jie.*
+io.github.zhouruil.workflow.*
+io.github.zhoushuai1119.*
+io.github.zhoushuofu.*
+io.github.zhtmf.*
+io.github.zhugefe.*
+io.github.zhuguohui.*
+io.github.zhukovaskychina.*
+io.github.zhul-cloud.*
+io.github.zhulongpeng.*
+io.github.zhusongling.*
+io.github.zhuyoubin.*
+io.github.zhuzl99.*
+io.github.zhx666666.*
+io.github.zicenter.*
+io.github.zicheng1992.*
+io.github.zicheng2019.*
+io.github.ziemowit.*
+io.github.ziliangyu.*
+io.github.zimu22.*
+io.github.zinebfadili.*
+io.github.zjblovewl.*
+io.github.zjie1595.*
+io.github.zjns.*
+io.github.zjns.redacted.*
+io.github.zjun02.*
+io.github.zkgroovy.*
+io.github.zkjg.*
+io.github.zkpursuit.*
+io.github.zlgspace.*
+io.github.zlika.*
+io.github.zlooo.fixyou.*
+io.github.znetworkw.znpcservers.*
+io.github.zon-g.*
+io.github.zongf0504.*
+io.github.zornx5.*
+io.github.zotornit.*
+io.github.zoujunjienb.*
+io.github.zouzhiy.*
+io.github.zoybean.*
+io.github.zpf9705.*
+io.github.zq2599.*
+io.github.zqiana.*
+io.github.zqrferrari.*
+io.github.zregvart.*
+io.github.zrq1060.*
+io.github.zrun1024.*
+io.github.zs1973.*
+io.github.zskamljic.*
+io.github.zsmarter-api.*
+io.github.zsqw123.*
+io.github.ztiany.*
+io.github.ztianz.uid.*
+io.github.ztind.*
+io.github.ztkmkoo.*
+io.github.ztnozdormu.*
+io.github.zty200329.*
+io.github.zulkar.*
+io.github.zumikua.*
+io.github.zuo-xie.*
+io.github.zwonb.*
+io.github.zxc578931016.*
+io.github.zxgangandy.*
+io.github.zxgangandy.rocketmq-wrapper.*
+io.github.zxyle.*
+io.github.zy654781296.*
+io.github.zyxdstu.*
+io.github.zzhhz.*
+io.github.zzlgo.*
+io.github.zzombiee.*
+io.github.zzw6776.*
+io.githunb.renxh4.*
+io.gitlab.*
+io.gitlab.3linepublic.*
+io.gitlab.adadapted.*
+io.gitlab.alexto9090.*
+io.gitlab.anhtd081095.*
+io.gitlab.arturbosch.detekt.*
+io.gitlab.c297131019.*
+io.gitlab.casperix.*
+io.gitlab.chaver.*
+io.gitlab.eacf2469.*
+io.gitlab.ekzeb1.*
+io.gitlab.embed-soft.*
+io.gitlab.frc3838.learning.*
+io.gitlab.friedrichlp.*
+io.gitlab.gitlab-cidk.*
+io.gitlab.gui-vista.*
+io.gitlab.hikariju.*
+io.gitlab.hohserg.elegant.networking.*
+io.gitlab.hsedjame.*
+io.gitlab.ikaros0503.*
+io.gitlab.imcasper.*
+io.gitlab.izabellamconigliaro.*
+io.gitlab.jaxsonp.openapi-publish.*
+io.gitlab.khoem.sombath.*
+io.gitlab.khoem.sombath.user-service.*
+io.gitlab.kineolyan.*
+io.gitlab.klawru.*
+io.gitlab.labaz.*
+io.gitlab.leewonjong29cm.*
+io.gitlab.leibnizhu.*
+io.gitlab.libscodefun.*
+io.gitlab.littlesaints.*
+io.gitlab.lotus4.*
+io.gitlab.marvin-haagen.*
+io.gitlab.mateuszjaje.*
+io.gitlab.mguimard.*
+io.gitlab.mhammons.*
+io.gitlab.monstm.*
+io.gitlab.motrack-org.*
+io.gitlab.mwldev.*
+io.gitlab.nalocal.*
+io.gitlab.nats.*
+io.gitlab.nexstream-android.*
+io.gitlab.not_a_number.maed.*
+io.gitlab.nrf110.*
+io.gitlab.openchvote.*
+io.gitlab.paa.coder.*
+io.gitlab.pixel-graphics.*
+io.gitlab.protobuf-tools.*
+io.gitlab.rudem.*
+io.gitlab.rujal_sh.*
+io.gitlab.rxp90.*
+io.gitlab.schedule4j.*
+io.gitlab.ssmodules.ads.*
+io.gitlab.strum-java.*
+io.gitlab.swapnilhuddar.*
+io.gitlab.swissclash79.*
+io.gitlab.syalioune.*
+io.gitlab.system-starter-httpclient.*
+io.gitlab.t.yaghoubi.*
+io.gitlab.txdocking.*
+io.gitlab.utils4java.*
+io.gitlab.vincent-lambert.*
+io.gitlab.wmwtr.*
+io.gitlab.xpauthentication.*
+io.gitlab.xpcommons.*
+io.gitlab.zxltongxue.*
+io.glassfy.*
+io.gleap.*
+io.glimr.geo.*
+io.glutamate.*
+io.glutenproject.*
+io.goatbytes.*
+io.goeasy.*
+io.goodforgod.*
+io.gopluslabs.*
+io.gorse.*
+io.goshawkdb.*
+io.graceland.*
+io.grafeas.*
+io.graphenee.*
+io.graphenee.blockchain.*
+io.graphenee.vaadin.flow.*
+io.graphgeeks.neo4j.*
+io.grasscutter.*
+io.gravitee.*
+io.gravitee.ae.*
+io.gravitee.alert.*
+io.gravitee.am.*
+io.gravitee.am.authdevice.notifier.*
+io.gravitee.am.botdetection.*
+io.gravitee.am.certificate.*
+io.gravitee.am.ciba.*
+io.gravitee.am.common.*
+io.gravitee.am.deviceidentifier.*
+io.gravitee.am.extensiongrant.*
+io.gravitee.am.factor.*
+io.gravitee.am.fapi.*
+io.gravitee.am.gateway.*
+io.gravitee.am.gateway.certificate.*
+io.gravitee.am.gateway.extensiongrant.*
+io.gravitee.am.gateway.handler.*
+io.gravitee.am.gateway.handlers.*
+io.gravitee.am.gateway.identityprovider.*
+io.gravitee.am.gateway.services.*
+io.gravitee.am.gateway.standalone.*
+io.gravitee.am.identityprovider.*
+io.gravitee.am.jwt.*
+io.gravitee.am.management.*
+io.gravitee.am.management.standalone.*
+io.gravitee.am.model.*
+io.gravitee.am.password.dictionary.*
+io.gravitee.am.plugins.handlers.*
+io.gravitee.am.policy.*
+io.gravitee.am.reporter.*
+io.gravitee.am.repository.*
+io.gravitee.am.resource.*
+io.gravitee.am.service.*
+io.gravitee.apim.*
+io.gravitee.apim.definition.*
+io.gravitee.apim.distribution.*
+io.gravitee.apim.gateway.*
+io.gravitee.apim.gateway.handlers.*
+io.gravitee.apim.gateway.security.*
+io.gravitee.apim.gateway.services.*
+io.gravitee.apim.gateway.standalone.*
+io.gravitee.apim.gateway.standalone.distribution.*
+io.gravitee.apim.plugin.*
+io.gravitee.apim.plugin.apiservice.*
+io.gravitee.apim.plugin.endpoint.*
+io.gravitee.apim.plugin.entrypoint.*
+io.gravitee.apim.plugin.reactor.*
+io.gravitee.apim.repository.*
+io.gravitee.apim.repository.gateway.bridge.http.*
+io.gravitee.apim.rest.api.*
+io.gravitee.apim.rest.api.idp.*
+io.gravitee.apim.rest.api.management.*
+io.gravitee.apim.rest.api.management.v2.*
+io.gravitee.apim.rest.api.portal.*
+io.gravitee.apim.rest.api.services.*
+io.gravitee.apim.rest.api.standalone.*
+io.gravitee.apim.rest.api.standalone.distribution.*
+io.gravitee.apim.ui.*
+io.gravitee.cockpit.*
+io.gravitee.common.*
+io.gravitee.connector.*
+io.gravitee.definition.*
+io.gravitee.discovery.*
+io.gravitee.el.*
+io.gravitee.elasticsearch.*
+io.gravitee.elasticsearch.ingest.plugin.*
+io.gravitee.fetcher.*
+io.gravitee.gateway.*
+io.gravitee.gateway.handlers.*
+io.gravitee.gateway.http.*
+io.gravitee.gateway.platforms.*
+io.gravitee.gateway.security.*
+io.gravitee.gateway.services.*
+io.gravitee.gateway.standalone.*
+io.gravitee.identityprovider.*
+io.gravitee.json.*
+io.gravitee.kubernetes.*
+io.gravitee.management.*
+io.gravitee.management.idp.*
+io.gravitee.management.providers.*
+io.gravitee.management.services.*
+io.gravitee.management.standalone.*
+io.gravitee.maven.archetypes.*
+io.gravitee.maven.plugins.*
+io.gravitee.node.*
+io.gravitee.node.services.*
+io.gravitee.notifier.*
+io.gravitee.oauth2.server.*
+io.gravitee.platform.*
+io.gravitee.plugin.*
+io.gravitee.policy.*
+io.gravitee.policy.apikey.*
+io.gravitee.policy.cors.*
+io.gravitee.policy.ratelimit.*
+io.gravitee.portal.*
+io.gravitee.reporter.*
+io.gravitee.repository.*
+io.gravitee.resource.*
+io.gravitee.rest.api.*
+io.gravitee.rest.api.idp.*
+io.gravitee.rest.api.management.*
+io.gravitee.rest.api.management.standalone.*
+io.gravitee.rest.api.management.standalone.distribution.*
+io.gravitee.rest.api.portal.*
+io.gravitee.rest.api.portal.standalone.*
+io.gravitee.rest.api.portal.standalone.distribution.*
+io.gravitee.rest.api.services.*
+io.gravitee.rest.api.standalone.*
+io.gravitee.rest.api.standalone.distribution.*
+io.gravitee.risk.assessment.api.*
+io.gravitee.sample.api.*
+io.gravitee.service.*
+io.gravitee.standalone.*
+io.gravitee.test.*
+io.gravitee.tracer.*
+io.gravitee.tracing.*
+io.greptime.*
+io.gridgo.*
+io.grisu.*
+io.groobee.message.*
+io.growing.*
+io.growing.data.protocol.*
+io.growing.data.utils.connector.*
+io.growing.sdk.java.*
+io.growing.sdk.openapi.*
+io.growthbook.sdk.*
+io.grpc.*
+io.gs2.*
+io.gsonfire.*
+io.guara.*
+io.guise.*
+io.gumga.*
+io.gupshup.developer.*
+io.gupshup.maven.*
+io.guthix.*
+io.guthix.oldscape.*
+io.h8.*
+io.h8.borscht.*
+io.hackerbay.fyipe.*
+io.hackie.*
+io.hackle.*
+io.halahutskyi.telegrambot4s.*
+io.hanko.*
+io.happyharbor.*
+io.harness.*
+io.hauer.*
+io.hauer.mojo.*
+io.havah.*
+io.hawkei.*
+io.hawt.*
+io.hawt.dockerui.*
+io.hawt.eshead.*
+io.hawt.example.services.*
+io.hawt.examples.*
+io.hawt.kibana.*
+io.hawt.swagger.*
+io.hawt.tests.*
+io.hcxprotocol.*
+io.hdocdb.*
+io.heap.autocapture.*
+io.heap.core.*
+io.heap.gradle.*
+io.heartpattern.springfox.*
+io.hekate.*
+io.hektor.*
+io.helidon.*
+io.helidon.applications.*
+io.helidon.archetypes.*
+io.helidon.build-tools.*
+io.helidon.build-tools.archetype.*
+io.helidon.build-tools.cli.*
+io.helidon.build-tools.cli.tests.*
+io.helidon.build-tools.common.*
+io.helidon.build-tools.devloop.*
+io.helidon.builder.*
+io.helidon.bundles.*
+io.helidon.common.*
+io.helidon.common.features.*
+io.helidon.common.processor.*
+io.helidon.common.testing.*
+io.helidon.config.*
+io.helidon.cors.*
+io.helidon.dbclient.*
+io.helidon.examples.*
+io.helidon.fault-tolerance.*
+io.helidon.graphql.*
+io.helidon.grpc.*
+io.helidon.health.*
+io.helidon.inject.*
+io.helidon.inject.configdriven.*
+io.helidon.integrations.*
+io.helidon.integrations.cdi.*
+io.helidon.integrations.common.*
+io.helidon.integrations.db.*
+io.helidon.integrations.graal.*
+io.helidon.integrations.jdbc.*
+io.helidon.integrations.jta.*
+io.helidon.integrations.micrometer.*
+io.helidon.integrations.micronaut.*
+io.helidon.integrations.microstream.*
+io.helidon.integrations.neo4j.*
+io.helidon.integrations.oci.*
+io.helidon.integrations.oci.metrics.*
+io.helidon.integrations.oci.sdk.*
+io.helidon.integrations.openapi-ui.*
+io.helidon.integrations.vault.*
+io.helidon.integrations.vault.auths.*
+io.helidon.integrations.vault.secrets.*
+io.helidon.integrations.vault.sys.*
+io.helidon.jersey.*
+io.helidon.licensing.*
+io.helidon.logging.*
+io.helidon.lra.*
+io.helidon.media.*
+io.helidon.media.jackson.*
+io.helidon.media.jsonb.*
+io.helidon.media.jsonp.*
+io.helidon.messaging.*
+io.helidon.messaging.aq.*
+io.helidon.messaging.connectors.*
+io.helidon.messaging.connectors.kafka.*
+io.helidon.messaging.jms.*
+io.helidon.messaging.kafka.*
+io.helidon.messaging.mock.*
+io.helidon.messaging.wls-jms.*
+io.helidon.metrics.*
+io.helidon.microprofile.*
+io.helidon.microprofile.bean-validation.*
+io.helidon.microprofile.bundles.*
+io.helidon.microprofile.cdi.*
+io.helidon.microprofile.config.*
+io.helidon.microprofile.graphql.*
+io.helidon.microprofile.grpc.*
+io.helidon.microprofile.health.*
+io.helidon.microprofile.jwt.*
+io.helidon.microprofile.lra.*
+io.helidon.microprofile.messaging.*
+io.helidon.microprofile.metrics.*
+io.helidon.microprofile.openapi.*
+io.helidon.microprofile.reactive-streams.*
+io.helidon.microprofile.rest-client.*
+io.helidon.microprofile.scheduling.*
+io.helidon.microprofile.server.*
+io.helidon.microprofile.service-common.*
+io.helidon.microprofile.telemetry.*
+io.helidon.microprofile.tests.*
+io.helidon.microprofile.tracing.*
+io.helidon.microprofile.websocket.*
+io.helidon.microprofile.weld.*
+io.helidon.nima.*
+io.helidon.nima.common.*
+io.helidon.nima.fault-tolerance.*
+io.helidon.nima.graphql.*
+io.helidon.nima.grpc.*
+io.helidon.nima.http.*
+io.helidon.nima.http.encoding.*
+io.helidon.nima.http.media.*
+io.helidon.nima.http2.*
+io.helidon.nima.observe.*
+io.helidon.nima.openapi.*
+io.helidon.nima.service-common.*
+io.helidon.nima.sse.*
+io.helidon.nima.testing.*
+io.helidon.nima.testing.junit5.*
+io.helidon.nima.webclient.*
+io.helidon.nima.webserver.*
+io.helidon.nima.websocket.*
+io.helidon.openapi.*
+io.helidon.pico.*
+io.helidon.pico.builder.config.*
+io.helidon.pico.configdriven.*
+io.helidon.reactive.*
+io.helidon.reactive.dbclient.*
+io.helidon.reactive.fault-tolerance.*
+io.helidon.reactive.graphql.*
+io.helidon.reactive.health.*
+io.helidon.reactive.media.*
+io.helidon.reactive.metrics.*
+io.helidon.reactive.openapi.*
+io.helidon.reactive.service-common.*
+io.helidon.reactive.webclient.*
+io.helidon.reactive.webserver.*
+io.helidon.reactive.webserver.transport.*
+io.helidon.reactive.webserver.transport.netty.*
+io.helidon.scheduling.*
+io.helidon.security.*
+io.helidon.security.abac.*
+io.helidon.security.integration.*
+io.helidon.security.providers.*
+io.helidon.service-common.*
+io.helidon.serviceconfiguration.*
+io.helidon.tracing.*
+io.helidon.webclient.*
+io.helidon.webserver.*
+io.helidon.webserver.transport.*
+io.helidon.webserver.transport.netty.*
+io.helins.*
+io.helixservice.*
+io.hentitydb.*
+io.heraldprox.*
+io.heretical.*
+io.herrera.kevin.*
+io.hetu.*
+io.hetu.core.*
+io.hexhacking.*
+io.hgc.*
+io.hgraphdb.*
+io.higgs.*
+io.higherkindness.*
+io.higherstate.*
+io.highlight.*
+io.hippochat.*
+io.hireproof.*
+io.hkhc.*
+io.hkhc.ccc.*
+io.hkhc.gradle.*
+io.hkhc.jarbird-android.*
+io.hkhc.jarbird.*
+io.hkhc.log.*
+io.hkube.*
+io.hndrs.*
+io.hndrs.slack.*
+io.holixon.*
+io.holixon.avro.*
+io.holixon.avro._.*
+io.holixon.avro.maven.*
+io.holixon.axon.*
+io.holixon.axon.avro.*
+io.holixon.axon.avro._.*
+io.holixon.axon.avro.lib.*
+io.holixon.axon.gateway.*
+io.holixon.axon.testing.*
+io.holixon.axon.testing._.*
+io.holunda.*
+io.holunda.camunda-api.*
+io.holunda.commons.*
+io.holunda.connector.*
+io.holunda.data.*
+io.holunda.decision.*
+io.holunda.decision._.*
+io.holunda.decision.lib.*
+io.holunda.deployment.*
+io.holunda.polyflow.*
+io.holunda.taskpool.*
+io.holunda.testing.*
+io.homunculus.*
+io.honeybadger.*
+io.honeycomb.*
+io.honeycomb.beeline.*
+io.honeycomb.libhoney.*
+io.honeycomb.opentelemetry.*
+io.honnix.*
+io.hoplin.*
+io.hops.*
+io.horizen.*
+io.hosuaby.*
+io.hotmoka.*
+io.hotmoka.chat.*
+io.hotmoka.websockets.*
+io.hpb.web3.*
+io.hschwentner.dddbits.*
+io.hstream.*
+io.humble.*
+io.hydrosphere.*
+io.hydrosphere.mist.*
+io.hyperfoil.*
+io.hyperfoil.tools.*
+io.hypersistence.*
+io.hypertrack.*
+io.hyphenate.*
+io.hypi.*
+io.hypi.ignite.backup.*
+io.hyscale.*
+io.hyte.activemq.*
+io.hyte.platform.*
+io.hyte.runtime.*
+io.hyte.stompjms.*
+io.i-t.*
+io.iamcyw.tower.*
+io.ianferguson.*
+io.ib67.astralflow.*
+io.ib67.kiwi.*
+io.ib67.linguee.*
+io.ib67.trans.*
+io.ibrett.example.*
+io.iceflower.*
+io.ichor.*
+io.iconator.*
+io.identifiers.*
+io.idml.*
+io.ifar.datadog.metrics.*
+io.ifar.dw-goodies.*
+io.ifar.dw-shiro-bundle.*
+io.ifar.kafka-archiver.*
+io.ifar.kafkalog.*
+io.ifar.shiro-jdbi-realm.*
+io.ifar.skid-road.*
+io.igia.*
+io.igia.i2b2.cdi.app.*
+io.igia.i2b2.cdi.common.*
+io.igia.i2b2.cdi.conceptimport.*
+io.igia.i2b2.cdi.dataimport.*
+io.igl.*
+io.igu.*
+io.ikrelln.*
+io.iktech.*
+io.imagineobjects.web.*
+io.imast.*
+io.immutables.*
+io.imoji.sdk.*
+io.imply.*
+io.improbable.*
+io.imqa.*
+io.imunity.*
+io.imunity.furms.*
+io.imunity.samly.*
+io.imunity.simplecaptcha.*
+io.inad.sdk.*
+io.inai.payments.*
+io.inappchat.*
+io.inbot.*
+io.indico.*
+io.indigoengine.*
+io.induct.*
+io.induct.bricks.*
+io.induct.daniel.*
+io.induct.http.*
+io.infinicast.*
+io.infinitic.*
+io.ingenieux.*
+io.ingenieux.lambada.*
+io.inisos.bank4j.*
+io.inkstand.*
+io.innerloop.*
+io.ino.*
+io.inscopemetrics.build.*
+io.inscopemetrics.client.*
+io.inscopemetrics.kairosdb.*
+io.insert-koin.*
+io.insource.*
+io.instacount.*
+io.integon.*
+io.integon.wso2mi.jwt.*
+io.integon.wso2mi.xfcc.*
+io.interact.*
+io.intercom.*
+io.intercom.android.*
+io.interface21.*
+io.intrepid.commonutils.*
+io.inugami.*
+io.inugami.data.*
+io.inugami.maven.plugin.*
+io.inugami.maven.plugin.analysis.*
+io.inugami.maven.plugin.analysis.front.*
+io.inugami.maven.plugin.lifecycle.*
+io.inugami.maven.superpom.*
+io.inugami.monitoring.*
+io.inugami.monitoring.distributions.*
+io.inugami.monitoring.providers.*
+io.inugami.monitoring.sensors.*
+io.inugami.plugins.*
+io.inugami.security.*
+io.inverno.*
+io.inverno.dist.*
+io.inverno.mod.*
+io.inverno.tool.*
+io.inversion.*
+io.ioevent.*
+io.iohk.*
+io.iohk.atala.*
+io.ionic.*
+io.iotchain.*
+io.ipfinder.api.*
+io.ipgeolocation.*
+io.ipinfo.*
+io.ipsq.*
+io.iron.ironmq.*
+io.iron.ironworker.*
+io.irontest.*
+io.islandtime.*
+io.isomarcte.*
+io.itculate.sdk.*
+io.itdraft.gwt.*
+io.iteratee.*
+io.iteratorx.*
+io.itpl.*
+io.iworkflow.*
+io.jackbradshaw.*
+io.jaconi.*
+io.jactl.*
+io.jaegertracing.*
+io.jafka.*
+io.jahed.*
+io.janstenpickle.*
+io.janusproject.*
+io.janusproject.guava.*
+io.janusproject.sre.*
+io.janusproject.v1.*
+io.janusproject.v1.extras.*
+io.janusproject.v1.extras.modules.*
+io.janusproject.v1.extras.modules.aclengine.*
+io.janusproject.v1.extras.modules.bdiengine.*
+io.janusproject.v1.extras.modules.ecoresolution.*
+io.janusproject.v1.extras.modules.jaak.*
+io.janusproject.v1.extras.modules.scriptedagent.*
+io.janusproject.v1.kernel.*
+io.janusproject.v1.kernel.network.*
+io.japi.*
+io.jart.*
+io.jasonatwood.*
+io.jasonleehodges.*
+io.javaalmanac.*
+io.javadog.*
+io.javalin.*
+io.javalin.community.openapi.*
+io.javalin.community.routing.*
+io.javalin.community.ssl.*
+io.javalin.community.vite.*
+io.javaninja.ajeet.*
+io.javaoperatorsdk.*
+io.javaoperatorsdk.admissioncontroller.sample.*
+io.javaoperatorsdk.webhook.sample.*
+io.javaru.iip.common.*
+io.javaslang.*
+io.jawg.geojson.*
+io.jboot.*
+io.jbotsim.*
+io.jcoder.odin.*
+io.jddf.gson.*
+io.jdev.address.*
+io.jdev.cucumber.*
+io.jdev.geb.*
+io.jdev.html2js.*
+io.jdev.miniprofiler.*
+io.jdev.pdf.*
+io.jee.alaska.*
+io.jellycat.plugins.*
+io.jenetics.*
+io.jengapgw.*
+io.jengapgw.prod.*
+io.jenkins-x.client.*
+io.jenkins-x.samples.spring.petclinic.*
+io.jenkins.archetypes.*
+io.jenkins.tools.*
+io.jenkins.tools.incrementals.*
+io.jenkins.updatebot.*
+io.jenner.*
+io.jentz.winter.*
+io.jeo.*
+io.jersey-wiremock.*
+io.jexxa.*
+io.jexxa.addend.*
+io.jexxa.addendj.*
+io.jexxa.jexxatest.*
+io.jexxa.test.*
+io.jhdf.*
+io.jitstatic.*
+io.jmad.*
+io.jmnarloch.*
+io.jobial.*
+io.joergi.*
+io.joern.*
+io.john-amiscaray.stir.*
+io.johnmurray.*
+io.johnnystarr.*
+io.johnsonlee.*
+io.johnsonlee.booster.*
+io.johnsonlee.buildprops.*
+io.johnsonlee.codegen.*
+io.johnsonlee.gradle.*
+io.johnsonlee.initializr.*
+io.johnsonlee.lambda.*
+io.johnsonlee.layoutlib.*
+io.johnsonlee.sonatype-publish-plugin.*
+io.johnsonlee.spi.*
+io.johnsonlee.tracing.*
+io.johnsonlee.translate.*
+io.johnsonlee.uxu.*
+io.joj.*
+io.jooby.*
+io.jorand.*
+io.joshworks.*
+io.joshworks.extensions.*
+io.joshworks.snappy.*
+io.joshworks.stream.*
+io.joshworks.unirest.*
+io.journalkeeper.*
+io.journify.analytics.kotlin.*
+io.joynr.*
+io.joynr.android.*
+io.joynr.android.common.*
+io.joynr.android.core.*
+io.joynr.android.messaging.*
+io.joynr.android.messaging.mqtt.*
+io.joynr.android.messaging.websocket.*
+io.joynr.cpp.*
+io.joynr.examples.*
+io.joynr.examples.radio-jee.*
+io.joynr.java.*
+io.joynr.java.android.*
+io.joynr.java.backend-services.*
+io.joynr.java.common.*
+io.joynr.java.core.*
+io.joynr.java.messaging.*
+io.joynr.java.messaging.bounceproxy.*
+io.joynr.java.messaging.bounceproxy.bounceproxy-controller-persistence.*
+io.joynr.java.messaging.mqtt.*
+io.joynr.java.messaging.websocket.*
+io.joynr.javascript.*
+io.joynr.javascript.apps.*
+io.joynr.javascript.inter-tab.*
+io.joynr.mqtt.*
+io.joynr.performance.*
+io.joynr.performance.performance-test-jee.*
+io.joynr.smrf.*
+io.joynr.smrf.java.*
+io.joynr.smrf.tests.*
+io.joynr.tests.*
+io.joynr.tests.system-integration-test.*
+io.joynr.tools.*
+io.joynr.tools.generator.*
+io.joyrpc.*
+io.jpom.*
+io.jpom.jpom-plugin.*
+io.jpom.plugins.*
+io.jpower.kcp.*
+io.jrevolt.launcher.*
+io.jschneider.*
+io.jshift.*
+io.jsonbox.*
+io.jsondb.*
+io.jsonwebtoken.*
+io.jsonwebtoken.coveralls.*
+io.jstach.*
+io.jstach.pistachio.*
+io.jstack.*
+io.jstate.*
+io.jug6ernaut.*
+io.juicefs.*
+io.jumpco.open.*
+io.justcount.*
+io.justdevit.libs.*
+io.justdevit.math.*
+io.justdevit.spring.*
+io.justrudd.*
+io.justrudd.datasources.*
+io.justrudd.leveled.*
+io.jvelo.*
+io.jvm.*
+io.jvm.uuid.*
+io.jvoid.*
+io.k-libs.*
+io.k2pool.*
+io.kabanero.*
+io.kagera.*
+io.kaitai.*
+io.kaizen-solutions.*
+io.kakai.*
+io.kalix.*
+io.kamino.*
+io.kamon.*
+io.kanaka.*
+io.kandula.*
+io.kanuka.*
+io.kareldb.*
+io.karim.*
+io.karte.android.*
+io.katharsis.*
+io.kazuhito.*
+io.kazuki.*
+io.kcache.*
+io.keen.*
+io.kemtoa.*
+io.kemtoa.swagger.*
+io.keploy.*
+io.kermoss.*
+io.kestra.*
+io.kestra.plugin.*
+io.kestra.storage.*
+io.kestros.cms.*
+io.kestros.cms.archetypes.*
+io.kestros.commons.*
+io.kevinlee.*
+io.keyko.*
+io.keyko.monitoring.*
+io.keyko.monitoring.agent.*
+io.keyko.nevermind.*
+io.keyko.nevermined.*
+io.keyko.ocean.keeper.*
+io.kform.*
+io.kgraph.*
+io.kickflip.*
+io.kidder.*
+io.kindedj.*
+io.kinoplan.*
+io.kipe.*
+io.kiw.*
+io.kjson.*
+io.kleisli.*
+io.klerch.*
+io.klib.tools.*
+io.klogging.*
+io.kmachine.*
+io.knotx.*
+io.knotx.acme.*
+io.knotx.archetypes.*
+io.knotx.codegen-test.*
+io.knotx.codegen.*
+io.knotx.composite-build-support.*
+io.knotx.distribution.*
+io.knotx.jacoco.*
+io.knotx.java-library.*
+io.knotx.maven-publish.*
+io.knotx.publish-all-composite.*
+io.knotx.release-base.*
+io.knotx.release-java.*
+io.knotx.unit-test.*
+io.knowledgelinks.cicd.*
+io.koalaql.*
+io.koara.*
+io.kobza.android.*
+io.kodif.android.*
+io.kodokojo.*
+io.kokuwa.*
+io.kokuwa.edge.*
+io.kokuwa.keycloak.*
+io.kokuwa.maven.*
+io.kokuwa.micronaut.*
+io.kokuwa.test.*
+io.konform.*
+io.konga.*
+io.konig.*
+io.konik.*
+io.kontainers.*
+io.kontakt.mvn.*
+io.konverge.*
+io.koople.*
+io.koosha.konfigurations.*
+io.koosha.nettyfunctional.*
+io.korandoru.hawkeye.*
+io.kornatowicz.*
+io.kotest.*
+io.kotest.extensions.*
+io.kotlintest.*
+io.kowalski.*
+io.kpeg.*
+io.kraken.client.*
+io.krakens.*
+io.kream.*
+io.krom.*
+io.kronor.*
+io.kronor.component.*
+io.kroxylicious.*
+io.kroxylicious.testing.*
+io.ks3.*
+io.ksmt.*
+io.kstore.*
+io.ktgp.*
+io.ktor.*
+io.kubemq.sdk.*
+io.kuberig.*
+io.kuberig.dsl.generator.*
+io.kubernetes.*
+io.kungfury.*
+io.kurtz.*
+io.kusanagi.*
+io.kuzzle.*
+io.kvh.*
+io.kvision.*
+io.kvstore.*
+io.kweb.*
+io.kwy.boot.*
+io.lacuna.*
+io.lakefs.*
+io.lambdacube.aspecio.*
+io.lambdacube.bnd.*
+io.lambdacube.component.annotation.*
+io.lambdaworks.*
+io.laminext.*
+io.lamma.*
+io.lanau.framework.modules.backend.aspect.*
+io.lanau.framework.modules.backend.batch.*
+io.lanau.framework.modules.backend.cache.*
+io.lanau.framework.modules.backend.core.*
+io.lanau.framework.modules.backend.messaging.*
+io.lanau.framework.modules.backend.persistence.*
+io.lanau.framework.modules.backend.reporting.*
+io.lanau.framework.modules.backend.ws.*
+io.lanau.framework.poms.*
+io.lanau.framework.tools.eclipselinkstaticweavemavenplugin.*
+io.landzcape.*
+io.laniakia.*
+io.laserdisc.*
+io.latent.*
+io.lavagna.*
+io.lbry.*
+io.leangen.geantyref.*
+io.leangen.graphql.*
+io.leego.*
+io.legaldocml.*
+io.legere.*
+io.legs.*
+io.lemonlabs.*
+io.lenar.*
+io.lenses.*
+io.leon.*
+io.leonard.*
+io.leonard.maven.plugins.*
+io.leonis.*
+io.leopard.*
+io.leopard.archetype.*
+io.leopard.boot.*
+io.leopard.burrow.*
+io.leopard.depend.*
+io.leopard.maven.plugins.*
+io.leopard.thirdparty.*
+io.leopard.top4j.*
+io.leopard.topnb.*
+io.leoplatform.*
+io.lettuce.*
+io.liberalize.*
+io.libraft.*
+io.liftoff.*
+io.liftwizard.*
+io.lightlink.*
+io.lightweightform.*
+io.lighty.applications.*
+io.lighty.applications.rcgnmi.*
+io.lighty.applications.rnc.*
+io.lighty.core.*
+io.lighty.models.*
+io.lighty.models.gnmi.*
+io.lighty.models.test.*
+io.lighty.modules.*
+io.lighty.modules.gnmi.*
+io.lighty.modules.gnmi.southbound.*
+io.lighty.resources.*
+io.limberest.*
+io.lindb.*
+io.lindstrom.*
+io.linguarobot.*
+io.lionweb.lioncore-java.*
+io.lippia.*
+io.lippia.archetypes.*
+io.lippia.report.*
+io.liquer.pencil.*
+io.litego.*
+io.litterat.*
+io.littlehorse.*
+io.livekit.*
+io.liveqa.*
+io.lktk.*
+io.localizable.*
+io.lockstep.*
+io.loefflefarn.*
+io.loefflefarn.battlenet.*
+io.loefflefarn.battlenet.client.*
+io.loefflefarn.bnet.*
+io.logicdrop.sparks.*
+io.logpush.*
+io.logspace.*
+io.logto.sdk.*
+io.logz.*
+io.logz.log4j.*
+io.logz.log4j2.*
+io.logz.logback.*
+io.logz.micrometer.*
+io.logz.sawmill.*
+io.logz.sender.*
+io.loli.*
+io.loli.nekocat.*
+io.loli.social.*
+io.loli.storage.*
+io.loli.util.*
+io.loli.zto.*
+io.looployalty.android.*
+io.lqd.*
+io.lsn.*
+io.lsn.java.*
+io.lsn.spring.*
+io.luchta.*
+io.lumify.*
+io.lumigo.*
+io.lunamc.*
+io.lytrax.*
+io.macgyver.*
+io.macgyver.jmespath4j.*
+io.macgyver.neorx.*
+io.macgyver.okrest.*
+io.macgyver.okrest3.*
+io.macgyver.rx-aws.*
+io.macgyver.tomlson.*
+io.machinecode.*
+io.machinecode.then.*
+io.machinecode.vial.*
+io.macronova.kafka.*
+io.maelstorm.*
+io.magentys.*
+io.magics.viewmagics.*
+io.magicthegathering.*
+io.magidc.*
+io.magj.*
+io.magus.methodmap.*
+io.mail7.sdk.*
+io.mailguru.*
+io.mailguru.gradle-config.*
+io.makepad.*
+io.makepad.socialwalker.*
+io.malcolmgreaves.*
+io.manbang.*
+io.mangoo.*
+io.mantisrx.*
+io.manycore.maven.*
+io.mappum.*
+io.mapsmessaging.*
+io.marauder.charger.*
+io.marauder.supercharger.*
+io.marioslab.basis.*
+io.markdom.*
+io.marto.aem.*
+io.marto.aem.vassets.*
+io.marto.sling.*
+io.maryk.lz4.*
+io.maryk.rocksdb.*
+io.mashona.*
+io.matchedup.*
+io.mateo.*
+io.mateo.cxf-codegen.*
+io.mateo.spring.*
+io.mateu.*
+io.mateu.archetypes.*
+io.mateu.jpa-utils.*
+io.mateu.ui.mdd.archetypes.*
+io.mathan.maven.*
+io.mathan.raml.*
+io.mathan.sonar.*
+io.mats3.*
+io.mats3.examples.*
+io.mats3.matsbrokermonitor.*
+io.mats3.matssocket.*
+io.matthewbradshaw.*
+io.matthewnelson.*
+io.matthewnelson.components.*
+io.matthewnelson.encoding.*
+io.matthewnelson.encrypted-storage.*
+io.matthewnelson.kmp.configuration.*
+io.matthewnelson.kotlin-components.*
+io.matthewnelson.pin-authentication.*
+io.matthewnelson.topl-android.*
+io.mattroberts.*
+io.mavsdk.*
+io.maxthomas.*
+io.mazenmc.*
+io.mazenmc.minecloud.*
+io.mcarle.*
+io.mdsl.*
+io.meat.*
+io.mediachain.*
+io.medialog.*
+io.megl.*
+io.mehow.hyperion.*
+io.mehow.laboratory.*
+io.mehow.ruler.*
+io.mehow.squashit.*
+io.mehow.threetenbp.*
+io.meikle.maven.okapi.*
+io.meles.testing.*
+io.memoria.*
+io.memoria.jutils.*
+io.meshware.*
+io.meshware.cache.*
+io.metaloom.*
+io.metaloom.jdlib.*
+io.metaloom.maven.*
+io.metaloom.qdrant.*
+io.metaloom.quadtree.*
+io.metaloom.test.*
+io.metaloom.utils.*
+io.metaloom.vertx.*
+io.metaloom.video.*
+io.metarouter.analytics.*
+io.metersphere.*
+io.methvin.*
+io.methvin.autodelegate.*
+io.methvin.fastforward.*
+io.methvin.play.*
+io.methvin.standardmethods.*
+io.mfj.*
+io.mhssn.*
+io.michaelrocks.*
+io.michaelrocks.bimap.*
+io.michaelrocks.pablo.*
+io.micrc.core.*
+io.microcms.*
+io.microconfig.*
+io.microlam.*
+io.micrometer.*
+io.micrometer.prometheus.*
+io.micronaut.*
+io.micronaut.acme.*
+io.micronaut.aot.*
+io.micronaut.aws.*
+io.micronaut.azure.*
+io.micronaut.beanvalidation.*
+io.micronaut.build.*
+io.micronaut.build.internal.*
+io.micronaut.build.internal.aot-module.*
+io.micronaut.build.internal.base-module.*
+io.micronaut.build.internal.base.*
+io.micronaut.build.internal.binary-compatibility-check.*
+io.micronaut.build.internal.bom-checker.*
+io.micronaut.build.internal.bom.*
+io.micronaut.build.internal.common.*
+io.micronaut.build.internal.dependency-updates.*
+io.micronaut.build.internal.docs.*
+io.micronaut.build.internal.gradle-enterprise.*
+io.micronaut.build.internal.module.*
+io.micronaut.build.internal.publishing.*
+io.micronaut.build.internal.quality-checks.*
+io.micronaut.build.internal.quality-reporting.*
+io.micronaut.build.internal.version-catalog-updates.*
+io.micronaut.build.shared.settings.*
+io.micronaut.cache.*
+io.micronaut.cassandra.*
+io.micronaut.chatbots.*
+io.micronaut.coherence.*
+io.micronaut.configuration.*
+io.micronaut.controlpanel.*
+io.micronaut.crac.*
+io.micronaut.data.*
+io.micronaut.discovery.*
+io.micronaut.docs.*
+io.micronaut.elasticsearch.*
+io.micronaut.email.*
+io.micronaut.example.*
+io.micronaut.flyway.*
+io.micronaut.gcp.*
+io.micronaut.graphql.*
+io.micronaut.groovy.*
+io.micronaut.grpc.*
+io.micronaut.ignite.*
+io.micronaut.jaxrs.*
+io.micronaut.jms.*
+io.micronaut.jmx.*
+io.micronaut.kafka.*
+io.micronaut.kotlin.*
+io.micronaut.kubernetes.*
+io.micronaut.liquibase.*
+io.micronaut.logging.*
+io.micronaut.maven.*
+io.micronaut.micrometer.*
+io.micronaut.microstream.*
+io.micronaut.mongodb.*
+io.micronaut.mqtt.*
+io.micronaut.multitenancy.*
+io.micronaut.nats.*
+io.micronaut.neo4j.*
+io.micronaut.netflix.*
+io.micronaut.objectstorage.*
+io.micronaut.oci.*
+io.micronaut.openapi.*
+io.micronaut.oraclecloud.*
+io.micronaut.picocli.*
+io.micronaut.platform.*
+io.micronaut.problem.*
+io.micronaut.pulsar.*
+io.micronaut.r2dbc.*
+io.micronaut.rabbitmq.*
+io.micronaut.reactor.*
+io.micronaut.redis.*
+io.micronaut.rss.*
+io.micronaut.rxjava1.*
+io.micronaut.rxjava2.*
+io.micronaut.rxjava3.*
+io.micronaut.security.*
+io.micronaut.serde.*
+io.micronaut.servlet.*
+io.micronaut.session.*
+io.micronaut.spring.*
+io.micronaut.sql.*
+io.micronaut.starter.*
+io.micronaut.test.*
+io.micronaut.testresources.*
+io.micronaut.toml.*
+io.micronaut.tracing.*
+io.micronaut.validation.*
+io.micronaut.views.*
+io.micronaut.xml.*
+io.micronaut.xxx.*
+io.microprofile.*
+io.microraft.*
+io.microservices.tools.canvas.*
+io.mikael.*
+io.mikesir87.*
+io.mikesir87.javacors.*
+io.milton.*
+io.milvus.*
+io.mindfulmachines.*
+io.mindmaps.*
+io.mingbo.mcs.*
+io.mingbo.uas.*
+io.minio.*
+io.minutelab.*
+io.miragon.bpmrepo.citest.*
+io.miragon.digiwf.*
+io.miragon.miranum.*
+io.miscellanea.etcd.*
+io.mishustin.*
+io.misterspex.*
+io.mixrad.*
+io.moatwel.crypto.*
+io.mobilitydata.transit.*
+io.mock-box.*
+io.mockative.*
+io.mockk.*
+io.moderne.*
+io.mogdb.*
+io.moia.*
+io.mokamint.*
+io.mola.galimatias.*
+io.molr.*
+io.monadasync.*
+io.monadless.*
+io.monalabs.client.*
+io.monaru.*
+io.mongock.*
+io.mongock.professional.*
+io.monix.*
+io.monkeypatch.kaval.*
+io.moonsense.*
+io.moorse.*
+io.moquette.*
+io.morethan.daggerdoc.*
+io.mosip.*
+io.mosip.admin.*
+io.mosip.authentication.*
+io.mosip.biometric.util.*
+io.mosip.biosdk.*
+io.mosip.cacheprovider.*
+io.mosip.commons.*
+io.mosip.datashare.*
+io.mosip.demosdk.*
+io.mosip.esignet.*
+io.mosip.esignet.mock.*
+io.mosip.hotlist.*
+io.mosip.idp.*
+io.mosip.idrepository.*
+io.mosip.kernel.*
+io.mosip.mock.mds.*
+io.mosip.mock.mv.*
+io.mosip.mock.sdk.*
+io.mosip.pmp.*
+io.mosip.pms.*
+io.mosip.preregistration.*
+io.mosip.preregistration.captcha.*
+io.mosip.print.*
+io.mosip.registration.*
+io.mosip.registrationprocessor.*
+io.mosip.resident.*
+io.mosip.vercred.*
+io.mosn.layotto.*
+io.motown.*
+io.motown.chargingstation-configuration.*
+io.motown.domain.*
+io.motown.identification-authorization.*
+io.motown.ocpp.*
+io.motown.operator-api.*
+io.motown.vas.*
+io.mozocoin.*
+io.mraa.*
+io.mraa.at.*
+io.mraa.at.upm.*
+io.mraa.upm.*
+io.mth.*
+io.muenchendigital.digiwf.*
+io.muoncore.*
+io.muoncore.protocol.*
+io.muoncore.transport.*
+io.muserver.*
+io.mvnpm.*
+io.mwielocha.*
+io.mx51.*
+io.mybatis.*
+io.mybatis.provider.*
+io.mybatis.rui.*
+io.mycat.*
+io.mycat.bigmem.*
+io.mypojo.*
+io.mypojo.test.*
+io.mypojo.test.bundles.*
+io.mzlnk.oauth2.exchange.*
+io.mzlnk.springframework.*
+io.nacular.doodle.*
+io.nacular.measured.*
+io.nagurea.*
+io.nangos.beaconcontrol.*
+io.nanoservices.*
+io.nanovc.*
+io.naradrama.*
+io.naraplatform.*
+io.naraway.*
+io.narayana.*
+io.narayana.microprofile.lra.*
+io.nary.*
+io.nativeblocks.*
+io.natix.*
+io.nats.*
+io.nats.bridge.*
+io.nats.nats-spring-samples.*
+io.naviar.*
+io.nayuki.*
+io.nbos.*
+io.nearpay.*
+io.neba.*
+io.nebulas.*
+io.nem.*
+io.neonbee.*
+io.neos.fusion4j.*
+io.neow3j.*
+io.nervous.*
+io.netfall.*
+io.netpie.*
+io.netty.*
+io.netty.contrib.*
+io.netty.incubator.*
+io.newm.*
+io.newm.server.*
+io.nextflow.*
+io.nextop.*
+io.nflow.*
+io.nigo.*
+io.ningyuan.*
+io.niowire.*
+io.nitric.*
+io.nity.grpc.*
+io.nixer.*
+io.nlopez.clusterer.*
+io.nlopez.compose.rules.*
+io.nlopez.drebin.*
+io.nlopez.loom.*
+io.nlopez.revamp.*
+io.nlopez.smartadapers.*
+io.nlopez.smartadapters.*
+io.nlopez.smartlocation.*
+io.nlopez.toolkit.*
+io.nlytx.*
+io.norberg.*
+io.nosqlbench.*
+io.noties.*
+io.noties.markwon.*
+io.nrbtech.rxandroidble.*
+io.nuclio.*
+io.nullablej.*
+io.nuls.*
+io.nuls.account-ledger-module.*
+io.nuls.account-module.*
+io.nuls.ccc.*
+io.nuls.client-module.*
+io.nuls.consensus-module.*
+io.nuls.contract-module.*
+io.nuls.core-module.*
+io.nuls.db-module.*
+io.nuls.ledger-module.*
+io.nuls.message-bus-module.*
+io.nuls.network-module.*
+io.nuls.protocol-module.*
+io.nuls.sdk-module.*
+io.nuls.sdk.*
+io.nuls.tools-module.*
+io.nuls.v2.*
+io.numaproj.numaflow.*
+io.nuun.*
+io.nuun.kernel.*
+io.nuvalence.dsgov.*
+io.nxnet.commons.*
+io.nxnet.html2adoc.*
+io.nyris.sdk.*
+io.oasp.*
+io.oasp.java.*
+io.oasp.java.boms.*
+io.oasp.java.ide.*
+io.oasp.java.modules.*
+io.oasp.java.starters.*
+io.oasp.java.templates.*
+io.obarch.*
+io.objectbox.*
+io.obs-websocket.community.*
+io.ocfl.*
+io.octa.security.*
+io.oddsource.java.*
+io.oden.*
+io.odpf.*
+io.omnisense.*
+io.omnitalk.*
+io.ona.kujaku.*
+io.onebrick.sdk.*
+io.onee.*
+io.onema.*
+io.oneprofile.*
+io.onetapbeyond.*
+io.onfhir.*
+io.ook.*
+io.oolon.*
+io.oopsie.*
+io.openapiprocessor.*
+io.openapitools.api.*
+io.openapitools.api.specification.*
+io.openapitools.hal.*
+io.openapitools.jackson.dataformat.*
+io.openapitools.swagger.*
+io.openbouquet.*
+io.opencaesar.adapters.*
+io.opencaesar.ecore.*
+io.opencaesar.oml.*
+io.opencaesar.ontologies.*
+io.opencaesar.owl.*
+io.opencensus.*
+io.opencmw.*
+io.opencubes.*
+io.opencubes.boxlin.*
+io.openepcis.*
+io.openexchange.*
+io.openfeedback.*
+io.openfoundation.dependencies.*
+io.openfuture.*
+io.opengood.api.*
+io.opengood.autoconfig.*
+io.opengood.commons.*
+io.opengood.data.*
+io.opengood.extensions.*
+io.openharmony.tpc.thirdlib.*
+io.openharmony.tpc.thirdlib.dev.applibgroup.*
+io.openio.sds.*
+io.openjob.*
+io.openjob.worker.*
+io.openk9.*
+io.openliberty.*
+io.openliberty.api.*
+io.openliberty.arquillian.*
+io.openliberty.beta.*
+io.openliberty.boost.*
+io.openliberty.features.*
+io.openliberty.spi.*
+io.openliberty.tools.*
+io.openlineage.*
+io.openmanufacturing.*
+io.openmessaging.*
+io.openmessaging.chaos.*
+io.openmessaging.storage.*
+io.openmobilemaps.*
+io.openpixee.*
+io.openraven.magpie.*
+io.openremote.*
+io.openscore.*
+io.openscore.content.*
+io.openscore.lang.*
+io.opensec.*
+io.opensergo.*
+io.openshift.*
+io.openshift.booster.*
+io.openshift.launchpad.*
+io.opensw.scheduler.*
+io.opentelemetry.*
+io.opentelemetry.contrib.*
+io.opentelemetry.instrumentation.*
+io.opentelemetry.javaagent.*
+io.opentelemetry.javaagent.instrumentation.*
+io.opentelemetry.proto.*
+io.opentelemetry.semconv.*
+io.opentimeline.*
+io.opentracing.*
+io.opentracing.brave.*
+io.opentracing.contrib.*
+io.opentracing.contrib.dropwizard.*
+io.opentracing.contrib.grpc.*
+io.opentracing.contrib.specialagent.*
+io.opentracing.contrib.specialagent.plugins.*
+io.opentracing.contrib.specialagent.rules.*
+io.openvalidation.*
+io.openvidu.*
+io.openwebrtc.*
+io.operatr.*
+io.operon.*
+io.opil.*
+io.opns.otl.*
+io.opsit.*
+io.orange-buffalo.*
+io.orangebeard.*
+io.orchestrate.*
+io.orijtech.integrations.*
+io.orkes.conductor.*
+io.orkes.queues.*
+io.ortis.*
+io.osnz.parent.*
+io.osnz.tiles.*
+io.oss84.geotools.*
+io.oss84.geotools.jdbc.*
+io.oss84.geotools.maven.*
+io.oss84.geotools.ogc.*
+io.oss84.geotools.xsd.*
+io.oss84.jgridshift.*
+io.othree.*
+io.ous.*
+io.outfoxx.*
+io.outfoxx.sunday.*
+io.overcoded.*
+io.packagecloud.*
+io.packagecloud.maven.wagon.*
+io.pact.plugin.driver.*
+io.palaima.*
+io.palaima.debugdrawer.*
+io.palyvos.*
+io.paradoxical.*
+io.parallec.*
+io.parapet.*
+io.parsek.*
+io.parsingdata.*
+io.passworks.*
+io.patriot-framework.*
+io.paulbaker.archetypes.*
+io.paulbaker.integration.*
+io.paulbaker.libs.*
+io.paycek.*
+io.payline.payments.processing.client.*
+io.paymenthighway.*
+io.payrun.sdk.*
+io.paysky.*
+io.payworks.labs.tcpmocker.*
+io.pcp.*
+io.pcp.agentparfait.*
+io.pcp.parfait.*
+io.pdal.*
+io.pdef.*
+io.pdfapi.*
+io.pdfdata.*
+io.pdfire.client.*
+io.peacemakr.*
+io.peasoup.*
+io.pebbletemplates.*
+io.peekandpoke.kraft.*
+io.peekandpoke.ultra.*
+io.pega.oss.sample.*
+io.pelle.hetzner.*
+io.pelle.mango.*
+io.peltas.*
+io.percy.*
+io.percy.espresso.*
+io.perfana.*
+io.perfeccionista.framework.*
+io.perfmark.*
+io.permazen.*
+io.permit.*
+io.persona3.*
+io.persona3.android.*
+io.persona3.android.pms.*
+io.personium.*
+io.phasetwo.*
+io.phasetwo.keycloak.*
+io.piano.*
+io.piano.android.*
+io.pig.*
+io.pileworx.*
+io.pinecone.*
+io.pity.*
+io.pivotal.*
+io.pivotal.android.*
+io.pivotal.cfenv.*
+io.pivotal.ecosystem.*
+io.pivotal.services.dataTx.*
+io.pivotal.spring.cloud.*
+io.pixeloutlaw.*
+io.pixeloutlaw.mythicdrops.*
+io.pixeloutlaw.spigot-commons.*
+io.pixeloutlaw.worldguard.*
+io.pjan.*
+io.pkts.*
+io.playn.*
+io.pleo.*
+io.plugy.*
+io.pmem.*
+io.pokpay.*
+io.policarp.*
+io.polygenesis.*
+io.polygenesis.abstractions.*
+io.polygenesis.deducers.*
+io.polygenesis.demo.*
+io.polygenesis.exporters.*
+io.polygenesis.generators.*
+io.polygenesis.labs.*
+io.polygenesis.metamodels.*
+io.polygenesis.template-engines.*
+io.polygenesis.transformers.*
+io.polyglotted.*
+io.polygonal.*
+io.polymorphicpanda.*
+io.polywrap.*
+io.polywrap.plugins.*
+io.portto.*
+io.postmaster.*
+io.potter.thrift.*
+io.poyarzun.*
+io.praesid.*
+io.pravega.*
+io.pravikant.*
+io.prediction.*
+io.pressf.iap-native.*
+io.pressf.settings-native.*
+io.prestodb.benchto.*
+io.prestodb.tempto.*
+io.prestosql.*
+io.prestosql.benchto.*
+io.prestosql.cassandra.*
+io.prestosql.hadoop.*
+io.prestosql.hive.*
+io.prestosql.orc.*
+io.prestosql.tempto.*
+io.prestosql.tpcds.*
+io.prestosql.tpch.*
+io.prestosql.yugabyte.*
+io.primer.*
+io.primeval.*
+io.primeval.component.annotation.*
+io.primeval.tooling.bnd.*
+io.prismic.*
+io.pristine.*
+io.pristine.sheath.*
+io.probedock.*
+io.probedock.client.*
+io.probedock.demo.*
+io.probedock.jee.*
+io.probedock.maven.plugins.*
+io.probedock.rt.client.*
+io.probedock.test.*
+io.progix.dropwizard.*
+io.progix.jackson.*
+io.projectglow.*
+io.projectreactor.*
+io.projectreactor.addons.*
+io.projectreactor.ipc.*
+io.projectreactor.kafka.*
+io.projectreactor.kotlin.*
+io.projectreactor.netty.*
+io.projectreactor.netty.incubator.*
+io.projectreactor.rabbitmq.*
+io.projectreactor.spring.*
+io.projectreactor.tools.*
+io.prometheus.*
+io.prometheus.client.*
+io.prometheus.client.examples.*
+io.prometheus.client.utility.*
+io.prometheus.cloudwatch.*
+io.prometheus.jmx.*
+io.proofdock.*
+io.prophecy.*
+io.prophecy.spark.*
+io.protop.calver.*
+io.protop.version.*
+io.protostuff.*
+io.provenance.*
+io.provenance.asset.*
+io.provenance.bilateral.*
+io.provenance.classification.asset.*
+io.provenance.client.*
+io.provenance.coroutines.*
+io.provenance.eventstream.*
+io.provenance.explorer.*
+io.provenance.hdwallet.*
+io.provenance.kafka-coroutine.*
+io.provenance.key-access-lib.*
+io.provenance.kms-connector.*
+io.provenance.loan-package.*
+io.provenance.model.*
+io.provenance.objectstore.gateway.*
+io.provenance.objectstore.locator.*
+io.provenance.originator-key-access-lib.*
+io.provenance.p8e-cee-api.*
+io.provenance.p8e.*
+io.provenance.protobuf.*
+io.provenance.scope.*
+io.provenance.spec.*
+io.provis.*
+io.prowave.*
+io.proximax.*
+io.proxsee.*
+io.pst.mojo.*
+io.purchasely.*
+io.purecore.*
+io.puremetrics.*
+io.puresec.*
+io.pyroclast.*
+io.pyroscope.*
+io.pythagoras.common.*
+io.pythagoras.messagebus.*
+io.qaclana.*
+io.qaclana.filter.*
+io.qadenz.*
+io.qala.datagen.*
+io.qameta.*
+io.qameta.allure.*
+io.qameta.allure.plugins.*
+io.qameta.atlas.*
+io.qameta.htmlelements.*
+io.qase.*
+io.qbeast.*
+io.qdb.*
+io.qiro.*
+io.qonversion.android.sdk.*
+io.qonversion.sandwich.*
+io.qross.*
+io.qtjambi.*
+io.quantics.*
+io.quarkiverse.*
+io.quarkiverse.amazonalexa.*
+io.quarkiverse.amazonservices.*
+io.quarkiverse.apicurio.*
+io.quarkiverse.apistax.*
+io.quarkiverse.artemis.*
+io.quarkiverse.arthas.*
+io.quarkiverse.asyncapi.*
+io.quarkiverse.authzed.*
+io.quarkiverse.azureservices.*
+io.quarkiverse.bucket4j.*
+io.quarkiverse.certmanager.*
+io.quarkiverse.config.*
+io.quarkiverse.cucumber.*
+io.quarkiverse.cxf.*
+io.quarkiverse.dapr.*
+io.quarkiverse.dashbuilder.*
+io.quarkiverse.doma.*
+io.quarkiverse.embedded.postgresql.*
+io.quarkiverse.file-vault.*
+io.quarkiverse.freemarker.*
+io.quarkiverse.githubaction.*
+io.quarkiverse.githubapi.*
+io.quarkiverse.githubapp.*
+io.quarkiverse.googlecloudservices.*
+io.quarkiverse.groovy.*
+io.quarkiverse.helm.*
+io.quarkiverse.hibernatesearchextras.*
+io.quarkiverse.hibernatetypes.*
+io.quarkiverse.hivemqclient.*
+io.quarkiverse.ironjacamar.*
+io.quarkiverse.itext.*
+io.quarkiverse.jackson-jq.*
+io.quarkiverse.jasperreports.*
+io.quarkiverse.jberet.*
+io.quarkiverse.jdbc.*
+io.quarkiverse.jdbi.*
+io.quarkiverse.jef.*
+io.quarkiverse.jgit.*
+io.quarkiverse.jgrapht.*
+io.quarkiverse.jjwtjackson.*
+io.quarkiverse.jnosql.*
+io.quarkiverse.jooq.*
+io.quarkiverse.jpastreamer.*
+io.quarkiverse.jsch.*
+io.quarkiverse.kerberos.*
+io.quarkiverse.logging.cloudwatch.*
+io.quarkiverse.logging.logback.*
+io.quarkiverse.logging.splunk.*
+io.quarkiverse.loggingjson.*
+io.quarkiverse.loggingmanager.*
+io.quarkiverse.loggingsentry.*
+io.quarkiverse.loggingui.*
+io.quarkiverse.lucene.*
+io.quarkiverse.mavenresolver.*
+io.quarkiverse.messaginghub.*
+io.quarkiverse.mfa.*
+io.quarkiverse.micrometer.registry.*
+io.quarkiverse.microprofile.*
+io.quarkiverse.minio.*
+io.quarkiverse.mockk.*
+io.quarkiverse.mockserver.*
+io.quarkiverse.moneta.*
+io.quarkiverse.morphia.*
+io.quarkiverse.mybatis.*
+io.quarkiverse.neo4j.*
+io.quarkiverse.ngrok.*
+io.quarkiverse.omnifaces.*
+io.quarkiverse.openapi.generator.*
+io.quarkiverse.opencv.*
+io.quarkiverse.openfga.*
+io.quarkiverse.opensearch.*
+io.quarkiverse.opentelemetry.exporter.*
+io.quarkiverse.opentracing.datadog.*
+io.quarkiverse.operatorsdk.*
+io.quarkiverse.pact.*
+io.quarkiverse.pinot.*
+io.quarkiverse.poi.*
+io.quarkiverse.prettytime.*
+io.quarkiverse.primefaces.*
+io.quarkiverse.pusher.beams.*
+io.quarkiverse.quarkus-elasticsearch-reactive.*
+io.quarkiverse.quarkus-reactive-h2-client.*
+io.quarkiverse.quarkus-reactive-mysql-pool-client.*
+io.quarkiverse.quarkus-zookeeper.*
+io.quarkiverse.quinoa.*
+io.quarkiverse.quteserverpages.*
+io.quarkiverse.rabbitmqclient.*
+io.quarkiverse.reactivemessaging.http.*
+io.quarkiverse.renarde.*
+io.quarkiverse.rsocket.*
+io.quarkiverse.satoken.*
+io.quarkiverse.scala.*
+io.quarkiverse.shardingsphere.*
+io.quarkiverse.sshd.*
+io.quarkiverse.systemd.notify.*
+io.quarkiverse.tektonclient.*
+io.quarkiverse.tika.*
+io.quarkiverse.univocityparsers.*
+io.quarkiverse.unleash.*
+io.quarkiverse.vault.*
+io.quarkiverse.web-bundler.*
+io.quarkiverse.wiremock.*
+io.quarkiverse.xmlsec.*
+io.quarkiverse.zanzibar.*
+io.quarkiverse.zeebe.*
+io.quarkus.*
+io.quarkus.arc.*
+io.quarkus.bot.*
+io.quarkus.domino.*
+io.quarkus.extensions.*
+io.quarkus.fs.*
+io.quarkus.gizmo.*
+io.quarkus.http.*
+io.quarkus.keycloak.*
+io.quarkus.platform.*
+io.quarkus.qe.*
+io.quarkus.qlue.*
+io.quarkus.qson.*
+io.quarkus.qute.*
+io.quarkus.resteasy.reactive.*
+io.quarkus.security.*
+io.quarkuscoffeeshop.*
+io.qubite.tomoko.*
+io.quckoo.*
+io.quee.api.dependencies.*
+io.quee.api.develop.*
+io.quee.api.parent.*
+io.quee.fragmentation.*
+io.quee.ktx.framework.*
+io.quee.ktx.framework.dependencies.*
+io.quee.ktx.layout.*
+io.quee.ktx.radix.*
+io.quee.mvp.*
+io.quickchart.*
+io.quicklog.*
+io.quicksign.*
+io.quickverse.androidsdk.*
+io.r2.*
+io.r2b2.*
+io.r2dbc.*
+io.radanalytics.*
+io.radar.*
+io.radicalbit.*
+io.radien.*
+io.railflow.annotations.*
+io.railflow.annotations.zephyr.*
+io.rainfall.*
+io.rakam.*
+io.rakutenadvertising.*
+io.rala.*
+io.rapidpro.*
+io.rapidw.mqtt.*
+io.rapidw.utils.*
+io.ratpack.*
+io.ray.*
+io.razem.*
+io.rbricks.*
+io.rdbc.*
+io.rdbc.pgsql.*
+io.rdbc.pool.*
+io.reacted.*
+io.reactiverse.*
+io.reactiverse.es4x.*
+io.reactivesocket.*
+io.reactivex.*
+io.reactivex.rxjava2.*
+io.reactivex.rxjava3.*
+io.reactors.*
+io.readsee.*
+io.really.*
+io.realm.*
+io.realm.kotlin.*
+io.reark.*
+io.redback.*
+io.redlink.*
+io.redlink.ext.logback.*
+io.redlink.geocoding.*
+io.redlink.nlp.*
+io.redlink.solr.*
+io.redlink.solrlib.*
+io.redlink.ssix.geofluent.*
+io.redlink.ssix.moven.*
+io.redlink.utils.*
+io.redskap.*
+io.redvox.*
+io.refiner.*
+io.reflectoring.*
+io.reflectoring.diffparser.*
+io.reformanda.semper.*
+io.regadas.*
+io.reinert.gdeferred.*
+io.reinert.requestor.*
+io.reinert.requestor.core.*
+io.reinert.requestor.ext.*
+io.reinert.requestor.impl.*
+io.reinert.tools.*
+io.rekast.*
+io.rekast.momoapi.*
+io.relayr.*
+io.relevantbox.*
+io.reliza.*
+io.remme.java.*
+io.remotecontrol.*
+io.renderback.*
+io.renku.*
+io.repaint.maven.*
+io.replay.*
+io.repseq.*
+io.requery.*
+io.requestly.*
+io.requestly.rqinterceptor.*
+io.resoluteworks.*
+io.resourcepool.*
+io.rest-assured.*
+io.rest-assured.examples.*
+io.restall.picodi.*
+io.restx.*
+io.resurface.*
+io.resys.hdes.*
+io.revenuemonster.*
+io.revenuemonster.sdk.*
+io.rhiot.*
+io.rhpatrick.maven.*
+io.rhpatrick.mojo.*
+io.rightmesh.*
+io.rincl.*
+io.rivulet.*
+io.rnkit.*
+io.rny.dropwizard.modules.*
+io.robe.*
+io.robotsnowfall.*
+io.rocketbase.asset.*
+io.rocketbase.commons.*
+io.rocketbase.extension.*
+io.rocketbase.mail.*
+io.rogue.ee.*
+io.rollout.*
+io.rollout.rox.*
+io.rouz.*
+io.rownd.*
+io.rqndomhax.*
+io.rsocket.*
+io.rsocket.broker.*
+io.rsocket.kotlin.*
+io.rsocket.routing.*
+io.rsocket.rpc.*
+io.rtdi.appcontainer.*
+io.rtdi.bigdata.connector.*
+io.rtdi.bigdata.kafka.*
+io.rtdi.hanaappserver.*
+io.rtdi.sap.*
+io.rtr.*
+io.rtr.alchemy.*
+io.rtron.*
+io.rubrica.*
+io.ruck.*
+io.rudin.cdi.*
+io.rudin.cdi.slf4j.*
+io.rudin.s7connector.*
+io.rudin.tomcat.embedded.*
+io.rudin.webdoc.*
+io.rudolph.netatmo.*
+io.runon.classification.*
+io.runon.collect.api.*
+io.runon.commons.*
+io.runon.cryptocurrency.*
+io.runon.trading.*
+io.runtime.mcumgr.*
+io.rxmicro.*
+io.ryos.rhino.*
+io.s-healthstack.*
+io.saagie.*
+io.salyangoz.scrollme.*
+io.salyangoz.updateme.*
+io.samagra.*
+io.sanghun.*
+io.sankha.*
+io.sapl.*
+io.sapmachine.*
+io.sariska.*
+io.sarl.*
+io.sarl.lang.*
+io.sarl.maven.*
+io.sarnowski.*
+io.scal.*
+io.scalac.*
+io.scalajs.*
+io.scalajs.npm.*
+io.scalaland.*
+io.scalecube.*
+io.scaleplan.*
+io.schram.webassembly.maven.*
+io.scif.*
+io.screenshotbot.*
+io.scyna.*
+io.sdkman.*
+io.sdsolutions.particle.*
+io.seal.sharefragments.*
+io.seald.*
+io.sealights.on-premise.agents.*
+io.sealights.on-premise.agents.android.*
+io.sealights.on-premise.agents.plugin.*
+io.searchbox.*
+io.seata.*
+io.seats.*
+io.secugrow.*
+io.securecodebox.*
+io.segment.analytics.android.*
+io.segment.android.*
+io.seldon.wrapper.*
+io.selendroid.*
+io.semla.*
+io.senorarchitect.*
+io.sensesecure.*
+io.sentry.*
+io.sentry.android.gradle.*
+io.sentry.jvm.gradle.*
+io.sentry.kotlin.compiler.gradle.*
+io.senx.*
+io.seon.androidsdk.*
+io.serialized.*
+io.serialized.archetype.*
+io.seruco.encoding.*
+io.seruco.rbak.*
+io.serverlessworkflow.*
+io.service84.apiregistry.javaclient.*
+io.service84.apiregistry.pythonclient.*
+io.service84.apiregistry.springimpl.*
+io.service84.downloaddependencies.*
+io.service84.library.*
+io.service84.openapi.*
+io.service84.openapi.external.*
+io.service84.services.*
+io.servicecomb.*
+io.servicecomb.demo.*
+io.servicecomb.springboot.jaxrs.client.*
+io.servicecomb.springboot.jaxrs.server.*
+io.servicecomb.springboot.pojo.client.*
+io.servicecomb.springboot.pojo.server.*
+io.servicecomb.springboot.springmvc.client.*
+io.servicecomb.springboot.springmvc.server.*
+io.servicecomb.tests.*
+io.servicefabric.*
+io.servicetalk.*
+io.setapp.*
+io.setl.*
+io.seventytwo.oss.*
+io.seventytwo.vaadin-jooq.*
+io.severr.*
+io.sfrei.*
+io.sgr.*
+io.sgr.maven.*
+io.sgr.oauth.*
+io.sgr.social.*
+io.sgr.telegram.*
+io.sgr.telegram.bot.examples.*
+io.sgr.telegram.bot.extensions.*
+io.sgr.telegram.bot.extensions.user-management.*
+io.shadowstack.*
+io.shaka.*
+io.shapelets.*
+io.shardingjdbc.*
+io.shardingsphere.*
+io.shaun.*
+io.shenjian.sdk.*
+io.shick.jsoup.*
+io.shiftleft.*
+io.shipbook.*
+io.shipsy.mobilesdk.*
+io.shulie.*
+io.shulie.amdb.*
+io.shulie.flpt.*
+io.shulie.instrument.module.*
+io.shulie.instrument.simulator.*
+io.shulie.pradar.*
+io.shulie.surge.data.*
+io.shulie.surge.data.suppliers.*
+io.shulie.takin.*
+io.shulie.takin.plugin.framework.*
+io.shulie.tro.*
+io.siddhi.*
+io.siddhi.distribution.*
+io.siddhi.extension.archetype.*
+io.siddhi.extension.execution.json.*
+io.siddhi.extension.execution.list.*
+io.siddhi.extension.execution.map.*
+io.siddhi.extension.execution.math.*
+io.siddhi.extension.execution.regex.*
+io.siddhi.extension.execution.reorder.*
+io.siddhi.extension.execution.streamingml.*
+io.siddhi.extension.execution.string.*
+io.siddhi.extension.execution.tensorflow.*
+io.siddhi.extension.execution.time.*
+io.siddhi.extension.execution.unique.*
+io.siddhi.extension.execution.unitconversion.*
+io.siddhi.extension.io.azuredatalake.*
+io.siddhi.extension.io.cdc.*
+io.siddhi.extension.io.email.*
+io.siddhi.extension.io.file.*
+io.siddhi.extension.io.gcs.*
+io.siddhi.extension.io.googlepubsub.*
+io.siddhi.extension.io.grpc.*
+io.siddhi.extension.io.hl7.*
+io.siddhi.extension.io.http.*
+io.siddhi.extension.io.ibmmq.*
+io.siddhi.extension.io.jms.*
+io.siddhi.extension.io.kafka.*
+io.siddhi.extension.io.mqtt.*
+io.siddhi.extension.io.nats.*
+io.siddhi.extension.io.prometheus.*
+io.siddhi.extension.io.rabbitmq.*
+io.siddhi.extension.io.s3.*
+io.siddhi.extension.io.sqs.*
+io.siddhi.extension.io.tcp.*
+io.siddhi.extension.io.websocket.*
+io.siddhi.extension.map.avro.*
+io.siddhi.extension.map.binary.*
+io.siddhi.extension.map.binarypassthrough.*
+io.siddhi.extension.map.csv.*
+io.siddhi.extension.map.json.*
+io.siddhi.extension.map.keyvalue.*
+io.siddhi.extension.map.protobuf.*
+io.siddhi.extension.map.text.*
+io.siddhi.extension.map.xml.*
+io.siddhi.extension.script.js.*
+io.siddhi.extension.store.elasticsearch.*
+io.siddhi.extension.store.mongodb.*
+io.siddhi.extension.store.rdbms.*
+io.siddhi.extension.store.redis.*
+io.siddhi.sdk.*
+io.sightly.*
+io.signpath.javaclient.*
+io.sigpipe.*
+io.sigs.*
+io.sikt.*
+io.silentium.*
+io.silksource.*
+io.silverspoon.*
+io.silverware.*
+io.silverware.demos.*
+io.simpleframework.*
+io.simplesource.*
+io.simplicite.simplinium.*
+io.siniavtsev.*
+io.sinistral.*
+io.sipstack.*
+io.sirix.*
+io.sitoolkit.bt.*
+io.sitoolkit.csv.*
+io.sitoolkit.cv.*
+io.sitoolkit.dba.*
+io.sitoolkit.rdg.*
+io.sitoolkit.util.bth.*
+io.sitoolkit.util.sbrs.*
+io.sitoolkit.wt.*
+io.sixhours.*
+io.skalogs.skaetl.*
+io.skelp.*
+io.skuber.*
+io.skullabs.apt.*
+io.skullabs.boilerplates.*
+io.skullabs.injector.*
+io.skullabs.kikaha.*
+io.skullabs.kos.*
+io.skullabs.powerlib.*
+io.skullabs.stalkr.*
+io.skullabs.trip.*
+io.skullabs.uworkers.*
+io.skyfii.*
+io.skysail.*
+io.slgl.*
+io.slifer.*
+io.slixes.*
+io.slugstack.oss.*
+io.smallrye.*
+io.smallrye.beanbag.*
+io.smallrye.common.*
+io.smallrye.config.*
+io.smallrye.config.examples.*
+io.smallrye.converters.*
+io.smallrye.opentelemetry.*
+io.smallrye.opentelemetry.examples.*
+io.smallrye.reactive.*
+io.smallrye.stork.*
+io.smallrye.testing.*
+io.smartcat.*
+io.smartdatalake.*
+io.smartmachine.*
+io.smartup.handyman.*
+io.smartup.localstack.*
+io.smartup.zipkin.*
+io.smilego.*
+io.smooch.*
+io.smooth-way.*
+io.smsc.*
+io.snamp.*
+io.snamp.connectors.*
+io.snamp.examples.*
+io.snamp.features.*
+io.snamp.gateways.*
+io.snamp.instrumentation.*
+io.snamp.integration.*
+io.snamp.osgi.*
+io.snamp.supervisors.*
+io.snapcx.*
+io.snappydata.*
+io.snice.*
+io.snice.codecs.*
+io.snice.gatling.*
+io.snice.modem.*
+io.snice.networking.*
+io.sniffy.*
+io.sniffy.influxdb.*
+io.snyk.*
+io.snyk.code.sdk.*
+io.soabase.*
+io.soabase.asm-mirror-descriptor.*
+io.soabase.exhibitor.*
+io.soabase.halva.*
+io.soabase.maple.*
+io.soabase.record-builder.*
+io.soabase.stages.*
+io.soabase.structured-logger.*
+io.socket.*
+io.soffa.*
+io.soffa.commons.*
+io.soffa.core.*
+io.soffa.foundation.*
+io.soffa.gradle.*
+io.soffa.platform.*
+io.soffa.tools.*
+io.soheila.*
+io.solidstudio.emobility.ocpp.*
+io.solit.maven.*
+io.soliton.*
+io.soluble.pjb.*
+io.solvice.*
+io.solwind.*
+io.soos.*
+io.sourceforge.recipe.*
+io.sourcy.*
+io.sovaj.basics.*
+io.sovaj.heartbeat.*
+io.soyl.*
+io.spacebunny.*
+io.specgen.*
+io.specmesh.*
+io.specto.*
+io.sphere.*
+io.sphere.jvmsdk.*
+io.sphere.maven-archetypes.*
+io.sphere.sdk.jvm.*
+io.spiffe.*
+io.spinnaker.clouddriver.*
+io.spinnaker.echo.*
+io.spinnaker.embedded-redis.*
+io.spinnaker.fiat.*
+io.spinnaker.front50.*
+io.spinnaker.gate.*
+io.spinnaker.halyard.*
+io.spinnaker.igor.*
+io.spinnaker.kayenta.*
+io.spinnaker.keel.*
+io.spinnaker.kork.*
+io.spinnaker.orca.*
+io.spinnaker.rosco.*
+io.split.*
+io.split.api.*
+io.split.client.*
+io.split.integrations.azure.*
+io.split.openfeature.*
+io.split.qosrunner.*
+io.spokestack.*
+io.spot-next.*
+io.spot-next.archetypes.*
+io.spray.*
+io.spring.asciidoctor.*
+io.spring.asciidoctor.backends.*
+io.spring.cloud.*
+io.spring.compatibility-test.*
+io.spring.dependency-management.*
+io.spring.ge.*
+io.spring.ge.conventions.*
+io.spring.gradle.*
+io.spring.initializr.*
+io.spring.javaformat.*
+io.spring.maven.antora.*
+io.spring.nohttp.*
+io.spring.platform.*
+io.spring.releasetrain.*
+io.spring.task.*
+io.springboot.*
+io.springboot.nacos.*
+io.springboot.plugin.*
+io.springboot.security.*
+io.springboot.sms.*
+io.springfox.*
+io.springfox.grails.*
+io.springfox.ui.*
+io.springlets.*
+io.springside.*
+io.sprucehill.*
+io.spsw.*
+io.sqooba.*
+io.sqooba.oss.*
+io.sqreen.*
+io.squark.*
+io.squark.yggdrasil.*
+io.squark.yggdrasil.yggdrasil-framework-provider.*
+io.squark.yggdrasil.yggdrasil-logging.*
+io.squashql.*
+io.squidex.*
+io.sreworks.*
+io.staminaframework.*
+io.staminaframework.addons.*
+io.staminaframework.hello.*
+io.staminaframework.http.*
+io.staminaframework.repo.*
+io.staminaframework.runtime.*
+io.staminaframework.shell.*
+io.starburst.*
+io.starburst.errorprone.*
+io.starburst.openjson.*
+io.starburst.openx.data.*
+io.stardog.*
+io.stardog.dropwizard.worker.*
+io.stardog.stardao.*
+io.stardog.starwizard.*
+io.stargate.*
+io.stargate.auth.*
+io.stargate.auth.api.*
+io.stargate.auth.jwt.*
+io.stargate.auth.table.*
+io.stargate.bridge.*
+io.stargate.config-store.*
+io.stargate.config.store.yaml.*
+io.stargate.core.*
+io.stargate.cql.*
+io.stargate.db.*
+io.stargate.db.cassandra.*
+io.stargate.db.dse.*
+io.stargate.db.limiter.global.*
+io.stargate.graphql.*
+io.stargate.grpc.*
+io.stargate.health.*
+io.stargate.it.*
+io.stargate.metrics.*
+io.stargate.persistence.*
+io.stargate.starter.*
+io.stargate.web.*
+io.start.*
+io.starter.*
+io.staticcdn.sdk.*
+io.statusmachina.*
+io.statx.*
+io.stepfunc.*
+io.sterodium.*
+io.stickerface.*
+io.storj.*
+io.stoys.*
+io.strati.*
+io.streamlayer.*
+io.streammachine.*
+io.streammachine.public_schemas.*
+io.streammachine.schemas.*
+io.streammachine.schemas.strmcatalog.*
+io.streamnative.*
+io.streamnative.com.example.maven-central-template.*
+io.streamnative.connectors.*
+io.streamnative.examples.*
+io.streamnative.http.*
+io.streamnative.metadata.drivers.*
+io.streamnative.pulsar.*
+io.streamnative.pulsar.handlers.*
+io.streamnative.pulsar.tracing.*
+io.streamnative.stats.*
+io.streamnative.tests.*
+io.streamnative.tests.backward-compat.*
+io.streamnative.tests.integration.*
+io.streamnative.tests.shaded.*
+io.streamthoughts.*
+io.strikt.*
+io.strimzi.*
+io.strmprivacy.*
+io.strmprivacy.aws-lambda-udfs.*
+io.strmprivacy.schemas.*
+io.strongtyped.*
+io.stryker-mutator.*
+io.substrait.*
+io.subutai.guicyfig.*
+io.sugo.android.*
+io.sumac.*
+io.sumislawski.swaggerify.*
+io.sundr.*
+io.sundr.examples.*
+io.sundr.tests.*
+io.sunland.*
+io.sunshower.*
+io.sunshower.aire-test.*
+io.sunshower.aire.*
+io.sunshower.aire.ux.controls-aire-switch.*
+io.sunshower.aire.ux.controls.*
+io.sunshower.arcus.*
+io.sunshower.arcus.annotations.*
+io.sunshower.arcus.config.*
+io.sunshower.arcus.cryptkeeper.*
+io.sunshower.arcus.persist.*
+io.sunshower.arcus.test.*
+io.sunshower.environment.*
+io.sunshower.zephyr.*
+io.sunshower.zephyr.semver.*
+io.supercharge.*
+io.supercharge.common.*
+io.superflat.*
+io.supportify.*
+io.surati.gap.*
+io.surfkit.*
+io.suzaku.*
+io.swagger.*
+io.swagger.codegen.v3.*
+io.swagger.core.v3.*
+io.swagger.parser.v3.*
+io.swagger.validator.v3.*
+io.swave.*
+io.swaydb.*
+io.sweers.arraysetbackport.*
+io.sweers.autotransient.*
+io.sweers.barber.*
+io.sweers.configurablecheckreturnvalue.*
+io.sweers.copydynamic.*
+io.sweers.inspector.*
+io.sweers.rxpalette.*
+io.sygna.*
+io.sylkworm.sdk.*
+io.symcpe.hendrix.*
+io.symphonia.*
+io.syncano.*
+io.syndesis.*
+io.syndesis.common.*
+io.syndesis.connector.*
+io.syndesis.extension.*
+io.syndesis.integration-runtime.*
+io.syndesis.integration.*
+io.syndesis.meta.*
+io.syndesis.rest.*
+io.syndesis.s2i.*
+io.syndesis.server.*
+io.syndesis.transitional.*
+io.syndesis.ui.*
+io.synthesized.*
+io.syrf.*
+io.sysmo.*
+io.tacl.*
+io.tago.java.*
+io.taig.*
+io.taig.android.*
+io.taig.android.viewvalue.*
+io.takamaka.crypto.*
+io.takamaka.extra.*
+io.takamaka.wallet.*
+io.takari.*
+io.takari.aether.*
+io.takari.airlift.*
+io.takari.bpm.*
+io.takari.bpm.examples.*
+io.takari.builder.*
+io.takari.graph.*
+io.takari.jenkins.*
+io.takari.jira.*
+io.takari.junit.*
+io.takari.m2e.discovery.publisher.*
+io.takari.m2e.workspace.*
+io.takari.maven.*
+io.takari.maven.plugin.testing.*
+io.takari.maven.plugins.*
+io.takari.nexus.*
+io.takari.nexus.perf.data.*
+io.takari.nexus.perf.data.docker.*
+io.takari.nexus.perf.data.maven.*
+io.takari.nexus.perf.data.npm.*
+io.takari.nexus.test.*
+io.takari.npm.*
+io.takari.orchestra.*
+io.takari.orchestra.docker.*
+io.takari.orchestra.it.*
+io.takari.orchestra.plugins.*
+io.takari.p2.bridge.*
+io.takari.pcollections.*
+io.takari.polyglot.*
+io.takari.siesta.*
+io.takari.slack.*
+io.takari.tycho.*
+io.takari.zsync.*
+io.taliox.*
+io.tapack.*
+io.tapir-test.*
+io.tarantool.*
+io.target-kt.*
+io.taskq.*
+io.tatum.*
+io.tauris.*
+io.tcds.*
+io.teachingmachines.*
+io.teamif.*
+io.tech1.framework.*
+io.techtrix.*
+io.teecube.*
+io.teecube.maven.skins.*
+io.teecube.t3.*
+io.teecube.tac.*
+io.teecube.tac.archetypes.*
+io.teecube.tic.*
+io.teecube.tic.tic-bw6-studio.*
+io.teecube.toe.*
+io.tehuti.*
+io.teknek.*
+io.tekniq.*
+io.tekniq.web.*
+io.telereso.kmp.*
+io.teliver.sdk.*
+io.teller.*
+io.temporal.*
+io.teragroup.keycloak.extension.*
+io.termd.*
+io.tesbo.*
+io.tesfy.*
+io.tesla.*
+io.tesla.aether.*
+io.tesla.aether.test.*
+io.tesla.dropwizard.*
+io.tesla.dropwizard.sisu.*
+io.tesla.jettyconsole.*
+io.tesla.maven.*
+io.tesla.maven.plugin.*
+io.tesla.maven.plugins.*
+io.tesla.nexus.plugins.*
+io.tesla.okhttp.*
+io.tesla.polyglot.*
+io.tesla.profile.*
+io.tesla.sisu.*
+io.tesla.sitebricks.*
+io.tesla.tycho.*
+io.tesler.*
+io.tesmon.*
+io.tessilab.*
+io.tessilab.oss.*
+io.test-gear.*
+io.testable.*
+io.testb4.*
+io.testb4.bdd.*
+io.testerra.*
+io.testproject.*
+io.testsmith.*
+io.theblackbox.*
+io.thedocs.*
+io.thegrid.backstack.*
+io.thegrid.imgflourl.*
+io.thekraken.*
+io.thekrakken.*
+io.thestencil.*
+io.theves.*
+io.theysay.*
+io.thill.kafkacap.*
+io.thill.kafkalite.*
+io.thill.trakrj.*
+io.thorntail.*
+io.thorntail.cli.*
+io.thorntail.docs.*
+io.thorntail.jdk-specific.*
+io.thorntail.openshift-test.*
+io.thorntail.servers.*
+io.thorntail.testsuite.*
+io.thumbcat.oss.*
+io.thundra.*
+io.thundra.agent.*
+io.thundra.merloc.*
+io.thundra.plugin.*
+io.thundra.swark.*
+io.thundra.utils.*
+io.tidb.*
+io.tigerui.*
+io.tikaltechnologies.danta.*
+io.tiklab.*
+io.tiledb.*
+io.tiler.*
+io.timeandspace.*
+io.timeli.*
+io.timothyheider.*
+io.timson.*
+io.tlf.jme.*
+io.tmio.*
+io.tmos.*
+io.toast-tk.*
+io.toit.api.*
+io.tokenanalyst.*
+io.tokenchannel.*
+io.tokra.*
+io.toolebox.*
+io.toolforge.*
+io.toolisticon.annotationprocessortoolkit.*
+io.toolisticon.aptk.*
+io.toolisticon.beanbuilder.*
+io.toolisticon.camel.*
+io.toolisticon.compiletesting.*
+io.toolisticon.cute.*
+io.toolisticon.fluapigen.*
+io.toolisticon.githubactions.*
+io.toolisticon.jackson.module.*
+io.toolisticon.lib.*
+io.toolisticon.maven.*
+io.toolisticon.maven.archetypes.*
+io.toolisticon.maven.parent.*
+io.toolisticon.maven.tile.*
+io.toolisticon.spiap.*
+io.toolisticon.springboot.*
+io.toolisticon.testing.*
+io.toolsplus.*
+io.tornimo.*
+io.touca.*
+io.tourniquet.*
+io.tourniquet.junit.*
+io.tourniquet.rest.*
+io.toxicity.*
+io.tracee.*
+io.tracee.backend.*
+io.tracee.binding.*
+io.tracee.contextlogger.*
+io.tracee.contextlogger.connector.*
+io.tracee.contextlogger.contextprovider.*
+io.tracee.contextlogger.integrationtest.*
+io.tracee.examples.*
+io.tracee.inbound.*
+io.tracee.outbound.*
+io.traceguide.*
+io.trakerr.*
+io.trane.*
+io.travisbrown.*
+io.trbl.*
+io.trbl.bcpg.*
+io.treev.*
+io.treeverse.*
+io.treeverse.lakefs.*
+io.trialy.library.*
+io.trino.*
+io.trino.benchto.*
+io.trino.cassandra.*
+io.trino.coral.*
+io.trino.hadoop.*
+io.trino.hive.*
+io.trino.orc.*
+io.trino.tempto.*
+io.trino.tpcds.*
+io.trino.tpch.*
+io.tromba.*
+io.tronalddump.*
+io.trygvis.*
+io.trygvis.appsh.*
+io.trygvis.appsh.apps.*
+io.trygvis.trello4j.*
+io.trygvis.usb.*
+io.tryp.*
+io.tsdb.services.*
+io.turny.*
+io.tus.android.client.*
+io.tus.java.client.*
+io.tutelar.*
+io.tvarit.*
+io.txcl.*
+io.txture.*
+io.typechecked.*
+io.typecraft.*
+io.typefox.gradle.*
+io.typefox.lsapi.*
+io.typefox.sprotty.*
+io.typefox.xtext.*
+io.typefox.xtext2langium.*
+io.typefox.yang.*
+io.udash.*
+io.uhome.*
+io.uiza.*
+io.ultrabrew.metrics.*
+io.ultreia.*
+io.ultreia.empreintes.edit.*
+io.ultreia.empreintes.edit.toolbox.*
+io.ultreia.gc.*
+io.ultreia.ifremer.*
+io.ultreia.java4all.*
+io.ultreia.java4all.config.*
+io.ultreia.java4all.decorator.*
+io.ultreia.java4all.eugene.*
+io.ultreia.java4all.http.*
+io.ultreia.java4all.i18n.*
+io.ultreia.java4all.jaxx.*
+io.ultreia.java4all.jgitflow.*
+io.ultreia.java4all.topia.*
+io.ultreia.maven.*
+io.ultreia.tabb.*
+io.ulysses.database-rider.*
+io.umehara.*
+io.underscore.*
+io.undertow.*
+io.undertow.build.*
+io.undertow.jastow.*
+io.undertow.js.*
+io.univalence.*
+io.unlaunch.sdk.*
+io.unmock.*
+io.unreach.*
+io.unsecurity.*
+io.uok.*
+io.uouo.*
+io.upnext.beaconcontrol.*
+io.urf.*
+io.useless.*
+io.userfeeds.ads.sdk.*
+io.userfeeds.sdk.*
+io.userfeeds.widget.*
+io.userinfo.*
+io.usersight.sdk.*
+io.userwise.userwise_sdk.*
+io.v.*
+io.v47.*
+io.v47.jaffree.*
+io.v47.tmdb-api-client.*
+io.vacco.*
+io.vacco.bert.*
+io.vacco.bertastic.*
+io.vacco.coroutines.*
+io.vacco.cpiohell.*
+io.vacco.flatbread.*
+io.vacco.gemory.*
+io.vacco.jaad.*
+io.vacco.jcwt.*
+io.vacco.jlame.*
+io.vacco.joggvorbis.*
+io.vacco.jsonbeans.*
+io.vacco.jtinn.*
+io.vacco.jukf.*
+io.vacco.kimaris.*
+io.vacco.kvnode.*
+io.vacco.leraikha.*
+io.vacco.libvirt.*
+io.vacco.metolithe.*
+io.vacco.murmux.*
+io.vacco.oriax.*
+io.vacco.orobas.*
+io.vacco.oruzka.*
+io.vacco.oss.gitflow.*
+io.vacco.purson.*
+io.vacco.ronove.*
+io.vacco.rwkv.*
+io.vacco.sabnock.*
+io.vacco.savitzky-golay.*
+io.vacco.scopicro.initramfs.*
+io.vacco.shax.*
+io.vacco.uvcj.*
+io.vacco.vapula.*
+io.vacco.volach.*
+io.vacco.ziminiar.*
+io.validly.*
+io.vamp.*
+io.vangogiel.*
+io.vangogiel.toffee.*
+io.vanillabp.*
+io.vanslog.*
+io.vantiq.*
+io.varietas.*
+io.vasilev.*
+io.vavr.*
+io.veep.android.*
+io.vegafusion.*
+io.velocitycareerlabs.*
+io.vena.*
+io.vena.bosk.*
+io.venable.amazonaws.*
+io.venuu.*
+io.verik.*
+io.verizon.ark.*
+io.verizon.delorean.*
+io.verizon.ermine.*
+io.verizon.helm.*
+io.verizon.journal.*
+io.verizon.knobs.*
+io.verizon.mutatis.*
+io.verizon.nelson.*
+io.verizon.quiver.*
+io.verniv.auth.*
+io.verniv.support.*
+io.vertigo.*
+io.vertx.*
+io.viascom.devutils.*
+io.viascom.discord.bot.*
+io.vilt.minium.*
+io.vilt.minium.developer.*
+io.vilt.minium.tools.*
+io.vilya.*
+io.vinyldns.*
+io.viper.*
+io.virtdata.*
+io.virtualan.*
+io.vitess.*
+io.vithor.danger.plugins.*
+io.vlingo.*
+io.vlingo.xoom.*
+io.vlinx.*
+io.voiapp.android.*
+io.voiapp.android.buildscripts.*
+io.volcanolabs.*
+io.voucherify.android.client.*
+io.voucherify.client.*
+io.vproxy.*
+io.vpv.saml.meta.*
+io.vpv.saml.metadata.*
+io.vtom.*
+io.vulpine.lib.*
+io.warp10.*
+io.waseem.*
+io.wavebeans.*
+io.waveshaper.*
+io.waylay.influxdb.*
+io.waylay.kairosdb.*
+io.wcm.*
+io.wcm.caravan.*
+io.wcm.caravan.maven.*
+io.wcm.caravan.maven.plugins.*
+io.wcm.cq5.*
+io.wcm.devops.*
+io.wcm.devops.conga.*
+io.wcm.devops.conga.definitions.*
+io.wcm.devops.conga.plugins.*
+io.wcm.devops.jenkins.*
+io.wcm.devops.maven.*
+io.wcm.devops.maven.plugins.*
+io.wcm.maven.*
+io.wcm.maven.archetypes.*
+io.wcm.maven.plugins.*
+io.wcm.maven.release-policies.*
+io.wcm.maven.skins.*
+io.wcm.osgi.wrapper.*
+io.wcm.qa.*
+io.wcm.samples.*
+io.wcm.tooling.commons.*
+io.wcm.tooling.netbeans.*
+io.wcm.tooling.nodetypes.*
+io.wcm.tooling.spotbugs.*
+io.weaviate.*
+io.weavr.components.*
+io.web3service.*
+io.webcrank.*
+io.webdevice.*
+io.webdevice.scenarios.*
+io.webfolder.*
+io.webinv.*
+io.webservices.api.*
+io.webthings.*
+io.weex.*
+io.whelk.asciidoc.*
+io.whelk.flesch.kincaid.*
+io.whelk.hy.phen.*
+io.whelk.spring.data.logging.*
+io.whileaway.code.summer.*
+io.whitesource.*
+io.whitfin.*
+io.wia.*
+io.williamwebb.auto.stub.*
+io.winkelmann.*
+io.winterframework.*
+io.winterframework.dist.*
+io.winterframework.mod.*
+io.winterframework.tool.*
+io.wiretest.*
+io.wisetime.*
+io.wizzie.*
+io.wizzie.enricher.*
+io.wizzie.metrics.*
+io.wizzie.normalizer.*
+io.wkz.kotlin.*
+io.wonderfuel.fueldb.*
+io.woo.*
+io.woong.bindkit.*
+io.woong.buildconfig.*
+io.woong.compose.grid.*
+io.woong.savedstate.*
+io.woong.scissors.*
+io.woong.shapedimageview.*
+io.woong.snappicker.*
+io.woong.toaster.*
+io.woong.wheelpicker.*
+io.workflowengine.*
+io.wtsky.dropwizard.*
+io.wttech.graal.templating.*
+io.wttech.habit.*
+io.wttech.markuply.*
+io.x22x22.*
+io.xcelite.spreadsheet.*
+io.xdag.*
+io.xenn.*
+io.xiandan.*
+io.xiaper.*
+io.xlate.*
+io.xocore.*
+io.xorum.*
+io.xpipe.*
+io.xpring.*
+io.xream.internal-util.*
+io.xream.reliable.*
+io.xream.rey.*
+io.xream.sqli.*
+io.xream.sspoin.*
+io.xream.x7.*
+io.xskipper.*
+io.xspec.*
+io.xspec.maven.*
+io.xtech.babel.*
+io.xuxiaowei.security.*
+io.xuxiaowei.security.next.*
+io.yaktor.*
+io.yaoling.*
+io.yaoling.common.*
+io.yaoling.starter.*
+io.yarpc.*
+io.yawp.*
+io.yegair.*
+io.yegair.jom.*
+io.yggdrash.*
+io.yielder.binding.*
+io.yosemiteblockchain.*
+io.youi.*
+io.ytcode.*
+io.yupiik.*
+io.yupiik.alveoli.*
+io.yupiik.batch.*
+io.yupiik.fusion.*
+io.yupiik.gallop.*
+io.yupiik.jaas.*
+io.yupiik.kubernetes.*
+io.yupiik.logging.*
+io.yupiik.maven.*
+io.yupiik.uship.*
+io.yupiik.yuc.*
+io.zahori.*
+io.zahori.tms.*
+io.zatarox.*
+io.zatarox.satellite.*
+io.zbus.*
+io.zeebe.*
+io.zeebe.bpmn-spec.*
+io.zeebe.hazelcast.*
+io.zeebe.redis.*
+io.zeebe.spring.*
+io.zeebe.spring.examples.*
+io.zeebe.spring.root.*
+io.zeebe.zeeqs.*
+io.zeitwert.*
+io.zeko.*
+io.zeleo.application.*
+io.zenoh.*
+io.zensend.*
+io.zeplin.rally.*
+io.zerocopy.json.*
+io.zerocopy.maven.plugins.*
+io.zestic.*
+io.zhijian.*
+io.zhkv.api.*
+io.zhudy.duic.*
+io.zhudy.kitty.*
+io.zink.*
+io.zipkin.*
+io.zipkin.aws.*
+io.zipkin.azure.*
+io.zipkin.brave.*
+io.zipkin.brave.cassandra.*
+io.zipkin.brave.karaf.*
+io.zipkin.brave.play.*
+io.zipkin.brave.ratpack.*
+io.zipkin.centralsync-maven-plugin.*
+io.zipkin.classic.*
+io.zipkin.contrib.brave.*
+io.zipkin.contrib.zipkin-secondary-sampling.*
+io.zipkin.contrib.zipkin-storage-forwarder.*
+io.zipkin.contrib.zipkin-storage-kafka.*
+io.zipkin.dependencies.*
+io.zipkin.finagle.*
+io.zipkin.finagle2.*
+io.zipkin.gcp.*
+io.zipkin.java.*
+io.zipkin.layout.*
+io.zipkin.proto3.*
+io.zipkin.reporter.*
+io.zipkin.reporter2.*
+io.zipkin.sparkstreaming.*
+io.zipkin.ui.*
+io.zipkin.zipkin2.*
+io.ziqni.*
+io.zksync.*
+io.zksync.sdk.*
+io.zman.*
+io.zocks.*
+io.zold.*
+io.zonky.test.*
+io.zonky.test.postgres.*
+io.zonky.util.*
+io.zoopaz.*
+io.zrz.psqlwriter.*
+io.zrz.rtcore.sip.*
+io.zulia.*
+iq.fib.payments.*
+ir.a2mo.*
+ir.a2mo.lib.*
+ir.abrin.*
+ir.ac.iust.*
+ir.aliap1376.lib.*
+ir.bitrah.*
+ir.boommarket.*
+ir.cafebabe.*
+ir.cafebabe.math.utils.*
+ir.cafebabe.ninja.*
+ir.daal.*
+ir.ghasemkiani.*
+ir.huri.*
+ir.iais.sana.*
+ir.jibit.*
+ir.king-app.*
+ir.mahozad.android.*
+ir.mahozad.multiplatform.*
+ir.malv.utils.*
+ir.map.*
+ir.mbaas.*
+ir.metrix.*
+ir.metrix.analytics.*
+ir.metrix.attribution.*
+ir.metrix.deeplink.*
+ir.metrix.internal.*
+ir.metrix.lifecycle.*
+ir.metrix.notification.*
+ir.metrix.push.*
+ir.metrix.referrer.*
+ir.metrix.trusted.*
+ir.metrix.utils.*
+ir.mobintabaran.android.*
+ir.mohammadesteki.*
+ir.moke.jca.*
+ir.moke.yaja.*
+ir.sadeghpro.*
+ir.samanjafari.easycountdowntimer.*
+ir.siaray.*
+ir.smartech.intrack.*
+ir.sotoon.ai.*
+ir.tapsell.*
+ir.tapsell.mediation.*
+ir.tapsell.mediation.adapter.*
+ir.tapsell.plus.*
+ir.tapsell.sdk.*
+ir.twostepverification.sdk.*
+ir.unilogic.common.*
+is.ashley.*
+is.cir.*
+is.hth.*
+is.leap.android.*
+is.leap.android.aui.*
+is.leap.android.core.*
+is.leap.android.creator.*
+is.rebbi.*
+is.solidninja.albion.*
+is.solidninja.openshift.*
+is.solidninja.schemaregistry.*
+is.tagomor.woothee.*
+is.wednesday.*
+is.yaks.*
+isorelax.*
+it.agilelab.*
+it.agilelab.bigdata.spark.*
+it.agilelab.log4j.*
+it.aleven.*
+it.amattioli.*
+it.amattioli.archetypes.*
+it.andreuzzi.*
+it.anyplace.sync.*
+it.anyplace.web.*
+it.appspice.*
+it.assist.jrecordbind.*
+it.atcetera.*
+it.axians.*
+it.bancaditalia.oss.*
+it.bancaditalia.oss.vtl.*
+it.bartelloni.*
+it.bitbl.*
+it.burning.*
+it.bz.opendatahub.alpinebits.*
+it.cd79.*
+it.changetracker.sdk.*
+it.christianlusardi.*
+it.cnr.*
+it.cnr.iac.*
+it.cnr.iit.jscontact.*
+it.cnr.istc.stlab.*
+it.cnr.isti.domoware.*
+it.cnr.isti.domoware.cyberdomo.*
+it.cnr.isti.domoware.tinyos.*
+it.cnr.si.*
+it.cnr.si.alfresco.*
+it.cnr.si.cool.*
+it.cnr.si.cool.jconon.*
+it.cnr.si.sigla.*
+it.cnr.si.sprint.*
+it.cnr.si.storage.*
+it.codiceinsicuro.*
+it.concept.pin.*
+it.cosenonjaviste.*
+it.could.*
+it.czerwinski.*
+it.czerwinski.android.*
+it.czerwinski.android.hilt.*
+it.czerwinski.android.lifecycle.*
+it.czerwinski.android.room.*
+it.davidepedone.*
+it.dontesta.labs.liferay.portal.db.*
+it.dontesta.labs.liferay.salesforce.client.soap.*
+it.dontesta.sugarcrm.client.soap.*
+it.eng.ds.*
+it.eng.spago.*
+it.enricocandino.*
+it.esinware.*
+it.espr.*
+it.espr.jsonldparser.*
+it.espr.parsers.*
+it.ethiclab.depcal.*
+it.fabioformosa.*
+it.fabioformosa.quartz-manager.*
+it.fabricalab.streaming.*
+it.fattureincloud.*
+it.firegloves.*
+it.francescosantagati.*
+it.freshminutes.*
+it.futurecraft.*
+it.germanorizzo.ws4sqlite.*
+it.grabz.grabzit.*
+it.greyfox.*
+it.hackubau.*
+it.imolinfo.maven.plugins.*
+it.innove.*
+it.inspiredsoft.*
+it.intre.*
+it.iosue.federico.android.*
+it.javalinux.sibilla.*
+it.javalinux.sibilla.plugins.*
+it.jnrpe.yaclp.*
+it.kamaladafrica.*
+it.kiwibit.*
+it.krzeminski.*
+it.krzeminski.vis-assert.*
+it.krzeminski.ycp.*
+it.larus-ba.*
+it.lucichkevin.*
+it.maconsultingitalia.keycloak.*
+it.mauxilium.*
+it.micegroup.*
+it.micegroup.displaytag.*
+it.micegroup.voila.runtime.*
+it.mineblock.mbcore.*
+it.moveax.sdkboilerplate.*
+it.mscuttari.kaoldb.*
+it.mulders.clocky.*
+it.mulders.puml.*
+it.mulders.spark-flash.*
+it.mulders.stryker.*
+it.multicoredev.*
+it.multicoredev.mbcore.bungeecord.*
+it.multicoredev.mbcore.spigot.*
+it.multicoredev.mclib.*
+it.n-ess.queryable.*
+it.neokree.*
+it.nerdammer.*
+it.nerdammer.bigdata.*
+it.netgrid.*
+it.netgrid.got.*
+it.nicolasanti.*
+it.nicolasfarabegoli.*
+it.nicolasfarabegoli.conventional-commits.*
+it.nicolasfarabegoli.pulverization-crowd.*
+it.nicolasfarabegoli.pulverization-framework.*
+it.nicolasfarabegoli.pulverization.crowdroom.*
+it.orlov.iuliia.*
+it.osys.*
+it.overzoom.*
+it.ozimov.*
+it.polimi.genomics.*
+it.polimi.lucananni.*
+it.polimi.spf.*
+it.ratelim.*
+it.rebase.*
+it.rebirthproject.*
+it.redss.*
+it.reify.*
+it.relime.*
+it.revarmygaming.ragcore.*
+it.sauronsoftware.cron4j.*
+it.schm.keycloak.*
+it.schm.magnolia.*
+it.scoppelletti.spaceship.*
+it.sephiroth.*
+it.sephiroth.android.exif.*
+it.sephiroth.android.library.*
+it.sephiroth.android.library.ab.*
+it.sephiroth.android.library.android.*
+it.sephiroth.android.library.asm.*
+it.sephiroth.android.library.bottomnavigation.*
+it.sephiroth.android.library.cache.*
+it.sephiroth.android.library.debuglog.*
+it.sephiroth.android.library.disklruimagecache.*
+it.sephiroth.android.library.disklrumulticache.*
+it.sephiroth.android.library.easing.*
+it.sephiroth.android.library.exif.*
+it.sephiroth.android.library.floatingmenu.*
+it.sephiroth.android.library.fork.*
+it.sephiroth.android.library.fork.actionbarpulltorefresh.*
+it.sephiroth.android.library.fork.grid.*
+it.sephiroth.android.library.fork.listviewanimations.*
+it.sephiroth.android.library.fork.slideexpandable.*
+it.sephiroth.android.library.hlistviewanimations.*
+it.sephiroth.android.library.horizontallistview.*
+it.sephiroth.android.library.imagezoom.*
+it.sephiroth.android.library.media.*
+it.sephiroth.android.library.overlaymenu.*
+it.sephiroth.android.library.picasso.*
+it.sephiroth.android.library.rangeseekbar.*
+it.sephiroth.android.library.simplelogger.*
+it.sephiroth.android.library.subtlerater.*
+it.sephiroth.android.library.targettooltip.*
+it.sephiroth.android.library.uigestures.*
+it.sephiroth.android.library.viewrevealanimator.*
+it.sephiroth.gradle.plugin.*
+it.sephiroth.hugo.*
+it.sephiroth.hunter.*
+it.serendigity.maven.parent.*
+it.serendigity.maven.plugins.*
+it.session.maven.*
+it.session.maven.plugins.*
+it.shifty.*
+it.siegert.*
+it.sisal.bill.*
+it.skrape.*
+it.slyce.*
+it.snada.*
+it.solutionsexmachina.*
+it.subito.*
+it.svario.xpathapi.*
+it.swim.*
+it.techgap.*
+it.thomasjohansen.*
+it.thomasjohansen.launcher.*
+it.thomasjohansen.warbuddy.*
+it.thomasjohansen.weblauncher.*
+it.tidalwave.*
+it.tidalwave.accounting.*
+it.tidalwave.betterbeansbinding.*
+it.tidalwave.blueargyle.*
+it.tidalwave.bluebill.*
+it.tidalwave.bluebill.android.*
+it.tidalwave.bluebook.*
+it.tidalwave.bluebook.bluebook.1.0.it.tidalwave.bluebook.*
+it.tidalwave.bluemarine.*
+it.tidalwave.bluemarine.boot.*
+it.tidalwave.bluemarine2.*
+it.tidalwave.bluemarine2.testsets.*
+it.tidalwave.blueshades.*
+it.tidalwave.dummy.*
+it.tidalwave.fork.com.jayway.maven.plugins.android.generation2.*
+it.tidalwave.geo.*
+it.tidalwave.geo.examples.*
+it.tidalwave.image.*
+it.tidalwave.imageio.*
+it.tidalwave.infoglueexporter.*
+it.tidalwave.maven.*
+it.tidalwave.metadata.*
+it.tidalwave.netbeans.*
+it.tidalwave.netbeans.boot.*
+it.tidalwave.northernwind.*
+it.tidalwave.northernwind.rca.*
+it.tidalwave.semantic.*
+it.tidalwave.solidblue.*
+it.tidalwave.solidblue2.*
+it.tidalwave.solidblue3.*
+it.tidalwave.steelblue.*
+it.tidalwave.superpom.*
+it.tidalwave.thesefoolishthings.*
+it.tidalwave.vaadin.*
+it.traeck.tools.json-merge.*
+it.traeck.tools.openapi.*
+it.trvi.*
+it.twenfir.*
+it.uliana.hazelcastshell.*
+it.unibo.alchemist.*
+it.unibo.alice.tuprolog.*
+it.unibo.apice.scafiteam.*
+it.unibo.coordaas.*
+it.unibo.jakta.*
+it.unibo.pulvreakt.*
+it.unibo.scafi.*
+it.unibo.tucson.*
+it.unibo.tuprolog.*
+it.unibo.tuprolog.argumentation.*
+it.unibz.inf.ontop.*
+it.unich.jgmp.*
+it.unich.jppl.*
+it.unich.scalafix.*
+it.unife.endif.ml.*
+it.unife.ml.*
+it.unimi.di.*
+it.unimi.di.law.*
+it.unimi.dsi.*
+it.unimib.disco.essere.*
+it.unipd.dei.*
+it.unipi.di.acube.*
+it.uniroma1.dis.wsngroup.gexf4j.*
+it.uniroma2.art.coda.*
+it.uniroma2.art.lime.*
+it.uniroma2.art.maple.*
+it.uniroma2.art.owlart.*
+it.uniroma2.art.owlart.sesame2impl.*
+it.uniroma2.art.semanticturkey.*
+it.uniroma2.art.sheet2rdf.*
+it.unitn.disi.*
+it.unitn.disi.languageutils.*
+it.univr.bcel.*
+it.vige.*
+it.vige.cities.*
+it.vige.wildfly.*
+it.xaan.*
+it.xabaras.android.*
+it.xabaras.android.espresso.*
+it.xabaras.android.logger.*
+it.yobibit.*
+it.zenitlab.*
+it.zielke.*
+it.zlays.*
+itext.*
+ivory.*
+izpack.*
+jaas.*
+jackcess.*
+jackson.*
+jacl.*
+jaf.*
+jaimbot.*
+jakarta-regexp.*
+jakarta.activation.*
+jakarta.annotation.*
+jakarta.authentication.*
+jakarta.authorization.*
+jakarta.batch.*
+jakarta.data.*
+jakarta.ejb.*
+jakarta.el.*
+jakarta.enterprise.*
+jakarta.enterprise.concurrent.*
+jakarta.enterprise.deploy.*
+jakarta.faces.*
+jakarta.inject.*
+jakarta.interceptor.*
+jakarta.jms.*
+jakarta.json.*
+jakarta.json.bind.*
+jakarta.jws.*
+jakarta.mail.*
+jakarta.management.j2ee.*
+jakarta.mvc.*
+jakarta.mvc.tck.*
+jakarta.nosql.*
+jakarta.nosql.communication.*
+jakarta.nosql.mapping.*
+jakarta.nosql.tck.*
+jakarta.nosql.tck.communication.*
+jakarta.nosql.tck.communication.driver.*
+jakarta.nosql.tck.mapping.*
+jakarta.persistence.*
+jakarta.platform.*
+jakarta.resource.*
+jakarta.security.auth.message.*
+jakarta.security.enterprise.*
+jakarta.security.jacc.*
+jakarta.servlet.*
+jakarta.servlet.jsp.*
+jakarta.servlet.jsp.jstl.*
+jakarta.transaction.*
+jakarta.validation.*
+jakarta.websocket.*
+jakarta.ws.rs.*
+jakarta.xml.bind.*
+jakarta.xml.registry.*
+jakarta.xml.rpc.*
+jakarta.xml.soap.*
+jakarta.xml.ws.*
+jalopy.*
+james.*
+janino.*
+jardiff.*
+jarjar.*
+jarsync.*
+jasper-jsr199.*
+jasperreports.*
+java2html.*
+java3d.*
+java_cup.*
+javacc.*
+javaconfig.*
+javadb.*
+javadoc.*
+javaee.*
+javagroups.*
+javainetlocator.*
+javamail.*
+javancss.*
+javanettasks.*
+javassist.*
+javatar.*
+javax.*
+javax.activation.*
+javax.annotation.*
+javax.batch.*
+javax.cache.*
+javax.cache.implementation.*
+javax.ccpp.*
+javax.comm.*
+javax.ejb.*
+javax.el.*
+javax.enterprise.*
+javax.enterprise.concurrent.*
+javax.enterprise.deploy.*
+javax.faces.*
+javax.help.*
+javax.inject.*
+javax.interceptor.*
+javax.j2ee.*
+javax.javaee.*
+javax.jbi.*
+javax.jcr.*
+javax.jdo.*
+javax.jmdns.*
+javax.jms.*
+javax.json.*
+javax.json.bind.*
+javax.jts.*
+javax.jws.*
+javax.mail.*
+javax.management.*
+javax.management.j2ee.*
+javax.measure.*
+javax.media.*
+javax.money.*
+javax.mvc.*
+javax.naming.*
+javax.net.websocket.*
+javax.persistence.*
+javax.portlet.*
+javax.resource.*
+javax.sdp.*
+javax.security.*
+javax.security.auth.message.*
+javax.security.enterprise.*
+javax.security.jacc.*
+javax.servlet.*
+javax.servlet.jsp.*
+javax.servlet.jsp.jstl.*
+javax.sip.*
+javax.slee.*
+javax.sql.*
+javax.transaction.*
+javax.transaction.cdi.*
+javax.usb.*
+javax.validation.*
+javax.vecmath.*
+javax.visrec.*
+javax.websocket.*
+javax.ws.rs.*
+javax.xml.*
+javax.xml.bind.*
+javax.xml.crypto.*
+javax.xml.parsers.*
+javax.xml.registry.*
+javax.xml.rpc.*
+javax.xml.soap.*
+javax.xml.stream.*
+javax.xml.ws.*
+javazoom.*
+javolution.*
+jawin.*
+jaxb.*
+jaxen.*
+jaxme.*
+jaxr-ra.*
+jblanket.*
+jboss.*
+jboss.jaxbintros.*
+jca.*
+jcache.*
+jcharts.*
+jcifs.*
+jcom.*
+jcommon.*
+jcoverage.*
+jcs-javagroups.*
+jcs.*
+jcvsii.*
+jdbc.*
+jdbm.*
+jdepend.*
+jdiff.*
+jdo.*
+jdom.*
+jdring.*
+jdsl.*
+je.dvs.echo.*
+jen.*
+jencks.*
+jep.*
+jepi.*
+jersey.*
+jetty.*
+jexcelapi.*
+jface.*
+jfree.*
+jfreechart.*
+jgoodies.*
+jgraph.*
+jgrapht.*
+jgroups.*
+jhunlang.*
+jini.*
+jintention.*
+jisp.*
+jivesoftware.*
+jlibdiff.*
+jline.*
+jmagick.*
+jmaki.*
+jmdns.*
+jmimemagic.*
+jmml.*
+jmock.*
+jms.*
+jmscts.*
+jmsn.*
+joda-time.*
+john-test.*
+jotm.*
+jp.ac.waseda.*
+jp.ac.waseda.cs.washi.*
+jp.alessandro.android.*
+jp.blackawa.*
+jp.bucketeer.*
+jp.classmethod.*
+jp.co.acroquest.acromusashi.*
+jp.co.ap-com.*
+jp.co.bizreach.*
+jp.co.ctc-g.jfw.*
+jp.co.cyberagent.aeromock.*
+jp.co.cyberagent.android.*
+jp.co.cyberagent.android.gpuimage.*
+jp.co.cyberagent.hive.*
+jp.co.cyberagent.katalog.*
+jp.co.cyberagent.lounge.*
+jp.co.cyberagent.valor.*
+jp.co.epea.*
+jp.co.freee.*
+jp.co.future.*
+jp.co.genestream.*
+jp.co.metabolics.*
+jp.co.nohana.*
+jp.co.ntt.oss.heapstats.*
+jp.co.paygent.*
+jp.co.recruit_mp.*
+jp.co.soramitsu.*
+jp.co.tagbangers.*
+jp.co.tis.gsp.*
+jp.co.worksap.jax_rs.*
+jp.co.worksap.message.wrapper.*
+jp.co.worksap.oss.*
+jp.co.worksap.workspace.*
+jp.co.yahoo.api-ads.*
+jp.co.yahoo.dataplatform.config.*
+jp.co.yahoo.dataplatform.mds.*
+jp.co.yahoo.dataplatform.schema.*
+jp.co.yahoo.yosegi.*
+jp.coppermine.*
+jp.dodododo.*
+jp.dodododo.janerics.*
+jp.elestyle.*
+jp.empressia.*
+jp.fintan.keel.*
+jp.furyu.*
+jp.go.aist.six.oval.*
+jp.go.aist.six.util.*
+jp.go.aist.six.vuln.*
+jp.gopay.*
+jp.gr.java_conf.kazsharp.*
+jp.igapyon.amateras.stepcounter.*
+jp.igapyon.blanco.apex.formatter.*
+jp.igapyon.blanco.apex.formatter.cli.*
+jp.igapyon.blanco.apex.formatter.plugin.*
+jp.igapyon.blanco.apex.parser.*
+jp.igapyon.blanco.apex.syntaxparser.*
+jp.igapyon.blanco.cg.*
+jp.igapyon.blanco.commons.*
+jp.igapyon.commons.*
+jp.igapyon.diary.*
+jp.igapyon.diary.igapyonv3.plugin.*
+jp.igapyon.oiyokan.*
+jp.igapyon.rsvr.jdbc.*
+jp.joao.*
+jp.jun_nama.*
+jp.karaden.*
+jp.ken1ma.*
+jp.kukv.*
+jp.kukv.ktor-extension-plugins.*
+jp.leafytree.gradle.*
+jp.mixi.*
+jp.ne.opt.*
+jp.ne.paypay.*
+jp.nephy.*
+jp.objectfanatics.*
+jp.openstandia.*
+jp.openstandia.connector.*
+jp.openstandia.guacamole.*
+jp.openstandia.midpoint-grpc.*
+jp.pay.*
+jp.pizzafactory.maven.*
+jp.pocket-change.pokepay.android-sdk.*
+jp.pois.*
+jp.preferred.menoh.*
+jp.qpg.*
+jp.sf.amateras.*
+jp.sf.amateras.mirage.*
+jp.skypencil.*
+jp.skypencil.config.*
+jp.skypencil.errorprone.slf4j.*
+jp.skypencil.findbugs.slf4j.*
+jp.skypencil.guava.*
+jp.skypencil.java-diff-utils.*
+jp.skypencil.sonarqube.*
+jp.sourceforge.spring-ext.*
+jp.spring-boot-reference.*
+jp.studyplus.android.sdk.*
+jp.t2v.*
+jp.tomorrowkey.*
+jp.tomorrowkey.gradle.notifier.*
+jp.try0.wicket.*
+jp.urgm.*
+jp.vmi.*
+jp.wasabeef.*
+jp.wasabeef.transformers.*
+jp.webpay.*
+jp.webpay.android.*
+jp.westbrook.android.*
+jparsec.*
+jpl.*
+jpox-dbcp.*
+jpox-enhancer.*
+jpox-java5.*
+jpox.*
+jrexx.*
+jrms.*
+jrobin.*
+jruby.*
+jsch.*
+jsf-extensions.*
+jspapi.*
+jsptags.*
+jstl.*
+jstyle.*
+jta.*
+jtds.*
+jtidy.*
+jug.*
+jung.*
+junit-addons.*
+junit-doclet.*
+junit.*
+junitperf.*
+juno.*
+jwebunit.*
+jxta.*
+jython.*
+kawa.*
+kg.apc.*
+kg.net.bazi.gsb4j.*
+kh.com.ipay88.sdk.*
+kh.gov.nbc.bakong_khqr.*
+kh.org.nbc.bakong_khqr.*
+kh.org.nbc.test-lib.*
+kim.donghwan.*
+kim.hanjie.common.*
+kim.nzxy.*
+kim.pmj.develop.*
+kim.sesame.framework.*
+kim.wind.*
+kim.zkp.*
+kiwi.orbit.compose.*
+koeln.niemeier.*
+kohsuke.*
+kr.ac.kaist.ir.*
+kr.bydelta.*
+kr.co.jacknife.*
+kr.co.kdsoft.droidlib.*
+kr.co.linkhub.*
+kr.co.mightymedia.*
+kr.co.plasticcity.*
+kr.co.prnd.*
+kr.co.smartstudy.*
+kr.co.vcnc.haeinsa.*
+kr.devdogs.*
+kr.devis.util.entityprinter.*
+kr.devis.util.offsetpaginator.*
+kr.dogfoot.*
+kr.entree.*
+kr.geun.logback.*
+kr.ikhoon.armeria.*
+kr.ikhoon.scalapb-reactor.*
+kr.jadekim.*
+kr.jclab.*
+kr.jclab.graphql.*
+kr.jclab.grpcover.*
+kr.jclab.grpcoverwebsocket.*
+kr.jclab.javautils.*
+kr.jclab.mux.*
+kr.jclab.netty.*
+kr.jclab.sipc.*
+kr.jclab.spring.*
+kr.jmlab.*
+kr.kyg.utils.*
+kr.motd.gradle.*
+kr.motd.javaagent.*
+kr.motd.maven.*
+kr.motto.*
+kr.pe.kwonnam.dynamicql.*
+kr.pe.kwonnam.freemarker.*
+kr.pe.kwonnam.freemarkerdynamicqlbuilder.*
+kr.pe.kwonnam.hibernate4memcached.*
+kr.pe.kwonnam.jsp.*
+kr.pe.kwonnam.slf4j-lambda.*
+kr.pe.kwonnam.spymemcached-extra-transcoders.*
+kr.pe.kwonnam.underscorebuilder.*
+kr.sparkweb.*
+kxml.*
+kxml2.*
+ky.korins.*
+kz.airbapay.*
+kz.allpay.mfs.*
+kz.btsd.*
+kz.greetgo.*
+kz.greetgo.cached.*
+kz.greetgo.class_scanner.*
+kz.greetgo.conf.*
+kz.greetgo.db.*
+kz.greetgo.depinject.*
+kz.greetgo.kafka.*
+kz.greetgo.logging.*
+kz.greetgo.mvc.*
+kz.greetgo.mybpm.*
+kz.greetgo.plugins.*
+kz.greetgo.security.*
+kz.greetgo.spring.*
+kz.greetgo.type_script.*
+kz.greetgo.util.*
+kz.greetgo.xml.*
+kz.idsoftware.bip.*
+kz.idsoftware.force.api.*
+kz.idsoftware.maven.plugins.*
+kz.idsoftware.sforce.*
+kz.idsoftware.util.*
+kz.jetpay.*
+kz.kesh.*
+la.alsocan.*
+la.renzhen.basis.*
+la.renzhen.basis.rtpt.*
+la.serendipity.*
+la.vui.api.*
+land.sungbin.*
+land.sungbin.android.autosigning.*
+land.sungbin.android.autosigning.plugin.*
+land.sungbin.composable.reference.suppressor.*
+land.sungbin.dependency.graph.*
+land.sungbin.dependency.graph.plugin.*
+land.sungbin.dependency.handler.extensions.*
+land.sungbin.gfm.*
+land.sungbin.github.upload.*
+land.sungbin.gradle.*
+land.sungbin.kotlin.dataclass.nocopy.*
+land.sungbin.kotlin.dataclass.nocopy.plugin.*
+land.sungbin.runnerbe.*
+land.sungbin.sat.*
+land.vani.mcorouhlin.*
+land.vani.mockpaper.*
+lc.kra.system.*
+ldapd-common.*
+ldapsdk.*
+lgbt.princess.*
+li.allan.*
+li.chee.vertx.*
+li.flor.*
+li.moskito.*
+li.naska.springejbautowiring.*
+li.pika.*
+li.pitschmann.*
+li.rudin.arduino.*
+li.rudin.bootstrap.*
+li.rudin.cdi.*
+li.rudin.core.*
+li.rudin.jjst.*
+li.rudin.jooq.*
+li.rudin.mavenjs.*
+li.rudin.mv.*
+li.rudin.parent.*
+li.rudin.pid.*
+li.rudin.rt.*
+li.rudin.scheduler.*
+li.rudin.svgdatabind.*
+li.rudin.webdoc.*
+li.strolch.*
+li.xiangyang.platformo.*
+life.725.*
+life.aastha.communication.*
+life.expert.*
+life.itzn.*
+life.knowledge4.*
+lingo.*
+link.bek.tools.*
+link.jfire.*
+link.luyu.*
+link.magic.*
+link.thingscloud.*
+link.webarata3.dro.common.*
+link.webarata3.kexcelapi.*
+link.zhangfei.*
+live.100ms.*
+live.argot.*
+live.attach.sdk.*
+live.autu.*
+live.connector.*
+live.ditto.*
+live.fanxing.*
+live.lingting.*
+live.lingting.components.*
+live.lingting.dependencies.*
+live.lumia.*
+live.midreamsheep.swcj.*
+live.osione.*
+live.pbj.sdk.*
+live.radix.*
+live.videosdk.*
+live.xiaoxu.*
+lk.chathurabuddi.*
+lk.klass.*
+lk.vivoxalabs.customstage.*
+locc.*
+log4j.*
+log4unit.*
+logkit.*
+lol.eicar.*
+lol.hub.*
+lol.hyper.*
+lol.maki.pathfinder.*
+loom.*
+love.forte.*
+love.forte.annotation-tool.*
+love.forte.annotationTool.*
+love.forte.catcode2.*
+love.forte.common.*
+love.forte.di.*
+love.forte.gradle.common.*
+love.forte.kron.*
+love.forte.nacos4k.*
+love.forte.plugin.suspend-transform.*
+love.forte.simbot.*
+love.forte.simbot.archetypes.*
+love.forte.simbot.boot.*
+love.forte.simbot.component.*
+love.forte.simbot.util.*
+love.forte.simple-robot-component.*
+love.forte.simple-robot-module.*
+love.forte.simple-robot.*
+love.forte.simple-robot.http.*
+love.forte.simple-robot.serialization.*
+love.forte.simple-robot.time-task.*
+love.forte.simple-robotx.*
+love.kill.*
+love.liuwen.*
+love.nuoyan.android.*
+love.openapi.*
+lpg.runtime.*
+lt.dvim.authors.*
+lt.dvim.ciris-hocon.*
+lt.dvim.citywasp.*
+lt.dvim.hof.*
+lt.dvim.polyfact.*
+lt.dvim.sssio.*
+lt.dvim.yabai.*
+lt.marsrutai.*
+lt.saltyjuice.dragas.*
+lt.saltyjuice.dragas.utility.*
+lt.tokenmill.*
+lt.tokenmill.crawling.*
+lt.tokenmill.uima.*
+lt.velykis.maven.*
+lt.velykis.maven.skins.*
+ltd.dolink.*
+ltd.dolink.arch.*
+ltd.fdsa.*
+ltd.hongyu.*
+ltd.icecold.*
+ltd.k1nd.*
+ltd.liuzhi.rhyme.*
+ltd.vastchain.*
+lu.greenhalos.*
+lu.intech.*
+lu.uni.serval.*
+lucene.*
+lv.ailab.morphology.*
+lv.androiddev.*
+lv.ctco.cukes.*
+lv.ctco.cukesrest.*
+lv.ctco.scm.*
+lv.ctco.zephyr.*
+lv.draugiem.*
+lv.katise.*
+ly.appsocial.*
+ly.com.tahaben.*
+ly.count.*
+ly.count.android.*
+ly.count.android.plugins.upload-symbols.*
+ly.count.sdk.*
+ly.iterative.itly.*
+ly.iterative.mparticle.*
+ly.kite.*
+ly.stealth.*
+ly.warp.*
+ma.cy.*
+ma.glasnost.orika.*
+ma.hu.*
+ma.ju.fieldmask.*
+ma.markware.charybdis.*
+magicGball.*
+maps.hudson.plugins.*
+market.dreamer.build.android.*
+marmalade.*
+math.geom2d.*
+maven-javanet-plugin.*
+maven-new.*
+maven-plugins.*
+maven-proxy.*
+maven-taglib.*
+maven-validator.*
+maven.*
+maxq.*
+mckoi.*
+md.your.gradle.*
+me.16s.*
+me.2bab.*
+me.2bab.koncat.android.app.*
+me.2bab.koncat.android.lib.*
+me.2bab.koncat.jvm.*
+me.2bab.scratchpaper.*
+me.2bab.seal.*
+me.ablax.*
+me.actv8.*
+me.actv8.core.*
+me.adaptive.*
+me.adkhambek.elf.*
+me.adkhambek.gsa.*
+me.adkhambek.moon.*
+me.adkhambek.pack.*
+me.aflak.libraries.*
+me.ahoo.cocache.*
+me.ahoo.cosec.*
+me.ahoo.cosid.*
+me.ahoo.cosky.*
+me.ahoo.eventbus.*
+me.ahoo.govern.*
+me.ahoo.pigeon.*
+me.ahoo.simba.*
+me.ahoo.wow.*
+me.aifaq.*
+me.alb-i986.*
+me.alb-i986.cucumber.*
+me.alb-i986.selenium.*
+me.alexisevelyn.*
+me.alexjs.*
+me.alexpanov.*
+me.alidg.*
+me.alllex.parsus.*
+me.amiee.*
+me.amitburst.airball.*
+me.andrusha.*
+me.andrz.*
+me.andrz.findbugs.*
+me.andrz.jackson.*
+me.andrz.maven.*
+me.angrybyte.*
+me.angrybyte.blinkerview.*
+me.angrybyte.goose.*
+me.angrybyte.picker.*
+me.angrybyte.sillyandroid.*
+me.angrybyte.slider.*
+me.antinux.*
+me.appstud.appstrack.*
+me.archdev.*
+me.archinamon.*
+me.arminb.spidersilk.*
+me.arminb.spidersilk.samples.*
+me.asycc.*
+me.atam.*
+me.atlis.*
+me.atrox.haikunator.*
+me.axieum.java.compressum.*
+me.baghino.*
+me.bardy.*
+me.bazhenov.*
+me.bazhenov.groovy-shell.*
+me.bechberger.*
+me.bemind.customfont.*
+me.benoitguigal.*
+me.bhop.*
+me.binwang.scala2grpc.*
+me.binwang.streamz.*
+me.biubiubiu.autoview.*
+me.biubiubiu.coverloading.*
+me.biubiubiu.droprefreshview.*
+me.biubiubiu.justifytext.*
+me.biubiubiu.swipeactivity.*
+me.biubiubiu.zoomlistview.*
+me.blogram.*
+me.bo0tzz.*
+me.bradleysteele.*
+me.breidenbach.*
+me.broot.typedmap.*
+me.busr.*
+me.bvn13.*
+me.bvn13.fsm.*
+me.bvn13.kafka.health.*
+me.bvn13.openfeign.logger.*
+me.bvn13.sdk.android.gpx.*
+me.cafecode.*
+me.cafecode.espresso.*
+me.catcoder.*
+me.ccampo.*
+me.champeau.jdoctor.*
+me.champeau.jlangdetect.*
+me.champeau.openbeans.*
+me.chanjar.*
+me.chaopeng.chaosrx.*
+me.chaopeng.grchaos.*
+me.chatgame.mobilecg.*
+me.chenhe.*
+me.chipdeals.mytivi.*
+me.chongchong.*
+me.chrons.*
+me.chyxion.*
+me.chyxion.misc.*
+me.chyxion.summer.*
+me.chyxion.tigon.*
+me.chyxion.utils.*
+me.clutchy.*
+me.clutchy.dependenciesgen.*
+me.cmoz.gradle.*
+me.cmoz.grizzly.*
+me.codeboy.*
+me.codeboy.android.*
+me.codeboy.common.*
+me.codeplayer.*
+me.confuser.banmanager.*
+me.confuser.banmanager.BanManagerLibs.*
+me.cormoran.*
+me.corsin.javatools.*
+me.crypnotic.messagechannel.*
+me.cryptopay.*
+me.d-d.*
+me.d2o.statemachine.*
+me.danwi.kato.*
+me.danwi.sqlex.*
+me.darkeyedragon.*
+me.datafox.dfxengine.*
+me.davidthaler.*
+me.ddayo.*
+me.decimo.*
+me.decimo.app.*
+me.decimo.widget.*
+me.defying.chili.*
+me.dehasi.*
+me.dehasi.jenkins-pipeline-linter.*
+me.desair.tus.*
+me.devnatan.*
+me.dhf.*
+me.digi.*
+me.dinowernli.*
+me.dlkanth.*
+me.dm7.android.widget.*
+me.dm7.barcodescanner.*
+me.dm7.jrengage.android.*
+me.dmdev.premo.*
+me.dmdev.rxpm.*
+me.dmmax.akka.*
+me.doubledutch.*
+me.drakeet.*
+me.drakeet.agera.*
+me.drakeet.billing.*
+me.drakeet.fingertransparentview.*
+me.drakeet.floo.*
+me.drakeet.labelview.*
+me.drakeet.library.*
+me.drakeet.mailotto.*
+me.drakeet.materialdialog.*
+me.drakeet.multitype.*
+me.drakeet.oasisfeng.*
+me.drakeet.retrofit2.*
+me.drakeet.support.*
+me.drakeet.uiview.*
+me.drmaas.*
+me.drozdzynski.library.steppers.*
+me.dwtj.*
+me.dylandoamaral.*
+me.effegi.*
+me.ehp246.*
+me.eigenraven.java8unsupported.*
+me.ele.openapi.*
+me.elgregos.*
+me.elrod.*
+me.elyor.*
+me.emmano.*
+me.escoffier.fluid.*
+me.escoffier.forge.*
+me.escoffier.loom.*
+me.escoffier.vertx.*
+me.eugeniomarletti.*
+me.eugeniomarletti.kotlin.metadata.*
+me.fabriciorby.*
+me.fengy.*
+me.fhir.*
+me.figo.*
+me.fistpump.*
+me.fmeng.*
+me.fo0.example.*
+me.franfernandez.*
+me.friwi.*
+me.frmr.dependon.*
+me.frmr.giterrific.*
+me.frmr.giterrific.extras.*
+me.frmr.jsonutils.*
+me.frmr.kafka.*
+me.frmr.newrelic.*
+me.frmr.stripe.*
+me.frmr.wepay-scala.*
+me.fycz.maple.*
+me.gaigeshen.mybatis.*
+me.gaigeshen.wechat.*
+me.geso.*
+me.geso.apimock.*
+me.geso.avans.*
+me.geso.dbinspector.*
+me.geso.esmapper.*
+me.geso.jdbcquerylog.*
+me.geso.jdbctracer.*
+me.geso.jolokia_jvm_agent_retry.*
+me.geso.string_filter.*
+me.geso.tinyconfig.*
+me.ghui.*
+me.giacoppo.*
+me.gilbva.*
+me.gladwell.microtesia.*
+me.gladwell.urimplicit.*
+me.gosimple.*
+me.goudham.*
+me.grantland.*
+me.grapebaba.*
+me.grdryn.lisztomania.*
+me.gregorias.*
+me.gregyyy.jduden.*
+me.grishka.appkit.*
+me.grishka.litex.*
+me.grishka.sparkjava.*
+me.grison.*
+me.gujun.android.taggroup.*
+me.gv7.woodpecker.*
+me.haga.librespot.spotifi.*
+me.hanyuliu.*
+me.hao0.*
+me.hdkz.seers.*
+me.hekr.iotos.*
+me.hekr.iotos.softgateway.*
+me.him188.*
+me.hirono.*
+me.hltj.*
+me.hsgamer.*
+me.hugmanrique.*
+me.huseyinozer.*
+me.huteri.*
+me.hz89.library.*
+me.ibrt.*
+me.icymint.*
+me.id.idmesocialcontacts.*
+me.id.sdk.*
+me.id.webverify.*
+me.idaima.x.*
+me.ihxq.projects.*
+me.imirai.*
+me.insidezhou.instep.*
+me.insidezhou.southernquiet.*
+me.jackdevey.*
+me.jacoblewis.flour.*
+me.jahnen.*
+me.jahnen.libaums.*
+me.jaimegarza.*
+me.jakejmattson.*
+me.jaksa.*
+me.jamiemansfield.*
+me.jason5lee.*
+me.javaroad.*
+me.javaweb.*
+me.jclang.*
+me.jeffshaw.*
+me.jeffshaw.argonaut.*
+me.jeffshaw.comparison.*
+me.jeffshaw.default.*
+me.jeffshaw.depthfirst.*
+me.jeffshaw.harmony.*
+me.jeffshaw.inotifywait.*
+me.jeffshaw.kafka.*
+me.jeffshaw.scalatest.*
+me.jeffshaw.scalaz.stream.*
+me.jeffshaw.tryutils.*
+me.jinghong.*
+me.jlurena.*
+me.johnniang.wechat.*
+me.jorgecastillo.*
+me.joshlarson.*
+me.jpomykala.hoc.*
+me.juancarlosganzo.util.*
+me.julb.*
+me.jvt.cucumber.*
+me.jvt.hacking.*
+me.jvt.http.*
+me.jvt.jwksical.*
+me.jvt.multireadservlet.*
+me.jvt.spring.*
+me.jvt.uuid.*
+me.kagura.*
+me.karboom.*
+me.kcybulski.bricks.*
+me.kcybulski.nexum.*
+me.keiwu.*
+me.kennethyo.library.*
+me.kenzierocks.*
+me.kenzierocks.auto.value.*
+me.kevingleason.*
+me.kevinpthorne.*
+me.kieranwallbanks.*
+me.kingjan1999.fhdw.*
+me.kingtux.*
+me.kisoft.*
+me.kolek.gradle.*
+me.kpali.*
+me.kuku.*
+me.lachlanap.config.*
+me.lachlanap.lct.*
+me.laiseca.urlmapper.*
+me.lamouri.*
+me.landmesser.simplecsv.*
+me.laoyuyu.aria.*
+me.laoyuyu.keepassa.*
+me.leaf.*
+me.legrange.*
+me.legrange.services.*
+me.lemire.integercompression.*
+me.lemonypancakes.actionbarapi.*
+me.lemonypancakes.resourcemanagerhelper.*
+me.leolin.*
+me.lessis.*
+me.levansmith.logdog.*
+me.lightspeed7.*
+me.limansky.*
+me.limone.*
+me.liuwj.ktorm.*
+me.loki2302.*
+me.lorenc.dreadlogs.*
+me.lorenzo0111.*
+me.lucko.*
+me.lucko.configurate.*
+me.lucko.luckperms.*
+me.luckslovez.*
+me.lucyy.*
+me.luzhuo.android.*
+me.lyh.*
+me.machinemaker.*
+me.machinemaker.lectern.*
+me.machinemaker.mirror.*
+me.maciejb.etcd-client.*
+me.maciejb.sarchieml.*
+me.maciejb.snappyflows.*
+me.madhead.aws-junit5.*
+me.magnet.*
+me.majiajie.*
+me.malu.*
+me.manishkatoch.*
+me.marcosassuncao.servsim.*
+me.mario6.*
+me.martiii.*
+me.masahito.*
+me.mattak.*
+me.matteomerola.*
+me.matteomerola.reminderlang.*
+me.mattstudios.*
+me.mattstudios.utils.*
+me.mazeika.uconfig.*
+me.meilon.jsftp.*
+me.meilon.sftp.*
+me.mekarthedev.tools.*
+me.melchor9000.*
+me.memerator.api.*
+me.mervinz.*
+me.mhn.*
+me.midday.*
+me.mindwind.*
+me.minidigger.*
+me.mitochon.*
+me.mnedokushev.*
+me.moallemi.*
+me.moallemi.gradle.*
+me.moallemi.tools.*
+me.moocar.*
+me.moros.*
+me.mrxbox98.jast.*
+me.mxia.*
+me.mywiki.*
+me.n4u.sass.*
+me.naganithin.bdaa.*
+me.naingaungluu.formconductor.*
+me.naotiki.*
+me.naotiki.ese.*
+me.nathanfallet.apirequest.*
+me.nathanfallet.digianalytics.*
+me.nathanfallet.gamified.*
+me.nathanfallet.makth.*
+me.nathanfallet.myappsandroid.*
+me.nathanfallet.unlockpremium.*
+me.navarr.JapaneseNumerals.*
+me.neavo.*
+me.nemiron.hyperion.*
+me.niccolomattei.api.*
+me.nikhilchaudhari.*
+me.nithanim.gw2api.*
+me.nithanim.quarkus.*
+me.nkgcp.*
+me.normanmaurer.maven.autobahntestsuite.*
+me.normanmaurer.niosmtp.*
+me.noroutine.*
+me.nqkdev.plugins.*
+me.nullicorn.*
+me.o-r-e.*
+me.obarros.*
+me.obsilabor.*
+me.omico.binder.actionbar.*
+me.omico.consensus.*
+me.omico.consensus.api.*
+me.omico.consensus.git.*
+me.omico.consensus.publishing.*
+me.omico.consensus.r8.*
+me.omico.consensus.spotless.*
+me.omico.elucidator.*
+me.omico.gradm.*
+me.onebone.*
+me.ooon.*
+me.pagar.*
+me.palazzetti.*
+me.panavtec.*
+me.parakh.core.*
+me.parakh.platform.*
+me.paulbares.*
+me.paulschwarz.*
+me.peproll.*
+me.philio.*
+me.philio.disqus.*
+me.phoboslabs.illuminati.*
+me.piebridge.*
+me.pietelite.mantle.*
+me.pietelite.nope.*
+me.pietrzak.aprcalc.*
+me.piomar.*
+me.pjq.*
+me.postaddict.*
+me.prettyprint.*
+me.proton.core.*
+me.proton.core.gradle-plugins.*
+me.proton.core.gradle-plugins.coverage-config.*
+me.proton.core.gradle-plugins.coverage.*
+me.proton.core.gradle-plugins.detekt.*
+me.proton.core.gradle-plugins.global-coverage.*
+me.proton.core.gradle-plugins.include-core-build.*
+me.proton.core.gradle-plugins.jacoco.*
+me.proton.core.gradle-plugins.kotlin.*
+me.proton.core.gradle-plugins.tests.*
+me.proton.gradle-plugins.*
+me.proton.gradle-plugins.detekt.*
+me.proton.gradle-plugins.jacoco.*
+me.proton.gradle-plugins.kotlin.*
+me.proton.gradle-plugins.tests.*
+me.proton.test.*
+me.proton.vpn.*
+me.pushy.*
+me.qmx.jitescript.*
+me.qmx.vraptor-authz.*
+me.qnox.*
+me.qnox.builder-generator-kotlin.*
+me.qoomon.*
+me.qyh.*
+me.ramendev.*
+me.ramswaroop.botkit.*
+me.ramswaroop.jbot.*
+me.raynes.*
+me.reactiv.fabric-java-sdk.*
+me.redaalaoui.gerrit.client.rest.*
+me.redaalaoui.gerrit_rest_java_client.*
+me.redaalaoui.sonar.*
+me.redaalaoui.sonar_ws.*
+me.relex.*
+me.rohanbansal.ricochet.*
+me.ronshapiro.rx.priority.*
+me.ruebner.*
+me.saharnooby.*
+me.saharnooby.lib.*
+me.saket.*
+me.saket.cascade.*
+me.saket.extendedspans.*
+me.saket.modernstorage.*
+me.saket.resourceinterceptor.*
+me.saket.reuserview.*
+me.saket.swipe.*
+me.saket.telephoto.*
+me.saket.unfurl.*
+me.saro.*
+me.scf37.*
+me.scf37.jmx-http.*
+me.schlaubi.*
+me.scolastico.*
+me.scutum.*
+me.sebj.*
+me.sequencer.*
+me.shadaj.*
+me.shaftesbury.*
+me.shakiba.cambridge.*
+me.shakiba.guice-config.*
+me.shakiba.jdbi.*
+me.shakiba.jsonrpc.*
+me.shakiba.og4j.*
+me.shakiba.readr.*
+me.shib.java.lib.*
+me.shib.java.tools.*
+me.shib.lib.*
+me.shib.lib.google.*
+me.shib.plugin.*
+me.shikhov.*
+me.shils.*
+me.silloy.*
+me.silvernine.*
+me.simin.*
+me.smecsia.gawain.*
+me.sneer.*
+me.sniggle.*
+me.snov.*
+me.snowdrop.*
+me.soknight.*
+me.soknight.maven.plugins.*
+me.soliveirajr.*
+me.springframework.*
+me.srodrigo.*
+me.stefanozanella.*
+me.stormma.*
+me.stuarthicks.*
+me.suanmiao.common.*
+me.suanmiao.ptrlistview.*
+me.sundp.*
+me.sunlan.*
+me.sunnydaydev.*
+me.taifuno.*
+me.tankery.lib.*
+me.tatarka.*
+me.tatarka.android.*
+me.tatarka.androidunittest.*
+me.tatarka.bindingcollectionadapter.*
+me.tatarka.bindingcollectionadapter2.*
+me.tatarka.central.test.*
+me.tatarka.compose.nav.*
+me.tatarka.gsonvalue.*
+me.tatarka.holdr.*
+me.tatarka.inject.*
+me.tatarka.injectedvmprovider.*
+me.tatarka.loadie.*
+me.tatarka.parsnip.*
+me.tatarka.redux.*
+me.tatarka.retainstate.*
+me.tatarka.rxloader.*
+me.tatarka.shard.*
+me.tatarka.silentsupport.*
+me.tatarka.simplefragment.*
+me.tatarka.socket.*
+me.tatarka.support.*
+me.tatarka.value.*
+me.tatarka.webpush.*
+me.tatarka.yesdata.*
+me.teplyakov.*
+me.textflow.*
+me.tfeng.play-mods.*
+me.tfeng.play-plugins.*
+me.tfeng.toolbox.*
+me.thefreezingchicken.stripper.*
+me.thingle.archetypes.*
+me.thomas-windt.*
+me.tinhtruong.gradle.plugin.*
+me.tobiadeyinka.*
+me.tomassetti.*
+me.tomassetti.antlr4c3.*
+me.tomassetti.kanvas.*
+me.tomsdevsn.*
+me.tongfei.*
+me.tonyrice.oss.*
+me.trnl.*
+me.twocities.*
+me.tzion.*
+me.vadyalex.*
+me.vcoder.*
+me.venise.*
+me.vertretungsplan.*
+me.vican.jorge.*
+me.vilsol.*
+me.vptheron.*
+me.walkerknapp.*
+me.welkinbai.*
+me.wener.jraphql.*
+me.wener.wava.*
+me.weteam.*
+me.winsh.*
+me.wojnowski.*
+me.wuwenbin.*
+me.xdrop.*
+me.xethh.archetype.*
+me.xethh.archetype.quickstart.*
+me.xethh.internal.libs.*
+me.xethh.libs.*
+me.xethh.libs.extension.*
+me.xethh.libs.extension.set.*
+me.xethh.libs.extension.set.sst.*
+me.xethh.libs.extension.sysModule.*
+me.xethh.libs.extensions.*
+me.xethh.libs.extensions.resetPwd.*
+me.xethh.libs.toolkits.*
+me.xethh.libs.toolkits.akka.*
+me.xethh.libs.toolkits.webDto.*
+me.xethh.utils.*
+me.xhsun.gw2wrapper.*
+me.xtrm.*
+me.xuender.*
+me.xujichang.lib.*
+me.xuxiaoxiao.*
+me.yaman.can.*
+me.yanaga.*
+me.yanglw.*
+me.yaohu.*
+me.yarhoslav.*
+me.yellowstrawberry.*
+me.yesheng.*
+me.yesilyurt.burak.*
+me.yingrui.mahjong.*
+me.ykaplan.jmacros.*
+me.yogendra.*
+me.yoram.log4j-infra.*
+me.yoram.log4j-infra.examples.*
+me.youm.base.*
+me.youm.boot.*
+me.youm.core.*
+me.youm.frame.*
+me.yuhuan.*
+me.yuichi0301.*
+me.zalo.*
+me.zebe.zebra.*
+me.zerogeworkshop.*
+me.zhanghai.android.appiconloader.*
+me.zhanghai.android.customtabshelper.*
+me.zhanghai.android.effortlesspermissions.*
+me.zhanghai.android.fastscroll.*
+me.zhanghai.android.foregroundcompat.*
+me.zhanghai.android.libselinux.*
+me.zhanghai.android.linenoise.*
+me.zhanghai.android.materialedittext.*
+me.zhanghai.android.materialplaypausedrawable.*
+me.zhanghai.android.materialprogressbar.*
+me.zhanghai.android.materialratingbar.*
+me.zhanghai.android.patternlock.*
+me.zhanghai.android.retrofile.*
+me.zhanghai.android.systemuihelper.*
+me.zhanghq.*
+me.zhangjh.*
+me.zhanglun.ahocorasick.*
+me.zhengjin.*
+me.zhennan.android.easyui.*
+me.zhenxin.*
+me.zhyd.braum.spring.boot.*
+me.zhyd.houtu.*
+me.zhyd.hunter.*
+me.zhyd.oauth.*
+me.zongren.*
+me.zsr.*
+me.zwave.*
+me.zyee.*
+me.zzp.*
+media.kamel.*
+media.pepperpot.tca.*
+merlin-developer.*
+merlin-tutorial.*
+merlin.*
+messenger.*
+metaclass.*
+mevenide.*
+middlegen.*
+mil.navy.spawar.soaf.*
+mil.nga.*
+mil.nga.gars.*
+mil.nga.geopackage.*
+mil.nga.geopackage.map.*
+mil.nga.mgrs.*
+mil.nga.oapi.features.*
+mil.nga.sf.*
+milyn.*
+mk.0x.ndk.*
+ml.alternet.*
+ml.bundle.*
+ml.calumma.web.*
+ml.combust.bundle.*
+ml.combust.mleap.*
+ml.comet.*
+ml.dcjz.*
+ml.dcjz.bridge.*
+ml.dcjz.common.*
+ml.dcjz.libs.*
+ml.dcjz.plugin.*
+ml.dmlc.*
+ml.dmlc.mxnet.*
+ml.karmaconfigs.*
+ml.milkov.*
+ml.miron.*
+ml.petmarket.*
+ml.prestoconnectors.*
+ml.rugal.*
+ml.rugal.archetype.*
+ml.shifu.*
+ml.sky233.suiteki.*
+ml.sorus.*
+ml.sparkling.*
+ml.ytooo.*
+ml.zhangxujie.*
+mm-mysql.*
+mm.mysql.*
+mn.foreman.*
+mobi.alphapush.*
+mobi.boilr.*
+mobi.boilr.libdynticker.*
+mobi.boilr.libpricealarm.*
+mobi.cangol.mobile.*
+mobi.cwiklinski.*
+mobi.designmyapp.*
+mobi.emmons.cheap_ruler.*
+mobi.lab.labencryptedstorage.*
+mobi.lab.scrolls.*
+mobi.liason.*
+mobi.mofokom.*
+mobi.mofokom.javax.slee.*
+mobi.mofokom.slee.*
+mobi.openddr.*
+mobi.openddr.client.*
+mobi.parchment.*
+mobi.pocketmedia.*
+mobi.quamotion.webdriver.*
+mobi.speakin.sdk.*
+mobi.stos.*
+mobi.stos.podataka_lib.*
+mobi.waterdog.kgeojson.*
+mobi.waterdog.ktor-template.*
+mockcreator.*
+mockit.*
+mockmaker.*
+mockobjects.*
+mockrunner.*
+modello.*
+moe.cnkirito.kdio.*
+moe.dare.briareus.*
+moe.icyr.*
+moe.kanon.konfig.*
+moe.kanon.krautils.*
+moe.keshane.*
+moe.lemonneko.*
+moe.maple.*
+moe.nea89.*
+moe.pine.*
+moe.sdl.annolist.*
+moe.sdl.ipdb.*
+moe.sdl.kcp.*
+moe.sdl.yabapi.*
+moe.sdl.yac.*
+moe.tlaster.*
+moe.tristan.*
+moe.yka.*
+moe.zodiia.*
+monetdb.*
+money.link.*
+money.open.*
+money.rave.*
+money.rbk.*
+money.terra.*
+money.zumo.zumokit.*
+monster.nor.prunes.*
+monster.sultanpower.*
+mrj.*
+ms.dew.*
+ms.safi.btsync.*
+ms.safi.spring.*
+mstor.*
+msv.*
+mt.edu.um.cs.rv.*
+mt.edu.um.cs.rv.valour.*
+mule.*
+muse.*
+mx.bigdata.anyobject.*
+mx.bigdata.cfdi.*
+mx.bigdata.datalib.*
+mx.bigdata.jcalais.*
+mx.bigdata.streaming.*
+mx.bigdata.t4j.*
+mx.bigdata.utils.*
+mx.com.fimet.*
+mx.com.inftel.codegen.*
+mx.com.inftel.codegen.browser-client.*
+mx.com.inftel.codegen2.*
+mx.com.inftel.codegen3.*
+mx.com.inftel.oss.*
+mx.com.inftel.oss.liquibase.*
+mx.com.inftel.sat.*
+mx.com.sw.*
+mx.com.sw.services.*
+mx.dapp.sdk.*
+mx.emite.*
+mx.grupocorasa.cfdi.*
+mx.nic.labs.reddog.*
+mx.openpay.*
+mx.wire4.sdk.*
+mx4j.*
+myfaces.*
+mysql.*
+mz.org.selv.*
+name.abuchen.*
+name.ball.joshua.craftinomicon.*
+name.bychkov.*
+name.didier.david.*
+name.didier.david.storm.*
+name.dmaus.schxslt.*
+name.falgout.jeffrey.*
+name.falgout.jeffrey.testing.*
+name.falgout.jeffrey.testing.junit5.*
+name.finsterwalder.*
+name.gcg.*
+name.heikoseeberger.*
+name.herve.*
+name.ignat.*
+name.ilab.*
+name.jervyshi.*
+name.kazennikov.*
+name.kevinlocke.appveyor.*
+name.kropp.kotlinx-gettext.*
+name.lakhin.eliah.projects.papacarlo.*
+name.lecaroz.*
+name.mitterdorfer.perlock.*
+name.mjw.*
+name.mlopatkin.bitbucket.*
+name.neuhalfen.projects.crypto.bouncycastle.openpgp.*
+name.neykov.*
+name.nkonev.multipart-spring-graphql.*
+name.nkonev.r2dbc-migrate.*
+name.pehl.*
+name.pellet.jp.*
+name.prokop.bart.fps.*
+name.prokop.bart.rxtx.*
+name.remal.*
+name.remal.gradle-plugins.idea-settings.*
+name.remal.gradle-plugins.lombok.*
+name.remal.gradle-plugins.sonarlint.*
+name.remal.gradle-plugins.test-source-sets.*
+name.remal.gradle-plugins.toolkit.*
+name.remal.idea-settings.*
+name.remal.integration-tests.*
+name.remal.lombok.*
+name.remal.maven-plugins.*
+name.remal.sonarlint.*
+name.remal.test-source-sets.*
+name.remal.test.*
+name.remal.tools.*
+name.remal.tools.test.*
+name.tachenov.ParameterizedJUnitParams.*
+name.valery1707.*
+name.valery1707.junit.*
+name.valery1707.kaitai.*
+name.valery1707.kaz-person-id.*
+name.valery1707.smsc.*
+name.valery1707.validator.*
+name.velikodniy.vitaliy.*
+name.wramner.httpclient.*
+name.wramner.log4j.*
+name.wramner.util.*
+name.xwork.*
+nanning.*
+nanocontainer.*
+nekohtml.*
+neo.*
+net.1024lab.*
+net.178le.*
+net.36dr.library.*
+net.3scale.*
+net.4youandme.*
+net._01001111.*
+net.abhinavsarkar.*
+net.abstractfactory.*
+net.abstractfactory.plum.*
+net.accelbyte.sdk.*
+net.accelf.accompanist.*
+net.accelf.contral.*
+net.acesinc.*
+net.acesinc.data.*
+net.acesinc.druid.extensions.*
+net.acesinc.webswing.*
+net.achalaggarwal.arbiter.*
+net.achalaggarwal.workerbee.*
+net.adamcin.*
+net.adamcin.bnd.*
+net.adamcin.com.eclipsesource.tycho.karaf.bridge.*
+net.adamcin.commons.*
+net.adamcin.granite.*
+net.adamcin.granite.client.*
+net.adamcin.httpsig.*
+net.adamcin.oakpal.*
+net.adamcin.org.kuali.maven.wagons.*
+net.adamcin.recap.*
+net.adamcin.sling.*
+net.adamcin.sshkey.*
+net.adamjenkins.*
+net.adeonatech.*
+net.adeptropolis.*
+net.admin4j.*
+net.admixer.sdk.*
+net.admixer.sdk.mediation-adapter.*
+net.admixer.sdk.mediation.*
+net.admixer.sdk.unity.*
+net.adoptopenjdk.*
+net.aequologica.neo.*
+net.aestron.*
+net.aestron.rtc.*
+net.aethersanctum.lilrest.*
+net.afanasev.*
+net.agile-automata.executor4s.*
+net.agile-automata.nio4s.*
+net.agkn.*
+net.aholbrook.paseto.*
+net.aichler.*
+net.aihelp.*
+net.akaish.ikey.hkb.*
+net.akaish.kab.*
+net.akaish.kitty.orm.*
+net.akehurst.language.*
+net.akehurst.language.editor.*
+net.akehurst.transform.*
+net.aksingh.*
+net.alantea.*
+net.alchim31.*
+net.alchim31.maven.*
+net.alchim31.runner.*
+net.alchim31.vscaladoc2.*
+net.algart.*
+net.algart.executors.*
+net.alloyggp.*
+net.almson.*
+net.amcintosh.*
+net.amrhassan.*
+net.amullins.*
+net.amygdalum.*
+net.analyse.*
+net.andimiller.*
+net.andreaskluth.*
+net.andrebrov.*
+net.andreinc.*
+net.andrewcpu.*
+net.andrewhatch.*
+net.andrzejczak.*
+net.ankao.org.*
+net.anotheria.*
+net.anotheria.portalkit.*
+net.anschau.*
+net.anshulverma.gradle.*
+net.anshulverma.skydns.*
+net.anthavio.*
+net.anthavio.disquo.*
+net.anthavio.maven.*
+net.antidot.*
+net.anumbrella.seaweedfs.*
+net.anumbrella.tools.*
+net.anwiba.*
+net.anwiba.commons.*
+net.anwiba.commons.swing.icons.*
+net.anwiba.commons.tools.*
+net.anwiba.database.*
+net.anwiba.eclipse.*
+net.anwiba.spatial.*
+net.anzix.*
+net.anzix.android.*
+net.anzix.aws.*
+net.anzix.maven.*
+net.apexes.*
+net.apexes.codegen.*
+net.apexes.commons.*
+net.apexes.fastexcel.*
+net.apexes.fqueue.*
+net.apexes.querydsl.*
+net.apexes.vertx.*
+net.apexes.wsonrpc.*
+net.apjanke.log4j-config-gui.*
+net.appsynth.danger.*
+net.arccode.*
+net.argius.*
+net.arhipov.*
+net.arkinsolomon.*
+net.arnx.*
+net.artemkv.*
+net.artsy.*
+net.arya.*
+net.as-development.asdk.*
+net.aschemann.tomcat.*
+net.asere.omni.mvi.*
+net.ashwork.*
+net.asynchorswim.*
+net.atinu.*
+net.atomarrow.*
+net.atomcode.*
+net.auoeke.*
+net.auoeke.ke.*
+net.auoeke.wheel.*
+net.auropay.*
+net.auropay.uat.*
+net.auropay.uat.1.0.0.auropaypaymenttest.net.auropay.uat.*
+net.authorize.*
+net.automatalib.*
+net.automatalib.archetypes.*
+net.automatalib.distribution.*
+net.avalara.avatax.*
+net.avcompris.commons.*
+net.avh4.clj.*
+net.avh4.data.*
+net.avh4.data.per.*
+net.avh4.framework.*
+net.avh4.ideal.data.*
+net.avh4.jrspec.*
+net.avh4.math.*
+net.avh4.mvn.archetype.*
+net.avh4.rpg.generators.*
+net.avh4.test.*
+net.avh4.util.*
+net.avh4.util.di.*
+net.avh4.util.socket.*
+net.awired.aclm.*
+net.awired.ajsl.*
+net.awired.bootstrap.*
+net.awired.clients.*
+net.awired.com.googlecode.jstestdriver.*
+net.awired.core.*
+net.awired.js.*
+net.awired.jscoverage.*
+net.awired.logback.prettier.*
+net.awired.parent.*
+net.awired.parent.parent-java.*
+net.awired.visuwall.*
+net.axay.*
+net.axay.openapigenerator.*
+net.azae.xray.*
+net.backbord.*
+net.badbird5907.*
+net.badgekeeper.android.*
+net.baens.*
+net.ballmerlabs.scatterbrainsdk.*
+net.bankras.*
+net.banterly.*
+net.baobabservices.dev.*
+net.bblfish.rdf.*
+net.bbmsoft.*
+net.beadsproject.*
+net.beardbot.*
+net.benjaminguzman.*
+net.benmur.*
+net.benpl.*
+net.benwoodworth.knbt.*
+net.benwoodworth.localeconfig.*
+net.bertag.*
+net.bhardy.bizzo.*
+net.bican.*
+net.big-oh.*
+net.billforward.*
+net.binggl.*
+net.bingosoft.oss.*
+net.bis5.excella.*
+net.bis5.gitlab.*
+net.bis5.mattermost4j.*
+net.bis5.opengraph4j.*
+net.bis5.opentracing.*
+net.bitnine.*
+net.biville.*
+net.biville.florent.*
+net.bjohannsen.*
+net.blackhacker.*
+net.bloemsma.graphql.query.*
+net.bluefen.*
+net.bluemix.*
+net.blugrid.*
+net.bnafit.*
+net.bndy.*
+net.bobosse.*
+net.boeckling.*
+net.bolbat.*
+net.bonn2.*
+net.bookrain.*
+net.bootsfaces.*
+net.boreeas.*
+net.bostrt.gwt.*
+net.botlify.brightdata.*
+net.botlify.dot-properties.*
+net.box.*
+net.bozho.easycamera.*
+net.bozho.securelogin.*
+net.bpelunit.*
+net.bpiwowar.*
+net.brabenetz.app.*
+net.brabenetz.lib.*
+net.bramp.db-patterns.*
+net.bramp.ffmpeg.*
+net.bramp.jackson.*
+net.bramp.objectgraph.*
+net.bramp.unsafe.*
+net.bretti.modelcheck.*
+net.bretti.openapi-route-definition-locator.*
+net.brunomendola.querity.*
+net.bull.javamelody.*
+net.bytebuddy.*
+net.bytebutcher.*
+net.bytepowered.*
+net.byteseek.*
+net.bzdyl.*
+net.bzzt.*
+net.c0f3.labs.*
+net.cacheux.crudroid.*
+net.cactusthorn.config.*
+net.cactusthorn.routing.*
+net.cadrian.jsonref.*
+net.cafeto.entitycopy.*
+net.cafeto.queryserialize.*
+net.cakesolutions.*
+net.caladesiframework.*
+net.calit2.mooc.iot_db410c.*
+net.calledtoconstruct.*
+net.callumtaylor.*
+net.callumtaylor.asynchttp.*
+net.canadensys.*
+net.caoticode.boolex.*
+net.caoticode.buhtig.*
+net.caoticode.dirwatcher.*
+net.carlosgsouza.*
+net.carrossos.*
+net.caspervg.jgaf.*
+net.caspervg.lex4j.*
+net.caspervg.tusk4j.*
+net.cassite.*
+net.cattaka.*
+net.catte.*
+net.ceedubs.*
+net.centro.rtb.*
+net.chaincomp.*
+net.chainside.webpossdk.*
+net.champemont.jean.hogancompile.*
+net.chandol.*
+net.chibidevteam.*
+net.chocolapod.*
+net.christophermerrill.*
+net.chriswareham.*
+net.chronakis.tiles-dynamic.*
+net.cilib.*
+net.cimadai.*
+net.cinling.*
+net.cinnom.*
+net.clementlevallois.functions.*
+net.clementlevallois.utils.*
+net.clintarmstrong.*
+net.clintonmagro.embedded.qpid.*
+net.clockworkcode.*
+net.cloudburo.*
+net.cloudinsights.*
+net.cloudopt.logger.*
+net.cloudopt.next.*
+net.cloventt.*
+net.cnese.framework.*
+net.cnri.*
+net.cnri.cordra.*
+net.coacoas.gradle.*
+net.code-story.*
+net.codebox.*
+net.codebuilders.*
+net.codecrafting.*
+net.codecrete.qrbill.*
+net.codecrete.usb.*
+net.codelibre.*
+net.coderazzi.*
+net.coderbee.*
+net.coderefactory.*
+net.codesup.util.*
+net.codesup.utilities.*
+net.coding.ShinEDL.*
+net.coding.chenxiaobo.*
+net.coding.xcom.*
+net.coding.yuanhai.*
+net.codingwell.*
+net.codinux.collections.*
+net.codinux.csv.*
+net.codinux.log.*
+net.codinux.util.*
+net.cofares.ljug.*
+net.cofcool.chaos.*
+net.colesico.framework.*
+net.commuty.*
+net.compartmental.code.*
+net.comze.*
+net.connectedcaching.*
+net.conquiris.*
+net.consensys.cava.*
+net.consensys.quorum.tessera.*
+net.contargo.*
+net.contentobjects.jnotify.*
+net.contextfw.*
+net.continuous-security-tools.*
+net.coobird.*
+net.coobird.gui.simpleimageviewer4j.*
+net.corda.*
+net.corda.corda-flows.*
+net.corda.cordapp.*
+net.corda.cordapp.cordapp-configuration.*
+net.corda.kotlin.*
+net.corda.plugins.*
+net.corda.plugins.cordapp-cpb.*
+net.corda.plugins.cordapp-cpb2.*
+net.corda.plugins.cordapp-cpk.*
+net.corda.plugins.cordapp-cpk2.*
+net.corda.plugins.csde.*
+net.corda.plugins.flask.*
+net.corda.plugins.quasar-utils.*
+net.corpwar.lib.*
+net.coru.*
+net.cpollet.jixture.*
+net.cpollet.maven.plugins.*
+net.craftforge.*
+net.craftforge.essential.*
+net.craigscode.*
+net.crashsight.*
+net.creationreborn.*
+net.crimsonmc.*
+net.crispcode.*
+net.crizin.*
+net.crofis.*
+net.crosp.libs.android.*
+net.croz.nrich.*
+net.csdn.*
+net.csibio.aird.*
+net.customware.confluence.plugin.google.calendar.*
+net.customware.confluence.reporting.*
+net.customware.gwt.dispatch.*
+net.customware.gwt.presenter.*
+net.customware.license.*
+net.customware.liquibase.*
+net.dankito.banking.*
+net.dankito.filechooserdialog.*
+net.dankito.jpa.annotationreader.*
+net.dankito.jpa.couchbaselite.*
+net.dankito.mime.*
+net.dankito.readability4j.*
+net.dankito.richtexteditor.*
+net.dankito.search.*
+net.dankito.text.extraction.*
+net.dankito.utils.*
+net.dankito.web.*
+net.danlew.*
+net.darkguard.drtools.*
+net.darkhax.namespaced.*
+net.darkmist.alib.*
+net.darkmist.alib.escape.*
+net.databinder.*
+net.databinder.conscript.*
+net.databinder.dispatch.*
+net.databinder.giter8.*
+net.databinder.herald.*
+net.databinder.maven.net.databinder.*
+net.databinder.spde.*
+net.datafaker.*
+net.dataforte.*
+net.dataforte.cassandra.*
+net.dataforte.doorkeeper.*
+net.datenstrudel.*
+net.datenstrudel.bulbs.*
+net.dathoang.cqrs.commandbus.*
+net.davidbuccola.force-spa.*
+net.davidtanzer.*
+net.ddellspe.*
+net.debasishg.*
+net.deechael.*
+net.deelam.*
+net.deffer.maven.*
+net.degols.libs.*
+net.degreedays.*
+net.dehora.nakadi.*
+net.dempsy.*
+net.dericbourg.*
+net.dericbourg.daily-utils.*
+net.dermetfan.libgdx-box2d-multiplayer.*
+net.dermetfan.libgdx-utils.*
+net.derquinse.*
+net.derquinse.bocas.*
+net.derquinse.j8.*
+net.desertconsulting.*
+net.devh.*
+net.devlab722.*
+net.devonlinux.solr.*
+net.devslash.*
+net.devslash.fetchdsl.*
+net.dharwin.common.tools.cli.*
+net.di2e.ecdr.*
+net.di2e.ecdr.api.*
+net.di2e.ecdr.app.*
+net.di2e.ecdr.endpoint.*
+net.di2e.ecdr.federation.*
+net.di2e.ecdr.libs.*
+net.di2e.ecdr.querylanguages.*
+net.di2e.ecdr.security.*
+net.di2e.ecdr.source.*
+net.di2e.ecdr.transformer.*
+net.digger.*
+net.digital-alexandria.*
+net.digitalid.utility.*
+net.digitaltsunami.*
+net.diibadaaba.zipdiff.*
+net.distilledcode.*
+net.distilledcode.aem.*
+net.distilledcode.maven.*
+net.disy.htmlunit.*
+net.disy.jquery.*
+net.disy.legato.*
+net.disy.legato.dist.*
+net.disy.oss.*
+net.disy.prototype.*
+net.disy.wps.*
+net.diversionmc.*
+net.diyigemt.miraiboot.*
+net.dloud.mimiron.*
+net.dloud.stand.*
+net.dmitriyvolk.maven.plugins.*
+net.dohaw.*
+net.dohaw.corelib.*
+net.domlom.*
+net.dona.doip.*
+net.dongliu.*
+net.dongliu.apk-parser.*
+net.dongliu.cache.*
+net.dongliu.commons.*
+net.dongliu.prettypb.*
+net.dongliu.vcdiff.*
+net.donhofer.*
+net.donky.*
+net.dontcode.*
+net.dontcode.common.*
+net.dontdrinkandroot.*
+net.dopan.*
+net.dorzey.templatepopulator.*
+net.dossot.*
+net.dpepper.*
+net.draal.home.*
+net.dracoblue.spring.*
+net.dragonshard.*
+net.dreamlu.*
+net.dreamlu.mica.*
+net.dreceiptx.*
+net.droidlabs.android.audio.ogg.*
+net.droidlabs.mvvm.*
+net.droidlabs.proguard.*
+net.dryuf.*
+net.dryuf.maven.plugin.*
+net.dschinghis-kahn.*
+net.dubboclub.*
+net.dubboclub.maven.*
+net.duguying.goj.*
+net.duguying.pinyin.*
+net.dv8tion.*
+net.dynamic-tools.*
+net.dynamic-tools.javascript.*
+net.dynamic-tools.javascript.dependencymanager.*
+net.dynamic-tools.javascript.maven.*
+net.dynamic_tools.*
+net.dynamic_tools.javascript.*
+net.dynamic_tools.javascript.dependencymanager.*
+net.dynamic_tools.javascript.maven.*
+net.dzikoysk.*
+net.e175.klaus.*
+net.e6tech.*
+net.ealden.gradle.plugins.*
+net.earthcomputer.currentaffairs.*
+net.earthcomputer.multiconnect.*
+net.east301.*
+net.easy3w.*
+net.edwardday.serialization.*
+net.edzard.*
+net.eldeen.dropwizard.*
+net.eledge.*
+net.elehack.argparse4s.*
+net.elehack.gradle.*
+net.elehack.maven.plugins.*
+net.elytrium.*
+net.emaze.*
+net.emphased.malle.*
+net.emphased.malle.example.*
+net.emtee.*
+net.emustudio.*
+net.encdec.*
+net.encomendaz.*
+net.endrealm.*
+net.energyhub.*
+net.engawapg.lib.*
+net.engio.*
+net.enilink.bundles.*
+net.enilink.komma.*
+net.enilink.llrp4j.*
+net.enilink.platform.*
+net.enovea.*
+net.erdfelt.android.*
+net.erdfelt.maven.*
+net.ericaro.*
+net.ermannofranco.*
+net.ethx.shuteye.*
+net.ettinsmoor.*
+net.eudu.*
+net.eulerframework.*
+net.eunjae.android.aevent.*
+net.eunjae.android.modelmapper.*
+net.eusashead.hateoas.*
+net.eusashead.mqtt.*
+net.eusashead.parquet.*
+net.eusashead.spring.*
+net.evanstoner.spring.*
+net.evendanan.*
+net.evendanan.anysoftkeyboard.*
+net.evenh.*
+net.evilengineers.templates4j.*
+net.evilmouth.*
+net.exoego.*
+net.exogeni.orca.*
+net.exogeni.orca.controllers.*
+net.exogeni.orca.core.*
+net.exogeni.orca.dependencies.*
+net.exogeni.orca.handlers.*
+net.exogeni.orca.handlers.network.*
+net.exogeni.orca.plugins.*
+net.exogeni.orca.tools.*
+net.exogeni.tools.*
+net.fabricmc.*
+net.fallingangel.*
+net.fasolato.jfmigrate.*
+net.fastposter.*
+net.fbridault.eeel.*
+net.fchauvel.trio.*
+net.fckeditor.*
+net.featurist.*
+net.feedify.sdk.push.*
+net.fehmicansaglam.*
+net.fellbaum.*
+net.fenghaitao.*
+net.feyin.api.*
+net.fhannes.rx.*
+net.filebot.*
+net.findhotel.*
+net.finmath.*
+net.fishear.*
+net.flexberry.*
+net.flexmojos.oss.*
+net.floatingsun.*
+net.florat.*
+net.florianschoppmann.java.*
+net.fnothaft.*
+net.fnothaft.snark.*
+net.folivo.*
+net.foolz.*
+net.formicary.remoterun.*
+net.formio.*
+net.fornwall.*
+net.fornwall.jelf.*
+net.forthecrown.*
+net.fortytwo.*
+net.fortytwo.extendo.*
+net.fortytwo.rdfagents.*
+net.fortytwo.ripple.*
+net.fortytwo.sesametools.*
+net.fortytwo.smsn.*
+net.fortytwo.stream.*
+net.fortytwo.twitlogic.*
+net.fosdal.*
+net.foxgenesis.watame.*
+net.frakbot.glowpadbackport.*
+net.freebytes.*
+net.freeutils.*
+net.freeutils.jtnef.*
+net.frett27.*
+net.froelund.*
+net.frogmouth.chronyjava.*
+net.ftlines.metagen.*
+net.ftlines.wicket-bean-validation.*
+net.ftlines.wicket-cdi.*
+net.ftlines.wicket-fullcalendar.*
+net.ftlines.wicket-source.*
+net.fushizen.invokedynamic.proxy.*
+net.fwbrasil.*
+net.gageot.*
+net.gcardone.junidecode.*
+net.gcolin.httpquery.*
+net.gfxmonk.*
+net.ggtools.junit.*
+net.ggtools.maven.*
+net.gini.*
+net.gini.android.*
+net.gini.dropwizard.*
+net.gittab.statemachine.*
+net.gjerull.etherpad.*
+net.gleamynode.*
+net.gleske.*
+net.glorat.*
+net.glxn.*
+net.glxn.qrgen.*
+net.gmcbm.dependencies.*
+net.golbarg.pdfviewer.*
+net.goldolphin.*
+net.gonzberg.*
+net.gorayan.mc.*
+net.gotev.*
+net.gouline.droidxing.*
+net.gouline.kapsule.*
+net.gpedro.integrations.slack.*
+net.gplatform.*
+net.gradbase.*
+net.gredler.*
+net.gree.aurora.*
+net.greghaines.*
+net.grey-panther.*
+net.griffiti.*
+net.groboclown.*
+net.grossmax.ktorwebsocketrest.*
+net.groupadd.yena.*
+net.gudenau.lib.annotation.*
+net.gudenau.lib.argument.*
+net.guerlab.*
+net.guerlab.builder.*
+net.guerlab.cloud.*
+net.guerlab.cloud.article.*
+net.guerlab.cloud.banner.*
+net.guerlab.cloud.dingtalk.*
+net.guerlab.cloud.gateway.*
+net.guerlab.cloud.monitor.*
+net.guerlab.cloud.monitor.admin.*
+net.guerlab.cloud.notify.*
+net.guerlab.cloud.oauth.*
+net.guerlab.cloud.pay.*
+net.guerlab.cloud.region.*
+net.guerlab.cloud.resource.*
+net.guerlab.cloud.uploader.*
+net.guerlab.cloud.user.*
+net.guerlab.cloud.wx.*
+net.guerlab.loadbalancer.*
+net.guerlab.sdk.*
+net.guerlab.smart.activity.*
+net.guerlab.smart.applicationMarket.*
+net.guerlab.smart.applicationmarket.*
+net.guerlab.smart.article.*
+net.guerlab.smart.banner.*
+net.guerlab.smart.dingtalk.*
+net.guerlab.smart.engine.dynamicForm.*
+net.guerlab.smart.license.*
+net.guerlab.smart.message.*
+net.guerlab.smart.notify.*
+net.guerlab.smart.oauth.*
+net.guerlab.smart.pay.*
+net.guerlab.smart.platform.*
+net.guerlab.smart.platform.basic.*
+net.guerlab.smart.qcloud.*
+net.guerlab.smart.region.*
+net.guerlab.smart.uploader.*
+net.guerlab.smart.user.*
+net.guerlab.smart.wx.*
+net.guerlab.sms.*
+net.guerlab.spring.*
+net.guizhanss.*
+net.gulbers.*
+net.guoyk.*
+net.gutefrage.*
+net.gutefrage.mandrill.*
+net.haesleinhuepf.*
+net.hamnaberg.*
+net.hamnaberg.json.*
+net.hamnaberg.jwk.*
+net.hamnaberg.rest.*
+net.handle.*
+net.happyonroad.*
+net.harawata.*
+net.harawata.reflection.*
+net.hasor.*
+net.hassannazar.*
+net.heartsavior.*
+net.heartsavior.spark.*
+net.heberling.binarynotes.*
+net.heberling.clanlord.bard.*
+net.heberling.clanlord.macro.*
+net.heberling.ismart.*
+net.hexonet.apiconnector.*
+net.highersoft.*
+net.highteq.cylab.*
+net.hilmarh.*
+net.hlinfo.*
+net.hockeyapp.android.*
+net.homeip.yusuke.*
+net.hostettler.jdd.*
+net.hsasaki0316.*
+net.hserver.apm.*
+net.hserver.mybatis.plugin.*
+net.hserver.plugins.beetlsql.*
+net.hserver.plugins.maven.*
+net.hserver.plugins.rpc.*
+net.htmlparser.*
+net.htmlparser.jericho.*
+net.humans.android.ui.*
+net.humans.kmm.arch.*
+net.humans.kmm.mvi.*
+net.hycube.*
+net.hydromatic.*
+net.i2p.*
+net.i2p.android.*
+net.i2p.android.ext.*
+net.i2p.client.*
+net.i2p.crypto.*
+net.iakovlev.*
+net.ibizsys.runtime.*
+net.ichigotake.*
+net.idauto.oss.connect-sdk.*
+net.idauto.oss.jcifs.*
+net.idfr.*
+net.ifok.common.*
+net.ifok.image.*
+net.ifok.limiter.*
+net.ifok.mail.*
+net.ifok.plugin.*
+net.ifok.png.compress.*
+net.ifok.project.*
+net.ifok.shiro.*
+net.ifok.swagger.*
+net.igsoft.*
+net.iharder.*
+net.ilocalize.*
+net.imadz.*
+net.imagej.*
+net.imglib2.*
+net.immute.*
+net.incongru.*
+net.incongru.berkano.*
+net.incongru.watchservice.*
+net.indigitall.*
+net.inemar.utility.*
+net.inetalliance.*
+net.infstudio.infinitylib.*
+net.innig.sweetxml.*
+net.insprill.*
+net.intelie.disq.*
+net.intelie.introspective.*
+net.intelie.live.*
+net.intelie.omnicron.*
+net.intelie.pipes.*
+net.intelie.tinymap.*
+net.interfax.*
+net.interus.*
+net.inveed.*
+net.iot-solutions.graphdb.*
+net.iotgw.*
+net.ipip.*
+net.iris.*
+net.iriscan.*
+net.isanchez.*
+net.isger.*
+net.ishiis.redis.*
+net.ishiis.util.*
+net.ishtanzar.java.drupal.*
+net.israfil.*
+net.israfil.cli.*
+net.israfil.foundation.*
+net.israfil.micro.*
+net.israfil.mojo.*
+net.israfil.services.mail.*
+net.isucon.bench.*
+net.itarray.*
+net.itbaima.*
+net.itransformers.*
+net.itransformers.snmp2xml4j.*
+net.itrixlabs.*
+net.iuyy.*
+net.ivoah.*
+net.ja731j.bukkit.*
+net.jaardvark.*
+net.jackadull.*
+net.jacobpeterson.*
+net.jade-dungeon.*
+net.jadler.*
+net.jafama.*
+net.jahez.packages.kmm-commons.*
+net.jahhan.*
+net.jakobnielsen.*
+net.jakot.*
+net.jakubec.*
+net.jakubholy.jeeutils.*
+net.jakubholy.jeeutils.jsfelcheck.*
+net.jakubholy.testing.*
+net.jakubpas.*
+net.jalg.*
+net.jamesandrew.*
+net.jamesbaca.ascent.*
+net.jangaroo.*
+net.jangaroo.com.codecatalyst.*
+net.jangaroo.com.sencha.*
+net.jangaroo.flash.flixel.*
+net.jangaroo.org.requirejs.*
+net.janklab.jump.*
+net.janklab.opp.*
+net.jasima.*
+net.java.*
+net.java.abeille.*
+net.java.balloontip.*
+net.java.dev.*
+net.java.dev.activeobjects.*
+net.java.dev.ajax4jsf.*
+net.java.dev.annsor.*
+net.java.dev.appframework.*
+net.java.dev.beansbinding.*
+net.java.dev.designgridlayout.*
+net.java.dev.dunamis.*
+net.java.dev.eval.*
+net.java.dev.faces-chain.*
+net.java.dev.flexdock.*
+net.java.dev.footprint.*
+net.java.dev.fuse.*
+net.java.dev.glassfish.*
+net.java.dev.glazedlists.*
+net.java.dev.gluegen.*
+net.java.dev.inflector.*
+net.java.dev.javacc.*
+net.java.dev.jaxb2-commons.*
+net.java.dev.jets3t.*
+net.java.dev.jgoodies.*
+net.java.dev.jintention.*
+net.java.dev.jna.*
+net.java.dev.jogl.*
+net.java.dev.jsr-275.*
+net.java.dev.laf-plugin.*
+net.java.dev.laf-widget.*
+net.java.dev.mocquer.*
+net.java.dev.msv.*
+net.java.dev.msv.datatype.xsd.*
+net.java.dev.nimbus.*
+net.java.dev.richjtable.*
+net.java.dev.rome.*
+net.java.dev.scenegraph.*
+net.java.dev.sommer.*
+net.java.dev.spring-annotation.*
+net.java.dev.stax-utils.*
+net.java.dev.swing-layout.*
+net.java.dev.swinghelper.*
+net.java.dev.textile-j.*
+net.java.dev.timingframework.*
+net.java.dev.urlrewrite.*
+net.java.dev.vcc.*
+net.java.dev.vcc.thirdparty.*
+net.java.dev.webdav.*
+net.java.dev.weblets.*
+net.java.dev.xadisk.*
+net.java.dev.xwork-optional.*
+net.java.excelbundle.*
+net.java.hulp.i18n.*
+net.java.hulp.i18ntask.*
+net.java.javabuild.*
+net.java.jawr.*
+net.java.jinput.*
+net.java.jogl.*
+net.java.jutils.*
+net.java.linoleum.*
+net.java.loci.*
+net.java.maven-incremental-build.*
+net.java.msrp.*
+net.java.openjdk.cacio.*
+net.java.openjfx.backport.*
+net.java.quickcheck.*
+net.java.sezpoz.*
+net.java.sezpoz.demo.*
+net.java.sigtest.*
+net.java.spnego.*
+net.java.timingframework.*
+net.java.truecommons.*
+net.java.truelicense.*
+net.java.trueupdate.*
+net.java.truevfs.*
+net.java.xadisk.*
+net.javacrumbs.*
+net.javacrumbs.completion-stage.*
+net.javacrumbs.future-converter.*
+net.javacrumbs.hamcrest-logger.*
+net.javacrumbs.jadler-jdk.*
+net.javacrumbs.json-unit.*
+net.javacrumbs.rest-fire.*
+net.javacrumbs.shedlock.*
+net.javahippie.jukebox.*
+net.javalib.*
+net.javapla.chains.*
+net.javapla.jawn.*
+net.javaw.*
+net.jawr.*
+net.jawr.dwr.*
+net.jawr.extensions.*
+net.jawr.tools.*
+net.jazdw.*
+net.jcazevedo.*
+net.jcip.*
+net.je2sh.*
+net.jemzart.*
+net.jeremybrooks.*
+net.jetblack.feedbus.*
+net.jexler.*
+net.jexler.leanengine.*
+net.jextra.*
+net.jfsanchez.netty.*
+net.jhorstmann.*
+net.jini.*
+net.jini.lookup.*
+net.jkcode.*
+net.jkcode.jkmvc.*
+net.jkcode.jksoa.*
+net.jkernelmachines.*
+net.jlxxw.*
+net.jmatrix.*
+net.jmob.*
+net.jnellis.*
+net.jnimble.*
+net.joala.*
+net.jockx.*
+net.jodah.*
+net.joeaustin.easyxml.*
+net.joeclark.proceduralgeneration.*
+net.joelinn.*
+net.johnluetke.WeatherAPI.*
+net.johnmcdonnell.netbeans.*
+net.jokubasdargis.buildtimer.*
+net.jokubasdargis.rxbus.*
+net.jokubasdargis.rxeither.*
+net.jolivier.*
+net.jomcraft.defaultsettings.*
+net.jomcraft.jclib.*
+net.jonathangiles.microprofile.configsource.azure.keyvault.*
+net.jonathangiles.tools.*
+net.joningi.*
+net.joshka.*
+net.jp.saf.http.cookie.*
+net.jp.saf.sastruts.*
+net.jperf.*
+net.jplugin.*
+net.jplugin.extension.*
+net.jplugin.mvn.*
+net.jplugin.pom.*
+net.jpountz.lz4.*
+net.jquant.*
+net.jqwik.*
+net.jradius.*
+net.jrouter.*
+net.jrouter.worker.*
+net.jsign.*
+net.jsmscs.*
+net.jsunit.*
+net.jthink.*
+net.jtownson.*
+net.ju-n.*
+net.ju-n.auto-instrument.*
+net.ju-n.benchmark.*
+net.ju-n.bonita.connectors.*
+net.ju-n.commons-dbcp-jmx.*
+net.ju-n.compile-command-annotations.*
+net.ju-n.maven.doxia.*
+net.ju-n.maven.plugins.*
+net.ju-n.maven.plugins.vagrant-maven-plugin.it.boxes.*
+net.ju-n.maven.skins.*
+net.juanlopes.lazycleaner.*
+net.jueb.*
+net.justmachinery.*
+net.justmachinery.futility.*
+net.justmachinery.kdbgen.*
+net.justmachinery.shellin.*
+net.jworkflow.*
+net.jxta.*
+net.kaczmarzyk.*
+net.kafujo.*
+net.kaliber.*
+net.kanstren.osmo.*
+net.kanstren.tcptunnel.*
+net.karneim.*
+net.katsstuff.*
+net.kautler.*
+net.kawinski.logging.*
+net.kdks.*
+net.kemitix.*
+net.kemitix.aws.*
+net.kemitix.checkstyle.*
+net.kemitix.s3sftp.*
+net.kemitix.slushy.*
+net.kemitix.thorp.*
+net.kemitix.tiles.*
+net.kemitix.ugiggle.*
+net.kemuri9.*
+net.kenblair.*
+net.kencochrane.raven.*
+net.kennychua.*
+net.kenro-ji-jin.*
+net.kfoundation.*
+net.kianoni.*
+net.kidoz.sdk.*
+net.kieker-monitoring.*
+net.kierenb.*
+net.kigawa.kutil.*
+net.kilger.mockins.*
+net.killa.kept.*
+net.kindeditor.*
+net.kindleit.*
+net.kingborn.*
+net.kingmc.*
+net.kingmc.common.*
+net.kkppyy.*
+net.klakegg.pkix.*
+net.klazz.soccf.*
+net.kleinhaneveld.cli.*
+net.kleinhaneveld.fn.*
+net.kolotyluk.java.*
+net.koofr.*
+net.kosto.*
+net.kotek.*
+net.kothar.*
+net.kozelka.ai.*
+net.kozelka.kapt.*
+net.kozelka.maven.*
+net.kozelka.runjar.*
+net.kpipes.*
+net.krazyweb.*
+net.kreatious.pianoleopard.*
+net.kriomant.buketan.*
+net.krotscheck.*
+net.krotscheck.dfr.*
+net.krotscheck.jersey2.*
+net.ksmr.*
+net.kuhlmeyer.*
+net.kumbhar.dx.*
+net.kurobako.*
+net.kut3.*
+net.kut3.cache.*
+net.kut3.data.*
+net.kut3.draft.*
+net.kut3.http.*
+net.kut3.http.server.*
+net.kut3.messaging.*
+net.kuujo.*
+net.kuujo.alleycat.*
+net.kuujo.catalog.*
+net.kuujo.catalyst.*
+net.kyori.*
+net.kyori.moonshine.*
+net.kyu_mu.*
+net.lachlanmckee.*
+net.ladenthin.*
+net.ladstatt.*
+net.lag.*
+net.lageto.monero.*
+net.lakis.*
+net.lamberto.*
+net.lamberto.junit.*
+net.lamberto.junit.jpa.*
+net.lamgc.*
+net.landzero.*
+net.lanxingren.*
+net.lapismc.*
+net.lariverosc.*
+net.laroueverte.stjs.bridge.*
+net.lbruun.*
+net.lbruun.aws.*
+net.lbruun.aws.ebpackager.*
+net.lbruun.keyedlocks.*
+net.lbruun.netbeans.*
+net.lbruun.springboot.*
+net.ldvsoft.simplex-lp-solver.*
+net.leadware.*
+net.leanera.*
+net.leanix.*
+net.leanix.poms.*
+net.lecousin.*
+net.lecousin.compression.*
+net.lecousin.core.loaders.*
+net.lecousin.framework.*
+net.lecousin.framework.application-loader.*
+net.lecousin.framework.network.*
+net.lecousin.framework.system.*
+net.lecousin.reactive-data-relational.*
+net.ledem.*
+net.leibman.*
+net.lenni0451.*
+net.lenni0451.classtransform.*
+net.lenni0451.mcstructs-bedrock.*
+net.lenni0451.mcstructs.*
+net.leodb.config.*
+net.leodb.dynamodb.*
+net.leodb.unleash.*
+net.lepshi.commons.*
+net.lepshi.fitnesse.multitables.*
+net.lessy.*
+net.librec.*
+net.liftmodules.*
+net.liftweb.*
+net.liftweb.examples.*
+net.lightapi.*
+net.lightbody.able.*
+net.lightbody.bmp.*
+net.lightoze.errbit.*
+net.lightoze.gwt-i18n-server.*
+net.lightoze.jooq-extras.*
+net.ligun.*
+net.lingala.*
+net.lingala.zip4j.*
+net.linkfuture.*
+net.linksfield.cube.*
+net.lizalab.*
+net.lizalab.util.*
+net.lizhao.*
+net.lkrnac.lib.*
+net.lkrnac.libs.*
+net.lleida.json.*
+net.lo2k.*
+net.loadbang.*
+net.logicsquad.*
+net.logstash.log4j.*
+net.logstash.logback.*
+net.lonewolfcode.opensource.springutilities.*
+net.loobpack.kafka-connect-healthchecks.*
+net.loomchild.*
+net.lopht.maven-plugins.*
+net.loxal.*
+net.lshift.*
+net.lshift.diffa.*
+net.lshift.javamail.*
+net.ltgt.dagger.*
+net.ltgt.gradle.*
+net.ltgt.gradle.incap.*
+net.ltgt.guice.*
+net.ltgt.gwt.archetypes.*
+net.ltgt.gwt.maven.*
+net.ltgt.jaxrs.*
+net.ltltd.*
+net.luckperms.*
+net.lucubrators.*
+net.lucypoulton.*
+net.lukepalmer.*
+net.lulab.drived.*
+net.lulihu.*
+net.lullabyte.*
+net.luminis.jmeter.*
+net.luohuasheng.bee.*
+net.luohuasheng.framework.*
+net.luohuasheng.framework.ability.*
+net.luohuasheng.framework.components.*
+net.luohuasheng.framework.starters.*
+net.lusade.*
+net.lustenauer.*
+net.lustlab.colorlib.*
+net.lustlab.framer.*
+net.lustlab.horizon.*
+net.lustlab.packer.*
+net.lvsq.*
+net.lz1998.*
+net.mabboud.fontverter.*
+net.mabboud.gfxassert.*
+net.madtiger.shared.lock.*
+net.maffoo.*
+net.magik6k.*
+net.magik6k.jwwf.*
+net.magja.*
+net.mahdilamb.*
+net.mahmutkocas.*
+net.mailific.*
+net.mailjimp.*
+net.mainclass.*
+net.maizegenetics.*
+net.maku.*
+net.malisis.*
+net.mamoe.*
+net.mamoe.yamlkt.*
+net.manub.*
+net.maritimecloud.*
+net.maritimecloud.3rdparty.*
+net.maritimecloud.examples.*
+net.maritimecloud.mms.*
+net.maritimecloud.msdl.*
+net.maritimecloud.pki.*
+net.maritimeconnectivity.eNav.*
+net.maritimeconnectivity.mrn.*
+net.maritimeconnectivity.pki.*
+net.markenwerk.*
+net.markjfisher.*
+net.markwalder.*
+net.marvk.fs.*
+net.mas0061.brms.drools.plugins.*
+net.masterthought.*
+net.matchproject.*
+net.mauhiz.*
+net.maxwoods.*
+net.mayope.*
+net.mbonnin.bare-graphql.*
+net.mbonnin.golatac.*
+net.mbonnin.kinta.*
+net.mbonnin.mooauth.*
+net.mbonnin.r8.*
+net.mbonnin.sqldelight.*
+net.mbonnin.vespene.*
+net.mbonnin.xoxo.*
+net.mbonnin.zippo.*
+net.md-5.*
+net.mdatools.*
+net.media.*
+net.mediascope.*
+net.meilcli.librarian.*
+net.meilcli.rippletext.*
+net.meku.chameleon.*
+net.meku.cylone.*
+net.meku.querydsl.*
+net.metadrift.*
+net.metaquotes.finteza.*
+net.mezzdev.*
+net.mfjassociates.maven.*
+net.mfjassociates.pdf.*
+net.mfjassociates.tools.*
+net.mgorski.quicktag.*
+net.mguenther.gen.*
+net.mguenther.idem.*
+net.mguenther.kafka.*
+net.micedre.keycloak.*
+net.michalp.*
+net.microsoft-powerbi.*
+net.micwin.ticino.*
+net.micwin.tindata.*
+net.middell.*
+net.mikehardy.*
+net.mikera.*
+net.mikolak.*
+net.milanqiu.mimas.*
+net.mimieye.*
+net.mindengine.*
+net.minecrell.*
+net.minestom.*
+net.mingsoft.*
+net.minidev.*
+net.mintern.*
+net.miob.maven.*
+net.mircomacrelli.*
+net.mlbox.*
+net.mlw.*
+net.mm2d.color-chooser.*
+net.mm2d.log.*
+net.mm2d.mmupnp.*
+net.mm2d.preference.*
+net.mm2d.touchicon.*
+net.mmgg.*
+net.mobilengage.sdk.*
+net.mobilize.snowpark-extensions.*
+net.moetang.*
+net.moneyspace.*
+net.monperrus.*
+net.morher.house.*
+net.morher.ui-connect.*
+net.morimekta.providence.*
+net.morimekta.tiny.server.*
+net.morimekta.utils.*
+net.mossol.bot.*
+net.mostlyoriginal.artemis-odb.*
+net.motionintelligence.*
+net.mountainblade.*
+net.moznion.*
+net.moznion.arnold.*
+net.mready.apiclient.*
+net.mready.frameplayer.*
+net.mready.hover.*
+net.mready.json.*
+net.mready.photon.*
+net.mready.picker.*
+net.mready.progresslayouts.*
+net.mstdev.*
+net.mttechsolutions.*
+net.mwgr.testing.gitlab.parent.*
+net.myrrix.*
+net.n12n.exif.*
+net.n2oapp.cache.*
+net.n2oapp.cloud.*
+net.n2oapp.context.*
+net.n2oapp.criteria.*
+net.n2oapp.datastreaming.*
+net.n2oapp.enginefactory.*
+net.n2oapp.filters.*
+net.n2oapp.framework.*
+net.n2oapp.framework.security.*
+net.n2oapp.platform.*
+net.n2oapp.properties.*
+net.n2oapp.register.*
+net.n2oapp.routing.*
+net.n2oapp.watchdir.*
+net.nacos.*
+net.named-data.*
+net.named-data.jndn-extra.*
+net.named-data.jndn-xx.*
+net.namekdev.entity_tracker.*
+net.namrats.commons.*
+net.nan21.dnet.*
+net.nashihara.*
+net.navatwo.*
+net.navatwo.gradle.*
+net.nawaman.*
+net.nawaman.collection.*
+net.nawaman.lambdacalculusj.*
+net.nczonline.web.*
+net.nebupookins.*
+net.neferett.*
+net.nemerosa.*
+net.nemerosa.ontrack.*
+net.neoremind.*
+net.netheos.*
+net.netnook.repeg.*
+net.nextencia.*
+net.nextpulse.*
+net.nharyes.*
+net.nicbell.emveeaye.*
+net.nicbell.material-lists.*
+net.nicholaswilliams.java.*
+net.nicholaswilliams.java.licensing.*
+net.nicoulaj.*
+net.nicoulaj.compile-command-annotations.*
+net.nicoulaj.maven.plugins.*
+net.niebes.*
+net.niiranen.*
+net.nikore.consul.*
+net.nikore.etcd.*
+net.nikore.gozer.*
+net.nilosplace.*
+net.ninjacat.*
+net.nisgits.executablewar.*
+net.nisgits.gradle.*
+net.nitrado.*
+net.nlacombe.*
+net.nmoncho.*
+net.nodebox.*
+net.noerd.*
+net.nokok.draft.*
+net.nokok.draft.annotations.*
+net.northfuse.*
+net.northfuse.sfop.*
+net.nowina.cadmelia.*
+net.nowtryz.*
+net.nprod.*
+net.nueca.androidtoolbox.*
+net.nullschool.*
+net.nurigo.*
+net.oauth-2.*
+net.oauth.*
+net.oauth.core.*
+net.objecthunter.*
+net.objectlab.*
+net.objectlab.kit.*
+net.objectlab.kit.datecalc.*
+net.obvj.*
+net.octopvp.*
+net.octyl.*
+net.octyl.apt-creator.*
+net.octyl.elivi.*
+net.oddpoet.*
+net.odoframework.*
+net.offecka.*
+net.officefloor.*
+net.officefloor.activity.*
+net.officefloor.cabinet.*
+net.officefloor.cache.*
+net.officefloor.core.*
+net.officefloor.declare.*
+net.officefloor.dependency.*
+net.officefloor.docker.*
+net.officefloor.eclipse.*
+net.officefloor.editor.*
+net.officefloor.example.*
+net.officefloor.identity.*
+net.officefloor.javascript.*
+net.officefloor.jee.*
+net.officefloor.kotlin.*
+net.officefloor.maven.*
+net.officefloor.package.*
+net.officefloor.pay.*
+net.officefloor.persistence.*
+net.officefloor.plugin.*
+net.officefloor.polyglot.*
+net.officefloor.reactor.*
+net.officefloor.scala.*
+net.officefloor.script.*
+net.officefloor.server.*
+net.officefloor.shim.*
+net.officefloor.spring.*
+net.officefloor.tool.*
+net.officefloor.tutorial.*
+net.officefloor.vertx.*
+net.officefloor.viewer.*
+net.officefloor.web.*
+net.ogalako.*
+net.ognyanov.niogram.*
+net.oijon.*
+net.olivo.*
+net.oneandone.*
+net.oneandone.cosmo.*
+net.oneandone.gocd.*
+net.oneandone.httpselftest.*
+net.oneandone.ical4j.*
+net.oneandone.ioc-unit.*
+net.oneandone.jsoup.*
+net.oneandone.kafka-clustered-task-scheduler.*
+net.oneandone.maven.*
+net.oneandone.maven.extensions.*
+net.oneandone.maven.plugins.*
+net.oneandone.maven.poms.*
+net.oneandone.maven.summon.*
+net.oneandone.mockrunner.*
+net.oneandone.neberus.*
+net.oneandone.reactive.*
+net.oneandone.reflections8.*
+net.oneandone.spock.*
+net.oneandone.stool.*
+net.oneandone.testlinkjunit.*
+net.oneandone.troilus.*
+net.onebean.*
+net.onedaybeard.agrotera.*
+net.onedaybeard.artemis.*
+net.onedaybeard.bitvector.*
+net.onedaybeard.collections-by.*
+net.onedaybeard.ecs.*
+net.onedaybeard.graftt.*
+net.onedaybeard.kbdluv.*
+net.onedaybeard.sift.*
+net.onedaybeard.sift.instrumenter.*
+net.onedaybeard.sift.template.*
+net.onedaybeard.transducers.*
+net.onelitefeather.microtus.*
+net.onelitefeather.microtus.testing.*
+net.ontopia.*
+net.ontopia.external.org.tmapi.*
+net.open-esb.*
+net.open-esb.admin.*
+net.open-esb.core.*
+net.open-esb.external.hulp.*
+net.open-esb.netbeans.*
+net.open-esb.runtime.standalone.*
+net.openhft.*
+net.openhft.com.binance.api.*
+net.openid.*
+net.opentsdb.*
+net.openurp.ecupl.*
+net.openurp.ecupl.platform.*
+net.openurp.lixin.admission.*
+net.openurp.sfu.*
+net.openurp.sfu.platform.*
+net.openurp.shcmusic.*
+net.optionfactory.*
+net.optionfactory.keycloak.*
+net.optionfactory.spring.*
+net.orandja.obor.*
+net.orandja.shadowlayout.*
+net.orandja.tt.*
+net.orange-box.storebox.*
+net.orbyfied.aspen.*
+net.orbyfied.coldlib.*
+net.orbyfied.j8.*
+net.orbyfied.osf.*
+net.orbyfied.xtr.*
+net.orekyuu.*
+net.orfjackal.nestedjunit.*
+net.orfjackal.retrolambda.*
+net.orfjackal.specsy.*
+net.ormr.asmkt.*
+net.ormr.eventbus.*
+net.ormr.katbox.*
+net.ormr.kcss.*
+net.ormr.kixiv.*
+net.ormr.kommando.*
+net.ormr.krautils.*
+net.ormr.semver4k.*
+net.ormr.tornadobinder.*
+net.ormr.userskripter.*
+net.orpiske.*
+net.oschina.arvin.*
+net.oschina.bilbodai.common.*
+net.oschina.bilbodai.common.beanutil.*
+net.oschina.bilbodai.common.retrofitor.*
+net.oschina.bilbodai.commons.*
+net.oschina.bilbodai.maven.*
+net.oschina.bilbodai.maven.filter.*
+net.oschina.bilbodai.maven.plugin.*
+net.oschina.dajiangnan.*
+net.oschina.durcframework.*
+net.oschina.haopeng.*
+net.oschina.htmlsucker.*
+net.oschina.j2cache.*
+net.oschina.jmind.*
+net.oschina.likaixuan.*
+net.oschina.michaelmofa.*
+net.oschina.myzhang.*
+net.oschina.suyeer.*
+net.oschina.wp3355168.*
+net.oschina.zcx7878.*
+net.oschina.zwlzwl376.*
+net.osgiliath.*
+net.osgiliath.archetypes.*
+net.osgiliath.features.*
+net.osgiliath.framework.*
+net.osgiliath.hello.*
+net.osgiliath.itests.*
+net.osgiliath.modules.*
+net.osgiliath.poms.*
+net.osgiliath.samples.*
+net.osgiliath.wrappers.*
+net.osomahe.*
+net.ossindex.*
+net.osslabz.*
+net.osslabz.evm.*
+net.oualid.maven.plugins.*
+net.ozwolf.*
+net.p-lucky.*
+net.packet.*
+net.paissad.tools.reqcoco.*
+net.paissad.tools.reqcoco.maven.*
+net.paissad.tools.reqcoco.parser.*
+net.paoding.*
+net.pargar.konfigurations.*
+net.pdiaz.nfunction.*
+net.peachjean.commons.*
+net.peachjean.confobj.*
+net.peachjean.differentia.*
+net.peachjean.guice.*
+net.peachjean.modularwebapp.*
+net.peachjean.mojo.pegdown.*
+net.peachjean.overeasy.*
+net.peachjean.pegdown.uml.*
+net.peachjean.restmx.*
+net.peachjean.slf4j.mojo.*
+net.peachjean.tater.*
+net.peanuuutz.*
+net.peanuuutz.tomlkt.*
+net.pearx.cursekt.*
+net.pearx.kasechange.*
+net.pearx.kpastebin.*
+net.pearx.okservable.*
+net.pechorina.kairos.automat.*
+net.pedroloureiro.mvflow.*
+net.peihuan.*
+net.pelsmaeker.*
+net.pennix.*
+net.petitviolet.*
+net.phaedra.*
+net.pincette.*
+net.piotrturski.integrationjtest.*
+net.piotrturski.testegration.*
+net.pishen.*
+net.pixiv.*
+net.pixiv.charcoal.*
+net.pkhapps.appmodel4flow.*
+net.placemarkt.*
+net.playq.*
+net.plcarmel.cryptic-sequences.*
+net.plsar.*
+net.plyse.*
+net.pocorall.*
+net.polyv.*
+net.polyv.android.*
+net.polyv.test.*
+net.portswigger.*
+net.portswigger.burp.api.driver.*
+net.portswigger.burp.extender.*
+net.portswigger.burp.extensions.*
+net.portswigger.extender.*
+net.posick.*
+net.postgis.*
+net.postgis.tools.*
+net.pragplat.*
+net.praqma.*
+net.prasenjit.*
+net.pravian.*
+net.pricefx.*
+net.priuli.*
+net.processweavers.*
+net.projectmonkey.*
+net.projecttl.*
+net.propromp.*
+net.pryoscode.*
+net.psgglobal.wsrpc.*
+net.psybit.factory.*
+net.purelic.*
+net.pwall.dom.*
+net.pwall.el.*
+net.pwall.html.*
+net.pwall.json.*
+net.pwall.log.*
+net.pwall.maven.*
+net.pwall.mustache.*
+net.pwall.text.*
+net.pwall.util.*
+net.pwall.xml.*
+net.pwall.yaml.*
+net.q2ek.*
+net.qieshu.*
+net.qihoo.*
+net.qiujuer.common.*
+net.qiujuer.genius.*
+net.qiujuer.lame.*
+net.qiujuer.library.planck.*
+net.qiujuer.widget.*
+net.quanter.*
+net.quasardb.*
+net.quedex.*
+net.quies.colfer.*
+net.quux00.simplecsv.*
+net.r-w-x.*
+net.r-w-x.netbeans.*
+net.radai.*
+net.raidstone.*
+net.rakugakibox.spring.boot.*
+net.rakugakibox.springbootext.*
+net.rakugakibox.util.*
+net.ramso.*
+net.randomsync.*
+net.ranides.*
+net.rapture.*
+net.rationalminds.*
+net.raumzeitfalle.fx.*
+net.raumzeitfalle.registration.*
+net.ravendb.*
+net.razorvine.*
+net.rcarz.*
+net.rdrei.android.buildtimetracker.*
+net.rdrei.android.dirchooser.*
+net.reactivecore.*
+net.reborg.*
+net.recalibrate.*
+net.recommenders.rival.*
+net.redhogs.actuarius.*
+net.redhogs.config.*
+net.redhogs.cronparser.*
+net.redhogs.inflatable.*
+net.redhogs.sbt.*
+net.redhogs.sprawler.*
+net.redora.*
+net.redpipe.*
+net.reini.*
+net.relapps.*
+net.relativt.battlecodeships.*
+net.relaysoft.commons.*
+net.relaysoft.robotframework.*
+net.renfei.*
+net.renfei.philisense.*
+net.rentworthy.*
+net.researchgate.*
+net.retailnext.*
+net.revelc.apilyzer.*
+net.revelc.code.*
+net.revelc.code.formatter.*
+net.revenj.*
+net.reyadeyat.*
+net.rforge.*
+net.rgielen.*
+net.rhuanrocha.*
+net.riccardocossu.autodoc.*
+net.riccardocossu.i18split.*
+net.ricebean.tools.colorstrip.*
+net.ricebean.tools.pointcloud.*
+net.ricecode.*
+net.rictech.util.*
+net.riminder.riminder.*
+net.rimoto.*
+net.riotopsys.*
+net.riotopsys.factotum.*
+net.riotopsys.shortbus.*
+net.ripe.commons.*
+net.ripe.ipresource.*
+net.ripe.rpki.*
+net.rlp.gitlab.s4axschu.*
+net.robertcollins.*
+net.roboconf.*
+net.robyf.*
+net.rollercoders.akka.*
+net.rootdev.*
+net.rootware.*
+net.roseboy.*
+net.rosien.*
+net.rossillo.mvc.cache.*
+net.rossonet.*
+net.rossonet.bbb.*
+net.rossonet.commons.*
+net.rossonet.commons.command.*
+net.rossonet.pmos.*
+net.roughdesign.ajiwa.*
+net.rpcnet.securitytoolkit.*
+net.rr-world.*
+net.rubygrapefruit.*
+net.ruippeixotog.*
+net.ruixinglong.*
+net.ruixinglong.java-slice-upload.*
+net.rumati.logging.*
+net.rumati.maven.plugins.*
+net.rumati.sql.*
+net.runeduniverse.lib.rogm.*
+net.runeduniverse.lib.rogm.lang.*
+net.runeduniverse.lib.rogm.modules.*
+net.runeduniverse.lib.rogm.parser.*
+net.runeduniverse.lib.utils.*
+net.runeduniverse.tools.build-helper.*
+net.runeduniverse.tools.maven.r4m.*
+net.runne.*
+net.ryian.*
+net.s-arash.*
+net.s-jr.utils.*
+net.s-jr.utils.converterutils.*
+net.s-jr.utils.sql.*
+net.s-jr.utils.sql.parametertype.*
+net.s-jr.utils.sql.rsloader.*
+net.s-jr.utils.sql.spring.*
+net.s17t.*
+net.s_mach.*
+net.saff.checkmark.*
+net.sagebits.*
+net.saik0.android.unifiedpreference.*
+net.sailes.*
+net.sakola.*
+net.saliman.*
+net.saltando.*
+net.samuelcampos.*
+net.samystudio.permissionlauncher.*
+net.samystudio.rxlocationmanager.*
+net.samystudio.rxpicasso.*
+net.sandrogrzicic.*
+net.sandrohc.*
+net.sanori.spark.*
+net.sansa-stack.*
+net.sansa-stack.thirdparty.it.unibz.inf.ontop.*
+net.sarazan.*
+net.sargue.*
+net.savantly.*
+net.savantly.franchise.*
+net.savantly.geo.*
+net.savantly.learning.*
+net.savantly.log4j2.*
+net.savantly.mesh.*
+net.savantly.metrics.*
+net.savantly.security.*
+net.savantly.sprout.*
+net.sc8s.*
+net.scalaleafs.*
+net.scalapro.*
+net.scalax.*
+net.scalax.djx314.*
+net.scalax.simple.*
+net.scalytica.*
+net.scarlettsystems.java.*
+net.scattersphere.*
+net.scharlie.lj4l.*
+net.schmizz.*
+net.scriptability.*
+net.scrumplex.*
+net.sdruskat.*
+net.seabears.*
+net.sealake.*
+net.secodo.besecurefirewall.*
+net.secodo.jcircuitbreaker.*
+net.sectorsieteg.*
+net.sederholms.*
+net.seedboxer.*
+net.seeseekey.*
+net.seesharpsoft.sharping.*
+net.seesharpsoft.spring.*
+net.segner.maven.plugins.*
+net.segoia.*
+net.seidengarn.*
+net.selenate.*
+net.sendcloud.sdk.*
+net.seninp.*
+net.serenity-bdd.*
+net.serenity-bdd.maven.plugins.*
+net.servicegrid.*
+net.servicestack.*
+net.sevecek.*
+net.sf.*
+net.sf.a2j.*
+net.sf.advanced-gwt.*
+net.sf.aguacate.*
+net.sf.aguacate.cloud.rabbitmq.*
+net.sf.aguacate.clud.aws.*
+net.sf.aguacate.clud.azure.*
+net.sf.aguacate.clud.local.*
+net.sf.aguacate.effort.async.*
+net.sf.aguacate.effort.scheduler.*
+net.sf.aguacate.filter.*
+net.sf.aguacate.filter.security.oauth2.user.db.*
+net.sf.aguacate.scheduler.*
+net.sf.aguacate.security.service.*
+net.sf.aguacate.security.service.jwt.*
+net.sf.aguacate.security.service.oauth2.*
+net.sf.aguacate.swagger.*
+net.sf.ahtutils.*
+net.sf.aislib.*
+net.sf.aislib.goodies.*
+net.sf.aislib.tools.entities.*
+net.sf.aislib.tools.mapping.*
+net.sf.albermojoplugin.*
+net.sf.alchim.*
+net.sf.alchim.jedit.*
+net.sf.androidscents.*
+net.sf.androidscents.signature.*
+net.sf.andromedaioc.*
+net.sf.antenna.*
+net.sf.appinfo.*
+net.sf.applecommander.*
+net.sf.apt-jelly.*
+net.sf.asmock.*
+net.sf.aspect4log.*
+net.sf.assimilate.*
+net.sf.asteriskjava.*
+net.sf.atmodem4j.*
+net.sf.autodao.*
+net.sf.automatic-report-generator.*
+net.sf.auxtestlib.*
+net.sf.aws-syndicate.*
+net.sf.barcode4j.*
+net.sf.beanlib.*
+net.sf.beanpot.*
+net.sf.beanrunner.*
+net.sf.beaver.*
+net.sf.beezle.maven.plugins.*
+net.sf.beezle.maven.poms.*
+net.sf.beezle.mork.*
+net.sf.beezle.ssass.*
+net.sf.beezle.sushi.*
+net.sf.bioutils-proteo.*
+net.sf.bioutils.proteomics.*
+net.sf.biweekly.*
+net.sf.bluecove.*
+net.sf.blunder.*
+net.sf.brunneng.fusie.*
+net.sf.brunneng.jom.*
+net.sf.btb.*
+net.sf.buildbox.*
+net.sf.buildbox.maven.*
+net.sf.buildbox.pom.*
+net.sf.buildbox.strictlogging.*
+net.sf.carafe.jcarafe.*
+net.sf.cathcart.*
+net.sf.cewolf-art.*
+net.sf.chex4j.*
+net.sf.click.*
+net.sf.clirr.*
+net.sf.cobol2j.*
+net.sf.cocmvc.*
+net.sf.common-util.*
+net.sf.composite.*
+net.sf.corn.*
+net.sf.cotelab.*
+net.sf.cotta.*
+net.sf.cotta.asserts.*
+net.sf.cotta.core.*
+net.sf.cotta.ftp.*
+net.sf.cotta.testbase.*
+net.sf.cotta.website.*
+net.sf.cssbox.*
+net.sf.csutils.*
+net.sf.csv-bean.*
+net.sf.cuf.*
+net.sf.czsem.*
+net.sf.datavision.*
+net.sf.dbfit.*
+net.sf.dbinit.*
+net.sf.dbmonster.*
+net.sf.dcdroplet.*
+net.sf.dcutils.*
+net.sf.debian-maven.*
+net.sf.delicious-java.*
+net.sf.derquinsej.*
+net.sf.dnsjava-osgi.*
+net.sf.dobo.*
+net.sf.docbook.*
+net.sf.doolin.*
+net.sf.dozer.*
+net.sf.dtddoc.*
+net.sf.dubtool.*
+net.sf.dyndblayer.*
+net.sf.dynpageplus.*
+net.sf.ebus.*
+net.sf.ehcache.*
+net.sf.ehcache.internal.*
+net.sf.emustudio.*
+net.sf.ennahdi.*
+net.sf.ennahdi.automatic-report-generator.*
+net.sf.ensurelib.*
+net.sf.environments-maven-plugin.*
+net.sf.epsgraphics.*
+net.sf.esfinge.*
+net.sf.excha.*
+net.sf.exlp.*
+net.sf.expectit.*
+net.sf.extcos.*
+net.sf.extjwnl.*
+net.sf.extjwnl.mcr.*
+net.sf.ezmorph.*
+net.sf.falcon.*
+net.sf.fastupload.*
+net.sf.fax4j.*
+net.sf.fck-faces.*
+net.sf.filepiper.*
+net.sf.fireweb.*
+net.sf.flatpack.*
+net.sf.flexjson.*
+net.sf.formlayoutmaker.*
+net.sf.fsp.*
+net.sf.gavgav.*
+net.sf.geal.*
+net.sf.gee.*
+net.sf.geographiclib.*
+net.sf.gluebooster.*
+net.sf.gluebooster.java.*
+net.sf.gluebooster.java.booster.*
+net.sf.gluebooster.java.demos.*
+net.sf.gnasher.*
+net.sf.gnu-hylafax.*
+net.sf.grester.*
+net.sf.grinder.*
+net.sf.groovydice.*
+net.sf.gtools.jms.*
+net.sf.gwt-widget.*
+net.sf.hammockmocks.*
+net.sf.hermesftp.*
+net.sf.hibernate.*
+net.sf.hibernate4gwt.*
+net.sf.hulp.meas.*
+net.sf.ij-plugins.*
+net.sf.ingenias.*
+net.sf.ingenme.*
+net.sf.ipsedixit.*
+net.sf.itcb.addons.cache.*
+net.sf.itcb.addons.monitoring.*
+net.sf.itcb.archetype.*
+net.sf.itcb.common.*
+net.sf.itcb.extension.jaxb.*
+net.sf.itcb.extension.mojo.*
+net.sf.itcb.module.blank.*
+net.sf.j8583.*
+net.sf.jabb.*
+net.sf.jaceko.*
+net.sf.jack4j.*
+net.sf.jacob-project.*
+net.sf.jadretro.*
+net.sf.jagg.*
+net.sf.jaggregate.*
+net.sf.jalarms.*
+net.sf.jali.*
+net.sf.jargsemsat.*
+net.sf.jason.*
+net.sf.jasper2docx.*
+net.sf.jasperreports.*
+net.sf.javaanpr.*
+net.sf.javaclub.*
+net.sf.javafeedparsercommon.*
+net.sf.javagimmicks.*
+net.sf.javamusictag.*
+net.sf.javaprinciples.build.*
+net.sf.javaprinciples.client.*
+net.sf.javaprinciples.core.*
+net.sf.javaprinciples.data.*
+net.sf.javaprinciples.membership.*
+net.sf.javaprinciples.model.*
+net.sf.javaprinciples.modelling.*
+net.sf.javaprinciples.persistence.*
+net.sf.javaprinciples.resource.*
+net.sf.javaprinciples.state.*
+net.sf.javaprinciples.test.*
+net.sf.javaprinciples.web.*
+net.sf.jaxrpc-maven.*
+net.sf.jazzy.*
+net.sf.jbddi.*
+net.sf.jbg.*
+net.sf.jbg.mojo.*
+net.sf.jcgrid.*
+net.sf.jchart2d.*
+net.sf.jcharts.*
+net.sf.jclal.*
+net.sf.jcmdlineparser.*
+net.sf.jcommon.*
+net.sf.jdatabaseimport.*
+net.sf.jdbc-wrappers.*
+net.sf.jdbclistdecorator.*
+net.sf.jdds.*
+net.sf.jdos.*
+net.sf.jeceira.*
+net.sf.jedit-syntax.*
+net.sf.jetro.*
+net.sf.jett.*
+net.sf.jexample.*
+net.sf.jfasta.*
+net.sf.jfastcgi.*
+net.sf.jfcunit.*
+net.sf.jfig.*
+net.sf.jfuzzydate.*
+net.sf.jga.*
+net.sf.jgap.*
+net.sf.jgrapht.*
+net.sf.jguard.*
+net.sf.jguiraffe.*
+net.sf.jiapi.*
+net.sf.jinterflex.*
+net.sf.jipcam.*
+net.sf.jkniv.*
+net.sf.jlogic.*
+net.sf.jlue.*
+net.sf.jlynx.*
+net.sf.jmatchparser.*
+net.sf.jmgf.*
+net.sf.jmimemagic.*
+net.sf.jmpi.*
+net.sf.jnati.*
+net.sf.jni-inchi.*
+net.sf.jni4net.*
+net.sf.jnrpe.*
+net.sf.jodreports.*
+net.sf.joesnmp.*
+net.sf.joost.*
+net.sf.jopt-simple.*
+net.sf.jour.*
+net.sf.jpa-queryfier.*
+net.sf.jpam.*
+net.sf.jpathwatch.*
+net.sf.jped.*
+net.sf.jped.plugins.*
+net.sf.jpf.*
+net.sf.jptools.*
+net.sf.jranges.*
+net.sf.jrtps.*
+net.sf.jsci.*
+net.sf.jsefa.*
+net.sf.jsequnit.*
+net.sf.jsignature.io-tools.*
+net.sf.jsimpletools.*
+net.sf.jsog.*
+net.sf.json-lib.*
+net.sf.jsonunicode.*
+net.sf.jsptest.*
+net.sf.jsqlparser.*
+net.sf.jsqlx.*
+net.sf.jsr107cache.*
+net.sf.jstring.*
+net.sf.jstuff.*
+net.sf.jt400.*
+net.sf.jtables.*
+net.sf.jtidy.*
+net.sf.jtreemap.*
+net.sf.juffrou.*
+net.sf.jung.*
+net.sf.jwordnet.*
+net.sf.jxls.*
+net.sf.jyntax.*
+net.sf.kdgcommons.*
+net.sf.kerner-utils-collections.*
+net.sf.kerner-utils-io.*
+net.sf.kerner-utils-jsf.*
+net.sf.kerner-utils.*
+net.sf.kosmosfs.*
+net.sf.kxml.*
+net.sf.lastjcl.*
+net.sf.launch4j.*
+net.sf.layoutparser.*
+net.sf.ldaptemplate.*
+net.sf.lightair.*
+net.sf.lightairmp.*
+net.sf.locale4j.*
+net.sf.locklib.*
+net.sf.logdistiller.*
+net.sf.logdistiller.logtypes.*
+net.sf.loggersoft.kotlin.*
+net.sf.lucis.*
+net.sf.m-m-m.*
+net.sf.m2-javafxc.*
+net.sf.madp.*
+net.sf.magicgrouplayout.*
+net.sf.mapasuta.*
+net.sf.mapasuta.build.maven.plugins.*
+net.sf.mardao.*
+net.sf.marineapi.*
+net.sf.mastif.*
+net.sf.mathml.*
+net.sf.matrixjavalib.*
+net.sf.matrixjavalib.build.*
+net.sf.maven-autotools.*
+net.sf.maven-har.*
+net.sf.maven-properties-enum-plugin.*
+net.sf.maven-sar.*
+net.sf.mavenjython.*
+net.sf.mavenjython.test.*
+net.sf.mbus4j.*
+net.sf.meka.*
+net.sf.meka.thirdparty.*
+net.sf.mgaip.*
+net.sf.mgp.*
+net.sf.michael-o.*
+net.sf.michael-o.dirctxsrc.*
+net.sf.michael-o.tomcat.*
+net.sf.microlog.*
+net.sf.mime-util.*
+net.sf.minuteproject.*
+net.sf.mmax2.*
+net.sf.mmm.*
+net.sf.moholy.*
+net.sf.mongojdbcdriver.*
+net.sf.morph.*
+net.sf.mpxj.*
+net.sf.mvc-prototype.*
+net.sf.nachocalendar.*
+net.sf.nebular.*
+net.sf.nervalreports.*
+net.sf.nimrod.*
+net.sf.nomin.*
+net.sf.ntru.*
+net.sf.offo.*
+net.sf.ofx4j.*
+net.sf.okapi.*
+net.sf.okapi.applications.*
+net.sf.okapi.connectors.*
+net.sf.okapi.examples.*
+net.sf.okapi.filters.*
+net.sf.okapi.it.*
+net.sf.okapi.lib.*
+net.sf.okapi.linguistic.*
+net.sf.okapi.logbind.*
+net.sf.okapi.longhorn.*
+net.sf.okapi.steps.*
+net.sf.okapi.testutilities.*
+net.sf.okapi.tm.*
+net.sf.openas2.*
+net.sf.opencsv.*
+net.sf.opendse.*
+net.sf.openymsg.*
+net.sf.opk.*
+net.sf.oqt.*
+net.sf.oqt.test.*
+net.sf.oval.*
+net.sf.patterntesting.*
+net.sf.perf4cdi.*
+net.sf.phat.*
+net.sf.portletunit.*
+net.sf.practicalxml.*
+net.sf.prefixedproperties.*
+net.sf.probin.*
+net.sf.proguard.*
+net.sf.psl-library.*
+net.sf.py4j.*
+net.sf.qdwizard.*
+net.sf.qualitycheck.*
+net.sf.r4h.*
+net.sf.randomjunit.*
+net.sf.relish.*
+net.sf.reportengine.*
+net.sf.resultsetmapper.*
+net.sf.retrotranslator.*
+net.sf.robocode.*
+net.sf.rubycollect4j.*
+net.sf.sanity4j.*
+net.sf.saxon.*
+net.sf.scannotation.*
+net.sf.scuba.*
+net.sf.sdedit.*
+net.sf.seaf.*
+net.sf.seaf.mojo.*
+net.sf.seam.perf4j.*
+net.sf.seideframework.*
+net.sf.seleniumjt.*
+net.sf.serfj.*
+net.sf.sevenzipjbinding.*
+net.sf.sf3jswing.*
+net.sf.sfac.*
+net.sf.shadesdb.*
+net.sf.sidaof.*
+net.sf.sido.*
+net.sf.sit.*
+net.sf.smc.*
+net.sf.snmpadaptor4j.*
+net.sf.sociaal.*
+net.sf.sojo.*
+net.sf.sparql-query-bm.*
+net.sf.sparta-spring-web-utils.*
+net.sf.speculoos.*
+net.sf.spring-json.*
+net.sf.springlayout.*
+net.sf.sprockets.*
+net.sf.sprtool.*
+net.sf.squirrel-sql.*
+net.sf.squirrel-sql.cli.*
+net.sf.squirrel-sql.plugins.*
+net.sf.squirrel-sql.thirdparty-non-maven.*
+net.sf.squirrel-sql.thirdparty.non-maven.*
+net.sf.squirrel-sql.thirdpary-non-maven.*
+net.sf.squirrel-sql.translations.*
+net.sf.ssg.tools.*
+net.sf.staccatocommons.*
+net.sf.staf.*
+net.sf.statsvn.*
+net.sf.stax.*
+net.sf.struts.*
+net.sf.sugar.*
+net.sf.sugar.fspath.*
+net.sf.sugar.scl.*
+net.sf.supercsv.*
+net.sf.tacos.*
+net.sf.testextensions.*
+net.sf.testium.*
+net.sf.testngdatabind.*
+net.sf.textile4j.*
+net.sf.tie.*
+net.sf.timecharts.*
+net.sf.tinylaf.*
+net.sf.transmorph.*
+net.sf.treeds4j.*
+net.sf.triemap.*
+net.sf.trove4j.*
+net.sf.tsl2nano.*
+net.sf.tweety.*
+net.sf.tweety.agents.*
+net.sf.tweety.arg.*
+net.sf.tweety.logics.*
+net.sf.tweety.lp.*
+net.sf.tweety.lp.asp.*
+net.sf.twip.*
+net.sf.uadetector.*
+net.sf.ucanaccess.*
+net.sf.uctool.*
+net.sf.ujac.*
+net.sf.wcf-art.*
+net.sf.webdav-servlet.*
+net.sf.webtestfixtures.*
+net.sf.wsag4j.*
+net.sf.wsag4j.rest.*
+net.sf.wsag4j.types.*
+net.sf.xenqtt.*
+net.sf.xisemele.*
+net.sf.xmldb-org.*
+net.sf.xmlform.*
+net.sf.xolite.*
+net.sf.xqparser.*
+net.sf.xradar.*
+net.sf.xsd2pgschema.*
+net.sf.xsemantics.*
+net.sf.xslthl.*
+net.sf.xsltmp.*
+net.sf.xsparql.*
+net.sf.xtext-jbase.*
+net.sf.yac-io.*
+net.sf.yal10n.*
+net.sf.zenbaf.*
+net.sghill.jenkins.*
+net.shambolica.helperl.*
+net.sheehantech.cherry.*
+net.sheehantech.databaseloader.*
+net.shibboleth.*
+net.shibboleth.ext.*
+net.shibboleth.utilities.*
+net.shinsoft.imagepicker.*
+net.shmin.*
+net.sickmc.*
+net.sigmalab.*
+net.sigmalab.maven.plugins.*
+net.sigmalab.trang.*
+net.sigusr.*
+net.siisise.*
+net.silkmc.*
+net.silthus.schat.*
+net.simno.kortholt.*
+net.simondieterle.*
+net.simonix.scripts.*
+net.simonvt.*
+net.simonvt.menudrawer.*
+net.simonvt.menudrawer.sample.*
+net.simonvt.messagebar.*
+net.simonvt.schematic.*
+net.simpledynamics.*
+net.sinetstream.*
+net.sinodawn.*
+net.sinofool.*
+net.sixpointsix.*
+net.sizovs.*
+net.sjava.appstore.*
+net.skobow.*
+net.skyscanner.backpack.*
+net.skyscanner.hello.*
+net.slozzer.*
+net.smacke.*
+net.smallyu.maven.*
+net.smartam.leeloo.*
+net.smartcosmos.*
+net.smartcosmos.extension.*
+net.smartlab.config.*
+net.smartlab.web.*
+net.smolok.*
+net.smoofyuniverse.*
+net.smoofyuniverse.jacoco-offline.*
+net.smoofyuniverse.jacoco-report-aggregation-offline.*
+net.snaq.*
+net.snortum.*
+net.snowflake.*
+net.so1.*
+net.solarnetwork.common.*
+net.solarnetwork.common.test.*
+net.solarnetwork.external.*
+net.solarnetwork.node.*
+net.solarnetwork.node.test.*
+net.somta.*
+net.soundvibe.*
+net.sourcedestination.*
+net.sourceforge.*
+net.sourceforge.addressing.*
+net.sourceforge.ajaxanywhere.*
+net.sourceforge.andspidclient.*
+net.sourceforge.argo.*
+net.sourceforge.argparse4clj.*
+net.sourceforge.argparse4j.*
+net.sourceforge.barbecue.*
+net.sourceforge.basher.*
+net.sourceforge.bpmn.*
+net.sourceforge.cardme.*
+net.sourceforge.ccxjc.*
+net.sourceforge.chipper.*
+net.sourceforge.chopchophttpclient.*
+net.sourceforge.ckjm.*
+net.sourceforge.cobertura.*
+net.sourceforge.cobertura.codestyle.*
+net.sourceforge.cobertura.conversion.*
+net.sourceforge.cobertura.conversion.api.*
+net.sourceforge.cobertura.interaction.*
+net.sourceforge.cobertura.interaction.annotations.*
+net.sourceforge.cobertura.interaction.annotations.api.*
+net.sourceforge.cobertura.metrics.*
+net.sourceforge.cobertura.metrics.api.*
+net.sourceforge.cobertura.metrics.model.*
+net.sourceforge.cobertura.poms.*
+net.sourceforge.collections.*
+net.sourceforge.cruisecontrol.*
+net.sourceforge.crumble.*
+net.sourceforge.csparsej.*
+net.sourceforge.cssparser.*
+net.sourceforge.csvjdbc.*
+net.sourceforge.csvscalpar.*
+net.sourceforge.ctakesresources.*
+net.sourceforge.databeans.*
+net.sourceforge.datamakerapi.*
+net.sourceforge.dita-ot.*
+net.sourceforge.dribble.*
+net.sourceforge.dynamicreports.*
+net.sourceforge.expectj.*
+net.sourceforge.f2j.*
+net.sourceforge.fiftyone-java.*
+net.sourceforge.findbugs.*
+net.sourceforge.floggy.*
+net.sourceforge.fmpp.*
+net.sourceforge.fuzzyservices.*
+net.sourceforge.getl.*
+net.sourceforge.html5valdialect.*
+net.sourceforge.htmlcleaner.*
+net.sourceforge.htmlunit.*
+net.sourceforge.ickles.*
+net.sourceforge.jabm.*
+net.sourceforge.jadex.*
+net.sourceforge.jasa.*
+net.sourceforge.javacsv.*
+net.sourceforge.javadpkg.*
+net.sourceforge.javaflacencoder.*
+net.sourceforge.javaocr.*
+net.sourceforge.javaocr.demos.*
+net.sourceforge.javaocr.plugins.*
+net.sourceforge.javawebparts.*
+net.sourceforge.javydreamercsw.*
+net.sourceforge.jbizmo.*
+net.sourceforge.jburg.*
+net.sourceforge.jcalendarbutton.*
+net.sourceforge.jchardet.*
+net.sourceforge.jdatepicker.*
+net.sourceforge.jdbcimporter.*
+net.sourceforge.jdistlib.*
+net.sourceforge.jena.*
+net.sourceforge.jenesis4java.*
+net.sourceforge.jeuclid.*
+net.sourceforge.jeval.*
+net.sourceforge.jexcelapi.*
+net.sourceforge.jfacets.*
+net.sourceforge.jmatio.*
+net.sourceforge.jmeasurement2.*
+net.sourceforge.jmol.*
+net.sourceforge.jpaxjc.*
+net.sourceforge.jplasma.*
+net.sourceforge.jpp.*
+net.sourceforge.jregex.*
+net.sourceforge.jscl-meditor.*
+net.sourceforge.jsdialect.*
+net.sourceforge.jsdp.*
+net.sourceforge.jseq.*
+net.sourceforge.jsf-comp.*
+net.sourceforge.jstags.*
+net.sourceforge.jtds.*
+net.sourceforge.jtransforms.*
+net.sourceforge.jweather.*
+net.sourceforge.jwebunit.*
+net.sourceforge.kivu4j.*
+net.sourceforge.kivu4j.books.*
+net.sourceforge.kivu4j.job.*
+net.sourceforge.kivu4j.utils.*
+net.sourceforge.lept4j.*
+net.sourceforge.mailprobe.*
+net.sourceforge.maven-jlex.*
+net.sourceforge.maven-taglib.*
+net.sourceforge.messadmin.*
+net.sourceforge.mikha-utils.*
+net.sourceforge.mikha-web-utils.*
+net.sourceforge.mstparser.*
+net.sourceforge.muleapps.*
+net.sourceforge.muleapps.examples.*
+net.sourceforge.mvn-dp-plugin.*
+net.sourceforge.mydoggy.*
+net.sourceforge.mysources.*
+net.sourceforge.mysources.thinkinjava4.*
+net.sourceforge.nekohtml.*
+net.sourceforge.novaforjava.*
+net.sourceforge.nrl.*
+net.sourceforge.openai.*
+net.sourceforge.openutils.*
+net.sourceforge.orbroker.*
+net.sourceforge.ota-tools.*
+net.sourceforge.ota-tools.schema.*
+net.sourceforge.ota-tools.schema.generated.*
+net.sourceforge.ota-tools.schema.jaxb.*
+net.sourceforge.ota-tools.schema.xmlbeans.*
+net.sourceforge.owlapi.*
+net.sourceforge.pagesdialect.*
+net.sourceforge.pah.*
+net.sourceforge.parallelcolt.*
+net.sourceforge.pjl-comp-filter.*
+net.sourceforge.plantuml-depend.*
+net.sourceforge.plantuml.*
+net.sourceforge.pldoc.*
+net.sourceforge.pmd.*
+net.sourceforge.pro-grade.*
+net.sourceforge.purrpackage.*
+net.sourceforge.queried.*
+net.sourceforge.rafc.*
+net.sourceforge.rapidprops.*
+net.sourceforge.rcache.*
+net.sourceforge.rconed.*
+net.sourceforge.reb4j.*
+net.sourceforge.reqtracer.*
+net.sourceforge.reqtracer.mojo.*
+net.sourceforge.retroweaver.*
+net.sourceforge.rtftemplate.*
+net.sourceforge.saxon.*
+net.sourceforge.scenarlang.*
+net.sourceforge.schemacrawler.*
+net.sourceforge.schemaspy.*
+net.sourceforge.segment.*
+net.sourceforge.serp.*
+net.sourceforge.simpleowlapi.*
+net.sourceforge.sorb.*
+net.sourceforge.spanishbanklib.*
+net.sourceforge.spinnerule.*
+net.sourceforge.streamsupport.*
+net.sourceforge.stripes.*
+net.sourceforge.svg2ico.*
+net.sourceforge.tapestrytestify.*
+net.sourceforge.tapestryxpath.*
+net.sourceforge.tedhi.*
+net.sourceforge.teetime-stages.*
+net.sourceforge.teetime.*
+net.sourceforge.tess4j.*
+net.sourceforge.testcoveragespy.*
+net.sourceforge.testxng.*
+net.sourceforge.thinlet.*
+net.sourceforge.tink.*
+net.sourceforge.tuio.*
+net.sourceforge.urin.*
+net.sourceforge.velai.*
+net.sourceforge.web-harvest.*
+net.sourceforge.werken-opt.*
+net.sourceforge.wicketwebbeans.*
+net.sourceforge.wicketwebbeans.databinder.*
+net.sourceforge.wicketwebbeans.databinder.examples.*
+net.sourceforge.wicketwebbeans.examples.*
+net.sourceforge.wicketwebbeans.parent.*
+net.sourceforge.wife.*
+net.sourceforge.winstone.*
+net.sourceforge.writexml.*
+net.sourceforge.wurfl.*
+net.sourceforge.xazzle.*
+net.sourceforge.xbis.*
+net.sourceforge.zip64file.*
+net.southbird.*
+net.sozal.*
+net.spals.*
+net.spals.appbuilder.*
+net.spals.appbuilder.plugins.*
+net.spals.midas.*
+net.spals.oembed4j.*
+net.spals.shaded.*
+net.spantree.namegenius.*
+net.sparja.*
+net.sparkworks.cargo.*
+net.spy.*
+net.sqlind.*
+net.sridharan.objectconstruction.*
+net.ssanj.*
+net.ssehub.easy.*
+net.ssehub.easy.instantiation.*
+net.ssehub.easy.producer.*
+net.ssehub.easy.producer.external.*
+net.ssehub.easy.reasoning.*
+net.ssehub.easy.runtime.*
+net.ssehub.easy.vil.*
+net.st915.*
+net.stamfest.*
+net.stangenberg.*
+net.stepniak.*
+net.stepniak.android.*
+net.stepniak.api.*
+net.stepniak.api.push.*
+net.stepniak.picheese.*
+net.steppschuh.markdowngenerator.*
+net.stickycode.*
+net.stickycode.bootstrap.*
+net.stickycode.component.*
+net.stickycode.composite.*
+net.stickycode.configuration.*
+net.stickycode.configured.*
+net.stickycode.deploy.*
+net.stickycode.deploy.sample.*
+net.stickycode.examples.*
+net.stickycode.kuuty.*
+net.stickycode.mockwire.*
+net.stickycode.parent.*
+net.stickycode.plugins.*
+net.stickycode.resource.*
+net.stickycode.rs.*
+net.stickycode.scheduled.*
+net.stickycode.servlet.*
+net.stickycode.stable.parent.*
+net.stickycode.stereotype.*
+net.stickycode.stile.*
+net.stickycode.tile.*
+net.stickycode.ws.*
+net.straylightlabs.*
+net.streamok.*
+net.subnoize.*
+net.subroh0508.kotlinmaterialui.*
+net.successk.*
+net.sue445.*
+net.sulea.cristian.*
+net.sundell.snax.*
+net.sunshow.nxcloud.*
+net.sunshow.toolkit.*
+net.sunyijun.*
+net.surguy.*
+net.swiftzer.semver.*
+net.swisstech.*
+net.syberia.storm.*
+net.sympower.gradle.*
+net.synedra.*
+net.tajsoft.*
+net.take.*
+net.taler.*
+net.tammon.*
+net.tanesha.recaptcha4j.*
+net.tangly.*
+net.taptech.*
+net.tascalate.*
+net.tascalate.async.*
+net.tascalate.concurrent.*
+net.tascalate.instrument.*
+net.tascalate.javaflow.*
+net.tascalate.javaflow.examples.*
+net.tascalate.javaflow.util.*
+net.team2xh.*
+net.technearts.*
+net.techno-visions.plugin.*
+net.technolords.micro.service.*
+net.technolords.tool.jmeter.*
+net.technolords.tool.kafka.*
+net.termer.krestx.*
+net.termer.rtflc.*
+net.termer.tcpacketprotocol.*
+net.termer.twine.*
+net.termer.vertx.kotlin.validation.*
+net.thauvin.erik.*
+net.thauvin.erik.httpstatus.*
+net.the4thdimension.*
+net.theblackchamber.*
+net.thedudemc.*
+net.thegodcode.*
+net.thejavashop.*
+net.thejeearchitectcookbook.*
+net.therore.*
+net.therore.logback.*
+net.therore.pluginloader.*
+net.therore.spring.mockito.*
+net.therore.zookeeperdump.*
+net.thevpc.*
+net.thevpc.common.*
+net.thevpc.echo.*
+net.thevpc.hl.*
+net.thevpc.jeep.*
+net.thevpc.jvmon.*
+net.thevpc.maven.*
+net.thevpc.more.iconsets.*
+net.thevpc.more.shef.*
+net.thevpc.nuts.*
+net.thevpc.nuts.ext.*
+net.thevpc.nuts.installer.*
+net.thevpc.nuts.lib.*
+net.thevpc.nuts.toolbox.*
+net.thevpc.pnote.*
+net.thimmwork.*
+net.thisptr.*
+net.thisptr.flume.plugins.*
+net.thk-systems.*
+net.thk-systems.commons.*
+net.thk-systems.network.*
+net.thucydides.*
+net.thucydides.easyb.*
+net.thucydides.kendoui.*
+net.thucydides.maven.plugins.*
+net.thucydides.plugins.gradle.*
+net.thucydides.plugins.jira.*
+net.tietema.versioning.*
+net.time4j.*
+net.time4tea.*
+net.timewalker.ffmq.*
+net.timothyhahn.*
+net.timothyhahn.crane.*
+net.timzh.*
+net.tirasa.*
+net.tirasa.connid.*
+net.tirasa.connid.bundles.*
+net.tirasa.connid.bundles.db.*
+net.tirasa.connid.bundles.okta.*
+net.tirasa.connid.bundles.soap.*
+net.tirasa.connid.commons.*
+net.tirasa.flowable-leftovers.*
+net.tirasa.hct.*
+net.tirasa.openjpa-azure.*
+net.tirasa.openjpasqlazure.*
+net.tirasa.syncope.*
+net.tirasa.syncope.wicket-enduser.*
+net.tirasa.syncope.wicket-enduser.ext.*
+net.tislib.ui-expose.*
+net.tislib.websiteparser.*
+net.tisseurdetoile.batch.*
+net.tixxit.*
+net.tlabs-data.*
+net.tleproject.*
+net.toddm.*
+net.toften.*
+net.tokensmith.*
+net.tomred.*
+net.tongsuo.*
+net.top-t.*
+net.torommo.logspy.*
+net.toshimichi.*
+net.toyknight.*
+net.trajano.*
+net.trajano.apiviz.*
+net.trajano.archetype.*
+net.trajano.auth.*
+net.trajano.caliper.*
+net.trajano.commons.*
+net.trajano.doxdb.*
+net.trajano.gasprices.*
+net.trajano.maven.doxia.*
+net.trajano.maven.skins.*
+net.trajano.mojo.*
+net.trajano.ms.app.*
+net.trajano.openidconnect.*
+net.trajano.project.*
+net.trajano.sonar.plugins.*
+net.trajano.wagon.*
+net.tribe7.seeds.*
+net.troja.*
+net.troja.eve.*
+net.truelicense.*
+net.trustly.*
+net.trustyuri.*
+net.ttddyy.*
+net.ttddyy.observation.*
+net.tuis.ubench.*
+net.turnbig.*
+net.tvalk.mpformatter.*
+net.tvburger.sjawl.*
+net.twasi.*
+net.twibs.*
+net.twisterrob.gradle.*
+net.twisterrob.gradle.plugin.android-app.*
+net.twisterrob.gradle.plugin.android-library.*
+net.twisterrob.gradle.plugin.android-test.*
+net.twisterrob.gradle.plugin.checkstyle.*
+net.twisterrob.gradle.plugin.gradle.test.*
+net.twisterrob.gradle.plugin.java-library.*
+net.twisterrob.gradle.plugin.java.*
+net.twisterrob.gradle.plugin.kotlin.*
+net.twisterrob.gradle.plugin.nagging.*
+net.twisterrob.gradle.plugin.pmd.*
+net.twisterrob.gradle.plugin.quality.*
+net.twisterrob.gradle.plugin.root.*
+net.twisterrob.gradle.plugin.settings.*
+net.twisterrob.gradle.plugin.vcs.*
+net.twonky.*
+net.uberfoo.gradle.*
+net.uiqui.*
+net.ulrice.*
+net.uncontended.*
+net.unicon.*
+net.unicon.cas.*
+net.unicon.persondir.*
+net.unicon.springframework.*
+net.uniscala.*
+net.unit8.*
+net.unit8.amagicman.*
+net.unit8.apistandard.*
+net.unit8.bouncr.*
+net.unit8.depict.*
+net.unit8.enkan.*
+net.unit8.erebus.*
+net.unit8.excelebration.*
+net.unit8.falchion.*
+net.unit8.jackson.dataformat.*
+net.unit8.kysymys.*
+net.unit8.logback.*
+net.unit8.maven.plugins.*
+net.unit8.metrics.*
+net.unit8.moshas.*
+net.unit8.rodriguez.*
+net.unit8.sastruts.*
+net.unit8.sastruts.oauth.*
+net.unit8.teslogger.*
+net.unit8.teststreamer.*
+net.unit8.waitt.*
+net.unit8.waitt.feature.*
+net.unit8.waitt.server.*
+net.unit8.weld.*
+net.unit8.wscl.*
+net.unmz.java.*
+net.unmz.java.wechat.pay.*
+net.uptheinter.*
+net.urizone.*
+net.urlrewriter.*
+net.urosk.graylog.*
+net.urosk.mifss.*
+net.usikkert.kouinject.*
+net.utsuro.*
+net.uvavru.maven.plugin.*
+net.vakilla.*
+net.vatov.*
+net.vectorpublish.*
+net.vectos.*
+net.veloxity.sdk.*
+net.vergien.bau.*
+net.vergien.fig.*
+net.vergien.saml2encoding.*
+net.verytools.*
+net.verytools.tools.*
+net.vibecoms.*
+net.vidageek.*
+net.videki.semver.*
+net.viktorc.*
+net.virtalab.*
+net.virtual-void.*
+net.visma.autopay.*
+net.vivialconnect.*
+net.vleo.timel.*
+net.vmate.*
+net.voicemod.*
+net.volcanomobile.fluidsynth-android.*
+net.vortexdata.tsqpf.*
+net.vrallev.android.*
+net.vrallev.ecc.*
+net.vrallev.gradle.*
+net.vrallev.sqrl.*
+net.vsame.*
+net.vskor.sdk.*
+net.vvakame.*
+net.vz.mongodb.jackson.*
+net.vz.play.snapshot.*
+net.vz.play.statsd.*
+net.walend.*
+net.walend.disentangle.*
+net.wasdev.maven.parent.*
+net.wasdev.maven.plugins.*
+net.wasdev.maven.tools.archetypes.*
+net.wasdev.maven.tools.parents.*
+net.wasdev.maven.tools.targets.*
+net.wasdev.wlp.ant.*
+net.wasdev.wlp.common.*
+net.wasdev.wlp.gradle.plugins.*
+net.wasdev.wlp.maven.*
+net.wasdev.wlp.maven.parent.*
+net.wasdev.wlp.maven.plugins.*
+net.wasdev.wlp.sample.*
+net.wasdev.wlp.starters.*
+net.wasdev.wlp.starters.microprofile.*
+net.wasdev.wlp.starters.ms-builder.*
+net.wasdev.wlp.starters.persistence.*
+net.wasdev.wlp.starters.rest.*
+net.wasdev.wlp.starters.springboot-web.*
+net.wasdev.wlp.starters.swagger.*
+net.wasdev.wlp.starters.template.*
+net.wasdev.wlp.starters.test.*
+net.wasdev.wlp.starters.watsonsdk.*
+net.wasdev.wlp.starters.web.*
+net.wasdev.wlp.starters.websocket.*
+net.wasdev.wlp.tracer.*
+net.wavell.*
+net.webintrospector.*
+net.webpdf.*
+net.weibeld.rabbitmq.*
+net.weibeld.rpc.*
+net.welen.WildFly-JMX-CLI.*
+net.welen.jmole.*
+net.wenheqi.util.encoding.*
+net.wensel.*
+net.wenzuo.*
+net.wessendorf.kafka.*
+net.wessendorf.websocket.*
+net.wetheinter.*
+net.weweave.commerce.*
+net.weweave.tubewarder.*
+net.whenperformancematters.*
+net.whimxiqal.journey.*
+net.whimxiqal.mantle.*
+net.whitbeck.*
+net.wicp.tams.*
+net.wildfyre.*
+net.wimpi.*
+net.windwards.*
+net.winroad.*
+net.winterly.rxjersey.*
+net.wiringbits.*
+net.wisedream.*
+net.wissel.salesforce.*
+net.wombyte.*
+net.wooga.*
+net.wooga.test.*
+net.worcade.*
+net.worktrail.*
+net.wouterdanes.*
+net.wouterdanes.docker.*
+net.wrap-trap.*
+net.wrap-trap.truffle-arrow-language.*
+net.wstech2.*
+net.wuerl.kotlin.*
+net.wuillemin.*
+net.wukl.*
+net.wushilin.*
+net.wwwhackcom.*
+net.xbaker.*
+net.xdob.cmd4j.*
+net.xdob.h2db.*
+net.xdob.ha-jdbc2.*
+net.xdob.http.*
+net.xdob.icap4j.*
+net.xdob.jmdns.*
+net.xdob.luava.*
+net.xdob.pf4boot.*
+net.xdob.rrd4j.*
+net.xdow.*
+net.xenqtt.*
+net.xeric.maven.*
+net.xeric.utils.test.*
+net.xfantome.*
+net.xiaoboli.*
+net.xiaoboli.jishi.*
+net.xiaolanglang.*
+net.xmacs.liga.*
+net.xp-forge.*
+net.xp-forge.maven.plugins.*
+net.xp-forge.sonar.plugins.*
+net.xp-forge.xar.*
+net.xp-framework.*
+net.xp-lang.*
+net.xpece.android.*
+net.xrrocha.*
+net.xwzhou.commons.*
+net.xyzsd.*
+net.xyzsd.fluent.*
+net.xyzsd.plurals.*
+net.y-yuki.*
+net.yadaframework.*
+net.yakclient.*
+net.yangkx.*
+net.yankus.*
+net.yefremov.sleipnir.*
+net.yesdata.*
+net.yested.*
+net.yetamine.*
+net.yetihafen.*
+net.yiim.yismcore.*
+net.ymate.apidocs.*
+net.ymate.framework.*
+net.ymate.maven.*
+net.ymate.maven.plugins.*
+net.ymate.module.*
+net.ymate.platform.*
+net.ymate.starter.*
+net.ymate.web.*
+net.youngdev.maven.plugins.*
+net.ypmania.zioxml.*
+net.yslibrary.historian.*
+net.yslibrary.keyboardvisibilityevent.*
+net.yslibrary.licenseadapter.*
+net.yslibrary.rxrealm.*
+net.yudichev.jiotty.*
+net.yunqihui.*
+net.yushanginfo.mes.*
+net.zaim.android.*
+net.zcarioca.zcommons.*
+net.zedge.zeppa.*
+net.zeroinstall.*
+net.zeroinstall.pom2feed.*
+net.zetetic.*
+net.zhfish.tio.*
+net.zidium.*
+net.zileo.*
+net.zubial.*
+net.zygfryd.*
+netbeans.*
+network.aika.*
+network.casper.*
+network.finschia.*
+network.idu.acapy.*
+network.mysterium.*
+network.nerve.*
+network.oxalis.*
+network.oxalis.commons.*
+network.oxalis.peppol.*
+network.oxalis.pkix.*
+network.oxalis.vefa.*
+network.particle.*
+network.qloud.*
+network.quant.*
+network.unique.*
+new.wimpi.telnetd.*
+nf.fr.eraasoft.*
+nf.fr.k49.*
+ng.com.systemspecs.*
+ng.okra.com.*
+ng.openbanking.*
+ng.shoppi.*
+ng.simplepay.gateway-dev.*
+ng.simplepay.gateway.*
+ninja.abap.*
+ninja.bulletproof.*
+ninja.cero.bootiful-sqltemplate.*
+ninja.codingsolutions.*
+ninja.eivind.*
+ninja.eivind.hots.*
+ninja.fido.config.*
+ninja.leaping.configurate.*
+ninja.pranav.algorithms.*
+ninja.seibert.*
+ninja.smirking.*
+ninja.stealing.*
+ninja.ugly.*
+nl.2312.*
+nl.42.*
+nl.armatiek.saxon.*
+nl.asrr.*
+nl.astraeus.*
+nl.basjes.antlr.*
+nl.basjes.codeowners.*
+nl.basjes.collections.*
+nl.basjes.dsmr.*
+nl.basjes.energy.*
+nl.basjes.energy.nifi.*
+nl.basjes.gitignore.*
+nl.basjes.hadoop.*
+nl.basjes.iot.*
+nl.basjes.maven.enforcer.codeowners.*
+nl.basjes.maven.release.*
+nl.basjes.parse.*
+nl.basjes.parse.httpdlog.*
+nl.basjes.parse.useragent.*
+nl.bebr.*
+nl.bebr.appoptics.*
+nl.bebr.nblib.geotools.*
+nl.bebr.util.api.*
+nl.benkhard.*
+nl.big-o.*
+nl.bimbase.bimworks.*
+nl.bitwalker.*
+nl.brusque.iou.*
+nl.bryanderidder.*
+nl.bryanderidder.cakecutter.*
+nl.bstoi.jersey.test-framework.*
+nl.bstoi.poiparser.*
+nl.clockwork.ebms.*
+nl.cloudfarming.client.*
+nl.cloudfarming.eventbus.*
+nl.cloudfarming.mojo.*
+nl.codecentric.axon-open-admin.*
+nl.codestar.*
+nl.coffeeit.appversioning.*
+nl.coffeeit.aroma.*
+nl.coffeeit.bagtag.*
+nl.colorize.*
+nl.crashdata.crashdata-parent.*
+nl.crashdata.java-chartjs.*
+nl.crashdata.wicket-chartjs.*
+nl.ctrlaltdev.*
+nl.ctrlaltdev.jsontransform.*
+nl.cwts.*
+nl.dead-pixel.telebot.*
+nl.dedicon.pipeline.*
+nl.delphinity.*
+nl.demon.shadowland.freedumbytes.maven.*
+nl.demon.shadowland.freedumbytes.maven.config.*
+nl.demon.shadowland.freedumbytes.maven.custom.skins.*
+nl.demon.shadowland.freedumbytes.maven.dependencies.*
+nl.demon.shadowland.freedumbytes.maven.nvd.backup.*
+nl.demon.shadowland.freedumbytes.maven.owasp.*
+nl.demon.shadowland.freedumbytes.maven.skins.*
+nl.demon.shadowland.freedumbytes.maven.versioning.*
+nl.demon.shadowland.freedumbytes.patch.lt.velykis.maven.skins.*
+nl.demon.shadowland.freedumbytes.sports.basketball.*
+nl.demon.shadowland.freedumbytes.swingx.*
+nl.demon.shadowland.maven.plugins.*
+nl.devillers.*
+nl.devoxist.*
+nl.dionsegijn.*
+nl.dvberkel.*
+nl.eernie.as.*
+nl.eernie.jmoribus.*
+nl.elec332.lib.*
+nl.elec332.sdr.*
+nl.elec332.sdr.source.*
+nl.elec332.util.*
+nl.elements.mobilization.*
+nl.elmar.*
+nl.elucidator.patterns.builder.annotations.*
+nl.entreco.rikken.*
+nl.entreco.sudoco.*
+nl.esi.metis.*
+nl.f00f.*
+nl.fd.*
+nl.fizzit.maven.plugins.*
+nl.future-edge.*
+nl.future-edge.docker.*
+nl.garvelink.oss.*
+nl.geodienstencentrum.maven.*
+nl.geozet.*
+nl.gn0s1s.*
+nl.gogognome.*
+nl.gohla.*
+nl.goodbytes.xmpp.xep.*
+nl.gridshore.nosapi.*
+nl.grons.*
+nl.hiddewieringa.*
+nl.hsac.*
+nl.inergy.liquibase.*
+nl.inl.blacklab.*
+nl.irias.*
+nl.ivonet.*
+nl.ivonet.beanunit.*
+nl.jarmoniuk.*
+nl.javadude.assumeng.*
+nl.javadude.gradle.plugins.*
+nl.javadude.scannit.*
+nl.javadude.t2bus.*
+nl.jiankai.*
+nl.joery.animatedbottombar.*
+nl.joery.timerangepicker.*
+nl.jpoint.*
+nl.jpoint.vertx-deploy-tools.*
+nl.jqno.equalsverifier.*
+nl.junglecomputing.*
+nl.junglecomputing.cashmere.*
+nl.junglecomputing.ipl.*
+nl.knaw.dans.*
+nl.knaw.meertens.mtas.*
+nl.komponents.kovenant.*
+nl.komponents.progress.*
+nl.lexemmens.*
+nl.litpho.mybatis.*
+nl.littlerobots.bean.*
+nl.littlerobots.bundles.*
+nl.littlerobots.cupboard-tools.*
+nl.littlerobots.rxlint.*
+nl.littlerobots.squadleader.*
+nl.littlerobots.vcu.*
+nl.littlerobots.version-catalog-update.*
+nl.lockhead.*
+nl.loxia.builder.generator.*
+nl.marc-apps.*
+nl.markv.*
+nl.martijndwars.*
+nl.mauritssilvis.darts.java.*
+nl.meandi.apns.*
+nl.meandi.apns.example.*
+nl.michelbijnen.jsonapi.*
+nl.michielmeulendijk.*
+nl.minvenj.nfi.storm.*
+nl.mirabeau.*
+nl.mirila.*
+nl.mirila.app.*
+nl.mirila.audit.*
+nl.mirila.cache.*
+nl.mirila.core.*
+nl.mirila.dbs.*
+nl.mirila.drivers.*
+nl.mirila.example.*
+nl.mirila.files.*
+nl.mirila.messaging.*
+nl.mirila.metrics.*
+nl.mirila.model.*
+nl.mirila.payments.*
+nl.mirila.rest.*
+nl.mirila.scheduling.*
+nl.mirila.security.*
+nl.mirila.services.*
+nl.mirila.settings.*
+nl.mplatvoet.komponents.*
+nl.myndocs.*
+nl.ncaj.*
+nl.neotech.plugin.*
+nl.neotech.plugin.rootcoverage.*
+nl.ngti.*
+nl.nigelvanhattum.*
+nl.nl-portal.*
+nl.nlighten.*
+nl.nubilus.*
+nl.nuts.consent.cordapp.*
+nl.oakhill.spark.*
+nl.open.*
+nl.openweb.hippo.*
+nl.openweb.hippo.hst.*
+nl.openweb.hippo.updater.*
+nl.openweb.jcr.*
+nl.orange11.healthcheck.*
+nl.orange11.hippo.common.*
+nl.palolem.*
+nl.paultegelaar.docker.*
+nl.paultegelaar.liquid.relay.*
+nl.pay.*
+nl.pdok.*
+nl.pieni.maven.dependency-analyzer.*
+nl.praegus.*
+nl.pragmasoft.eventsourced.*
+nl.pragmasoft.sensors.*
+nl.psdcompany.*
+nl.psek.fitnesse.*
+nl.pvanassen.*
+nl.pvanassen.christmas.tree.*
+nl.pvanassen.led.*
+nl.pvanassen.steam.*
+nl.pwiddershoven.jfactory.*
+nl.qbusict.*
+nl.rabobank.oss.omnikassa.*
+nl.rabobank.oss.rules.*
+nl.rabobank.rules.*
+nl.razko.*
+nl.reinkrul.did.*
+nl.reinkrul.nuts.*
+nl.rhinofly.*
+nl.rkuijt.*
+nl.robfaber.home.*
+nl.rostykerei.demo.*
+nl.rrd.*
+nl.ru.*
+nl.rug.search.*
+nl.sanderdijkhuis.*
+nl.sedit.*
+nl.sidnlabs.*
+nl.sijpesteijn.*
+nl.sijpesteijn.testing.fitnesse.plugins.*
+nl.sophisticode.squash.*
+nl.stanroelofs.*
+nl.stevenhack.volley.*
+nl.stijngroenen.tradfri.*
+nl.stokpop.*
+nl.stormlantern.*
+nl.suriani.*
+nl.svendubbeld.*
+nl.svenkonings.jacomo.*
+nl.systemsgenetics.*
+nl.talsmasoftware.*
+nl.talsmasoftware.context.*
+nl.talsmasoftware.enumerables.*
+nl.teslanet.mule.connectors.coap.*
+nl.teslanet.mule.connectors.plc.*
+nl.teslanet.mule.transport.coap.*
+nl.thanus.*
+nl.thebigb.*
+nl.thecheerfuldev.*
+nl.thijsbroersen.*
+nl.timmybankers.maven.*
+nl.topicus.*
+nl.topicus.overheid.*
+nl.topicus.plugins.*
+nl.tradecloud.*
+nl.tranquilizedquality.*
+nl.trifork.healthcheck.*
+nl.tritales.springrestdoc.*
+nl.trivento.albero.*
+nl.tudelft.simulation.*
+nl.tvos.sdi4j.*
+nl.tweeenveertig.*
+nl.tweeenveertig.csveed.*
+nl.tweeenveertig.openstack.*
+nl.ulso.magisto.*
+nl.ulso.sprox.*
+nl.uva.sne.*
+nl.voidcorp.ovchipapi.*
+nl.vpro.*
+nl.vpro.amara.*
+nl.vpro.api-client.*
+nl.vpro.api.*
+nl.vpro.camel.*
+nl.vpro.esper.*
+nl.vpro.image.*
+nl.vpro.magnolia.*
+nl.vpro.media.*
+nl.vpro.pages.*
+nl.vpro.poms.*
+nl.vpro.poms.api-clients.*
+nl.vpro.shared.*
+nl.vpro.subtitles.*
+nl.vpro.user.*
+nl.vroste.*
+nl.vv32.rcon.*
+nl.weeaboo.common.*
+nl.weeaboo.gdx-styledtext.*
+nl.weeaboo.gdx-test.*
+nl.weeaboo.gdx-video.*
+nl.weeaboo.luajpp2.*
+nl.weeaboo.vn.*
+nl.wehkamp.cakemix.*
+nl.wernerdegroot.applicatives.*
+nl.wilcotomassen.loremdatum.*
+nl.wimmelstein.*
+nl.wimmelstein.impediment.*
+nl.wittig.*
+nl.wouterbohlken.transip-api-kotlin.*
+nl.woutertimmermans.connect4.*
+nl.wykorijnsburger.kminrandom.*
+nl.xymion.maven.archetypes.*
+nl.yannickl88.*
+nl.ypmamedia.googlefaces.*
+nl.zolotko.sbt.*
+no.acando.*
+no.acntech.common.*
+no.agens.darjeeling.*
+no.antares.*
+no.api.freemarker.*
+no.api.meteo.*
+no.api.syzygy.*
+no.arktekk.*
+no.arktekk.atom.*
+no.arktekk.sbt.*
+no.arktekk.unix.*
+no.avexis.*
+no.bekk.*
+no.bekk.bekkopen.*
+no.bekk.bekkopen.cde.*
+no.bouvet.*
+no.capraconsulting.*
+no.datek.*
+no.dervis.*
+no.difi.commons.*
+no.difi.meldingsutveksling.*
+no.difi.move-common.*
+no.difi.move.*
+no.difi.oxalis.*
+no.difi.sdp.*
+no.difi.vefa.*
+no.digipost.*
+no.digipost.jaxb.*
+no.digipost.signature.*
+no.dossier.libraries.*
+no.eirikb.*
+no.entitas.gradle.*
+no.entitas.gradle.jaxb.*
+no.entur.*
+no.entur.abt.*
+no.entur.android.nfc.*
+no.entur.mapstruct.spi.*
+no.entur.protobuf.*
+no.esito.*
+no.fiken.oss.junixsocket.*
+no.finansportalen.*
+no.finn.archaius-constretto.*
+no.finn.guava-metrics.*
+no.finn.lambda.*
+no.finn.retriable-kafka-consumer.*
+no.finn.search.*
+no.finn.unleash.*
+no.finntech.retriable-kafka-consumer.*
+no.flowlab.plugins.*
+no.found.elasticsearch.*
+no.gorandalum.*
+no.hackeriet.*
+no.hassle.*
+no.hassle.commons.*
+no.hassle.maven.plugins.*
+no.hyper.*
+no.kantega.*
+no.kodeworks.*
+no.ks.*
+no.ks.fiks.*
+no.ks.fiks.pom.*
+no.ks.fiks.svarut.*
+no.laukvik.*
+no.maddin.mockjdbc.*
+no.maddin.niofs.*
+no.mechatronics.sfi.fmi4j.*
+no.mnemonic.commons.*
+no.mnemonic.messaging.*
+no.mnemonic.services.common.*
+no.mnemonic.services.triggers.*
+no.nav.*
+no.nav.abac.policies.*
+no.nav.arbeidsgiver.*
+no.nav.common.*
+no.nav.familie.felles.*
+no.nav.familie.ks.*
+no.nav.foreldrepenger.*
+no.nav.foreldrepenger.kontrakter.*
+no.nav.foreldrepenger.kontrakter.topics.*
+no.nav.fpsak.nare.*
+no.nav.fpsak.tidsserie.*
+no.nav.helse.*
+no.nav.helse.sykepenger.lovverk.*
+no.nav.helse.xml.*
+no.nav.meldinger.*
+no.nav.meldinger.virksomhet.*
+no.nav.melosys.*
+no.nav.modig.*
+no.nav.personbruker.dittnav.*
+no.nav.registre.*
+no.nav.sbl.dialogarena.*
+no.nav.security.*
+no.nav.spsak.tidsserie.*
+no.nav.syfo.kafka.*
+no.nav.syfo.schemas.*
+no.nav.syfo.sm.*
+no.nav.sykepenger.kontrakter.*
+no.nav.tjenestespesifikasjoner.*
+no.nextgentel.oss.akka-tools.*
+no.nordicsemi.android.*
+no.nordicsemi.android.common.*
+no.nordicsemi.android.gradle.*
+no.nordicsemi.android.kotlin.ble.*
+no.nordicsemi.android.support.v18.*
+no.norge.data.skos-ap-no.*
+no.nrk.shared.*
+no.obje.*
+no.olavfosse.*
+no.oms.maven.*
+no.oslomet.*
+no.penger.*
+no.priv.bang.authservice.*
+no.priv.bang.beans.*
+no.priv.bang.debug-utils.*
+no.priv.bang.jdbc.*
+no.priv.bang.karaf.*
+no.priv.bang.oldalbum.*
+no.priv.bang.osgi.service.*
+no.priv.bang.osgi.service.adapters.*
+no.priv.bang.osgiservice.*
+no.priv.bang.pom.*
+no.priv.bang.servlet.*
+no.priv.bang.sonar.sonar-collector.*
+no.priv.garshol.duke.*
+no.rmz.*
+no.sanchezrolfsen.framework.*
+no.saua.remock.*
+no.scalabin.http4s.*
+no.sharebox.*
+no.shiplog.*
+no.sintef.*
+no.skatteetaten.aurora.*
+no.skatteetaten.aurora.checkstyle.*
+no.skatteetaten.aurora.gradle.plugins.*
+no.skatteetaten.aurora.kubernetes.*
+no.skatteetaten.aurora.maven.plugins.*
+no.skatteetaten.aurora.mockmvc.extensions.*
+no.skatteetaten.aurora.springboot.*
+no.skytteren.*
+no.sparebank1.*
+no.sparebank1.troxy.*
+no.spid.*
+no.ssb.concurrent.futureselector.*
+no.ssb.config.*
+no.ssb.jpms.*
+no.ssb.json-template.*
+no.ssb.jsonstat.*
+no.ssb.lds.*
+no.ssb.locking.*
+no.ssb.raml.*
+no.ssb.rawdata.*
+no.ssb.saga.*
+no.ssb.spi.*
+no.ssb.vtl.*
+no.ssb.vtl.connectors.*
+no.steria.osgi.jsr330activator.*
+no.steria.osgi.jsr330activator.gogoshell.build.*
+no.sysco.middleware.alpakka.*
+no.sysco.middleware.kafka.*
+no.sysco.middleware.prometheus.*
+no.sysco.middleware.zipkin.*
+no.systek.dataflow.*
+no.tornado.*
+no.tornado.brap.*
+no.tornado.databinding.*
+no.tv2.serf.*
+no.twingine.hudson.*
+no.uis.*
+no.uis.fsws.*
+no.uis.nio.*
+no.uis.studinfo.*
+no.uis.util.*
+no.vegvesen.nvdb.*
+norbert.*
+np.com.madanpokharel.embed.*
+np.com.ngopal.*
+np.com.susanthapa.*
+nsuml.*
+nu.aaro.gustav.*
+nu.ahlbom.*
+nu.alde.*
+nu.aron.*
+nu.infinity.*
+nu.jibe.*
+nu.mine.mosher.gedcom.*
+nu.mine.mosher.gnopt.*
+nu.mine.mosher.io.*
+nu.mine.mosher.servlet.*
+nu.mine.mosher.xml.*
+nu.pattern.*
+nu.rinu.*
+nu.studer.*
+nu.validator.*
+nu.validator.htmlparser.*
+nu.zoom.*
+nu.zoom.desktop.*
+nu.zoom.svansprogram.*
+nz.ac.auckland.aem.*
+nz.ac.auckland.bathe.initializers.*
+nz.ac.auckland.common.*
+nz.ac.auckland.composite.*
+nz.ac.auckland.email.*
+nz.ac.auckland.groupapps.common.*
+nz.ac.auckland.groupapps.javascript.*
+nz.ac.auckland.groupapps.lmz.*
+nz.ac.auckland.groupapps.maven.*
+nz.ac.auckland.groupapps.parent.*
+nz.ac.auckland.iks.*
+nz.ac.auckland.integration.testing.*
+nz.ac.auckland.jobs.*
+nz.ac.auckland.lmz.*
+nz.ac.auckland.lmz.javascript.*
+nz.ac.auckland.lmzwidget.*
+nz.ac.auckland.logging.*
+nz.ac.auckland.morc.*
+nz.ac.auckland.scriptella.driver.*
+nz.ac.auckland.simple.*
+nz.ac.auckland.stencil.*
+nz.ac.auckland.stubble.*
+nz.ac.auckland.syllabus.*
+nz.ac.waikato.cms.adams.*
+nz.ac.waikato.cms.moa.*
+nz.ac.waikato.cms.weka.*
+nz.ac.waikato.cms.weka.thirdparty.*
+nz.ac.waikato.modeljunit.*
+nz.bradcampbell.*
+nz.cheyne.junit.*
+nz.co.aetheric.maven.*
+nz.co.aetheric.parent.*
+nz.co.aetheric.shiva.*
+nz.co.afor.framework.*
+nz.co.afor.framework.mock.*
+nz.co.blinkpay.*
+nz.co.bottech.*
+nz.co.breakpoint.*
+nz.co.delacour.*
+nz.co.doltech.*
+nz.co.edmi.*
+nz.co.electricbolt.*
+nz.co.glidden.*
+nz.co.gregs.*
+nz.co.jedsimson.lgp.*
+nz.co.objectivity.tiles.*
+nz.co.rossphillips.*
+nz.co.senanque.*
+nz.co.trademe.covert.*
+nz.co.trademe.includeme.*
+nz.co.trademe.konfigure.*
+nz.co.trademe.mapme.*
+nz.co.trademe.plunge.*
+nz.geek.android.*
+nz.ilbb.ag.*
+nz.ilbb.bas.*
+nz.ilbb.labbcat.*
+nz.mkokho.*
+nz.net.catalyst.*
+nz.net.osnz.*
+nz.net.osnz.bathe.*
+nz.net.osnz.common.*
+nz.net.osnz.composite.*
+nz.net.osnz.jmz.*
+nz.net.osnz.lmz.*
+nz.net.osnz.parent.*
+nz.net.osnz.test.*
+nz.net.osnz.tile.*
+nz.net.osnz.tiles.*
+nz.net.osnz.westore.*
+nz.net.ultraq.extensions.*
+nz.net.ultraq.groovy.*
+nz.net.ultraq.jaxb.*
+nz.net.ultraq.lesscss.*
+nz.net.ultraq.postprocessing.*
+nz.net.ultraq.preferences.*
+nz.net.ultraq.redhorizon.*
+nz.net.ultraq.rss.*
+nz.net.ultraq.thymeleaf.*
+nz.net.ultraq.web.filter.*
+nz.net.ultraq.web.lesscss.*
+nz.net.ultraq.web.thymeleaf.*
+nz.net.ultraq.web.yuicompressor.*
+nz.net.ultraq.yuicompressor.*
+nz.paulin.hockey.snapi.*
+nz.salect.objJSON.*
+nz.sodium.*
+nz.wicker.*
+oauth.signpost.*
+odmg.*
+ognl.*
+ojb.*
+ojdbc.*
+old.neo.*
+one.block.*
+one.cafebabe.*
+one.chest.*
+one.chest.ratpack.*
+one.contentbox.boxd.*
+one.credify.sdk.*
+one.duckling.*
+one.edee.*
+one.edee.oss.*
+one.empty3.*
+one.empty3.apps.*
+one.estrondo.*
+one.gfw.*
+one.harmony.*
+one.irradia.datepicker.*
+one.irradia.fieldrush.*
+one.irradia.http.*
+one.irradia.mime.*
+one.irradia.opds1_2.*
+one.irradia.opds2_0.*
+one.irradia.servicedirectory.*
+one.jasyncfio.*
+one.jkr.de.jkrsoftware.entity.locking.libraries.*
+one.leftshift.asteria.*
+one.leftshift.canon.*
+one.leftshift.chartscript.*
+one.leftshift.dynabuffers.*
+one.leftshift.explicit.*
+one.leftshift.gaia-java-sdk.*
+one.leftshift.gaia-sdk.*
+one.leftshift.implicit.*
+one.leftshift.intent-markup.*
+one.leftshift.pdfscript.*
+one.leftshift.protoscript.*
+one.leftshift.skill.*
+one.lfa.*
+one.microproject.iamservice.*
+one.microproject.rpi.*
+one.microproject.test.*
+one.microproject.testmeter.*
+one.microstream.*
+one.pice.*
+one.som.*
+one.tomorrow.transactional-outbox.*
+one.trueorigin.*
+one.util.*
+one.valuelogic.*
+one.xcorp.widget.*
+one.xingyi.*
+one.xuelun.*
+oness.*
+onl.mdw.*
+online.armtts.*
+online.chanlong.*
+online.citizenshipverification.*
+online.datanode.guardian.*
+online.devliving.*
+online.donnimoni.*
+online.ffpy.DataStructAndAlgorithm.*
+online.ffpy.datastruct.*
+online.inote.*
+online.ipop.*
+online.kakapapa.*
+online.qiqiang.*
+online.sanen.*
+online.senpai.*
+online.shuita.gitee.*
+online.terrageo.gjson.*
+online.terraml.algorithm.*
+online.terraml.commons.*
+online.terraml.geometry.*
+online.terraml.geospatial.*
+online.yangcloud.*
+online.yuanpi.*
+open-esb.*
+open.jbi.components.maven.archetype.*
+opencypher.*
+openejb.*
+openim.*
+openjms.*
+opennms.*
+opensymphony.*
+oracle.toplink.essentials.*
+org.*
+org.1000kit.mp.*
+org.1000kit.quarkus.*
+org.24601.*
+org.99soft.*
+org.99soft.commons.*
+org.99soft.guice.*
+org.99soft.guice.sli4j.*
+org.99soft.semweb.*
+org.99soft.shs.*
+org.99soft.trudeau.*
+org.99soft.trudeau.math.*
+org.a05annex.*
+org.aaa4j.radius.*
+org.aarboard.*
+org.aarboard.nextcloud.*
+org.aaronhe.*
+org.aaronhe.rxgooglemapsbinding.*
+org.abcl.*
+org.abego.commons.*
+org.abego.guitesting.*
+org.abego.param.*
+org.abego.stringgraph.*
+org.abego.stringpool.*
+org.abego.treelayout.*
+org.abego.yaml.*
+org.abstractform.*
+org.abstractj.*
+org.abstractj.kalium.*
+org.abstractj.libmatthew.*
+org.abstractmeta.*
+org.accidia.*
+org.acegisecurity.*
+org.achtern.*
+org.acplt.*
+org.acplt.remotetea.*
+org.actframework.*
+org.activecomponents.jadex.*
+org.activejpa.*
+org.activejpa.persistence.*
+org.activestack.*
+org.activiti.*
+org.activiti.api.*
+org.activiti.build.*
+org.activiti.cloud.*
+org.activiti.cloud.acc.*
+org.activiti.cloud.api.*
+org.activiti.cloud.app.*
+org.activiti.cloud.audit.*
+org.activiti.cloud.build.*
+org.activiti.cloud.common.*
+org.activiti.cloud.connector.*
+org.activiti.cloud.dependencies.*
+org.activiti.cloud.examples.*
+org.activiti.cloud.messages.*
+org.activiti.cloud.modeling.*
+org.activiti.cloud.modeling.build.*
+org.activiti.cloud.notifications.graphql.*
+org.activiti.cloud.process.model.*
+org.activiti.cloud.query.*
+org.activiti.cloud.rb.*
+org.activiti.core.common.*
+org.activiti.dependencies.*
+org.activiti.examples.*
+org.adada.*
+org.adeptnet.*
+org.adeptnet.atlassian.*
+org.adeptnet.auth.*
+org.adeptnet.jmx.addons.*
+org.adeptnet.prtg.*
+org.adoptopenjdk.*
+org.adoptopenjdk.maven.plugins.*
+org.adorsys.xlseasy.*
+org.adroitlogic.build.*
+org.aeonbits.owner.*
+org.aerobase.*
+org.aerofx.*
+org.aerogear.*
+org.aerogear.kafka.*
+org.aerogear.unifiedpush.*
+org.aerysoft.miniauth.*
+org.aerysoft.miniclient.*
+org.aerysoft.minijson.*
+org.aerysoft.minimaven.*
+org.aesh.*
+org.affinity-project.*
+org.afplib.*
+org.agileclick.genorm.*
+org.agileclick.slickxml.*
+org.agileclick.ultramc.*
+org.agileinsider.*
+org.agilej.*
+org.agilemicroservices.*
+org.agileware.*
+org.agilewiki.jaconfig.*
+org.agilewiki.jactor.*
+org.agilewiki.jasocket.*
+org.agilewiki.jfile.*
+org.agilewiki.jid.*
+org.agiso.core.*
+org.agiso.tempel.*
+org.agiso.tempel.templates.*
+org.agmip.*
+org.agmip.ace.*
+org.agmip.bom.*
+org.agmip.lib.*
+org.agmip.libs.*
+org.agmip.parent.*
+org.agmip.parents.*
+org.agmip.resources.*
+org.agmip.thirdparty.*
+org.agmip.translators.*
+org.agmip.translators.ace.*
+org.agmip.translators.acmo.*
+org.agmip.utility.*
+org.agorava.*
+org.agrona.*
+org.ahocorasick.*
+org.ai-flow.*
+org.aicer.*
+org.aicer.grok.*
+org.aicer.hibiscus.*
+org.aiddl.*
+org.aika-software.*
+org.ailinykh.*
+org.ainslec.*
+org.aion4j.*
+org.aioobe.cloudconvert.*
+org.airsonic.*
+org.ajax4jsf.*
+org.ajaxanywhere.*
+org.ajaxer.*
+org.ajaxtags.*
+org.ajbrown.*
+org.ajbrown.dropwizard.*
+org.ajoberstar.*
+org.ajoberstar.defaults.*
+org.ajoberstar.defaults.gradle-plugin.*
+org.ajoberstar.defaults.java-library.*
+org.ajoberstar.defaults.locking.*
+org.ajoberstar.defaults.maven-central.*
+org.ajoberstar.defaults.spotless.*
+org.ajoberstar.git-publish.*
+org.ajoberstar.grgit.*
+org.ajoberstar.grgit.service.*
+org.ajoberstar.reckon.*
+org.ajoberstar.reckon.settings.*
+org.ajoberstar.stutter.*
+org.ak80.*
+org.ak80.att.*
+org.ak80.bdp.*
+org.ak80.snastac.*
+org.ak80.standin.*
+org.ak80.ubyte.*
+org.akashihi.osm.*
+org.akhikhl.gradle-onejar.*
+org.akhikhl.gretty.*
+org.akhikhl.mavenize.*
+org.akhikhl.rooty.*
+org.akhikhl.unpuzzle.*
+org.akhikhl.wuff.*
+org.akka-js.*
+org.aksw.beast.*
+org.aksw.bsbm.*
+org.aksw.commons.*
+org.aksw.conjure.*
+org.aksw.gson.*
+org.aksw.iana-language-subtag-registry.*
+org.aksw.jena-sparql-api.*
+org.aksw.jenax.*
+org.aksw.r2rml.*
+org.aksw.rdfunit.*
+org.aksw.rmltk.*
+org.aksw.sparql-integrate.*
+org.aksw.sparqlify.*
+org.aksw.spring.*
+org.aksw.thirdparty.com.sshtools.*
+org.aksw.thirdparty.org.apache.commons.*
+org.aksw.thirdparty.org.spinrdf.*
+org.aktin.*
+org.aktin.broker.*
+org.aktivecortex.*
+org.akubraproject.*
+org.alcibiade.*
+org.aldica.*
+org.alecsvan.aalogger.*
+org.alephium.*
+org.alexn.*
+org.alfasoftware.*
+org.alfresco.*
+org.alfresco.cmis.client.*
+org.alfresco.maven.*
+org.alfresco.maven.archetype.*
+org.alfresco.maven.plugin.*
+org.algorithm-visualizer.*
+org.algorithmx.*
+org.alicep.*
+org.alindner.cish.*
+org.alindner.tools.*
+org.allenai.*
+org.allenai.blacklab.*
+org.allenai.common.*
+org.allenai.datastore.*
+org.allenai.nlpstack.*
+org.allenai.openregex.*
+org.allenai.scienceparse.*
+org.allenai.tinkerpop.blueprints.*
+org.allenai.word2vec.*
+org.alliancegenome.*
+org.alloytools.*
+org.allurefw.*
+org.allurefw.report.*
+org.alluxio.*
+org.altbeacon.*
+org.aludratest.*
+org.aludratest.maven.*
+org.amcgala.*
+org.amebastack.*
+org.amebastack.container.*
+org.amebastack.maven.*
+org.amebastack.module.*
+org.amebastack.security.*
+org.amebastack.template.*
+org.ammonium.*
+org.amplecode.*
+org.amqphub.jca.*
+org.amqphub.quarkus.*
+org.amqphub.spring.*
+org.amshove.kluent.*
+org.anacoders.plugins.*
+org.anadix.*
+org.anadix.conditions.*
+org.anadix.domains.*
+org.anadix.integration.*
+org.anadix.parsers.*
+org.analogweb.*
+org.anarres.*
+org.anarres.dhcp.*
+org.anarres.gradle.*
+org.anarres.graphviz.*
+org.anarres.ipmi.*
+org.anarres.jallocator.*
+org.anarres.jarjar.*
+org.anarres.jdiagnostics.*
+org.anarres.lzo.*
+org.anarres.mirrors.license3j.*
+org.anarres.mirrors.simpleframework.*
+org.anarres.qemu.*
+org.anarres.simplexml.serializers.*
+org.anarres.tftp.*
+org.anarres.typeserializer.*
+org.anarres.vfsjfilechooser.*
+org.anarres.weaklistener.*
+org.anasoid.jmc.*
+org.anc.*
+org.anc.json.*
+org.anc.lapps.gate.*
+org.anc.maven.*
+org.anc.maven.plugins.*
+org.ancoron.common.*
+org.ancoron.glassfish.asadmin.*
+org.ancoron.glassfish.extender.*
+org.ancoron.glassfish.lib.*
+org.ancoron.glassfish.samples.*
+org.ancoron.glassfish.samples.asadmin.*
+org.ancoron.javaee.*
+org.ancoron.movie.*
+org.ancoron.osgi.test.*
+org.ancoron.postgresql.*
+org.androidannotations.*
+org.androidaudioplugin.*
+org.androidtransfuse.*
+org.andromda.*
+org.andromda.andromdapp.*
+org.andromda.andromdapp.projects.*
+org.andromda.ant.*
+org.andromda.bootstrap.*
+org.andromda.bootstrap.cartridges.*
+org.andromda.bootstrap.maven.plugins.*
+org.andromda.bootstrap.metafacades.*
+org.andromda.bootstrap.repositories.*
+org.andromda.bootstrap.templateengines.*
+org.andromda.bootstrap.translationlibraries.*
+org.andromda.cartridges.*
+org.andromda.cartridges.support.*
+org.andromda.documentation.*
+org.andromda.maven.*
+org.andromda.maven.plugins.*
+org.andromda.maven.plugins.site.*
+org.andromda.maven.site.*
+org.andromda.metafacades.*
+org.andromda.profiles.*
+org.andromda.profiles.emf.rsm75.*
+org.andromda.profiles.emf.uml2.*
+org.andromda.profiles.emf.uml22.*
+org.andromda.profiles.uml14.*
+org.andromda.profiles.uml2.*
+org.andromda.repositories.*
+org.andromda.samples.*
+org.andromda.samples.animalquiz.*
+org.andromda.samples.carrental.*
+org.andromda.samples.crud.*
+org.andromda.samples.onlinestore.*
+org.andromda.taglibs.*
+org.andromda.templateengines.*
+org.andromda.thirdparty.jalopy.*
+org.andromda.thirdparty.jaxb2_commons.*
+org.andromda.thirdparty.jmi.*
+org.andromda.thirdparty.netbeans.mdr.*
+org.andromda.timetracker.*
+org.andromda.translationlibraries.*
+org.andromedae.*
+org.andromedae.plugin.*
+org.anglur.*
+org.angproj.io.buf.*
+org.angproj.io.err.*
+org.angproj.io.sig.*
+org.animatejsf.*
+org.annolab.tt4j.*
+org.annotationpro.*
+org.ansj.*
+org.answer-it.*
+org.ant-design-binding.*
+org.antfarmer.*
+org.antframework.*
+org.antframework.boot.*
+org.antframework.cache.*
+org.antframework.common.*
+org.antframework.configcenter.*
+org.antframework.event.*
+org.antframework.filter.*
+org.antframework.idcenter.*
+org.antframework.ids.*
+org.antframework.manager.*
+org.antframework.sync.*
+org.antframework.template.*
+org.anti-ad.mc.*
+org.antipathy.*
+org.antislashn.*
+org.antlr.*
+org.antublue.*
+org.anvilpowered.*
+org.anyboot.*
+org.anyline.*
+org.anystub.*
+org.aoju.*
+org.aolyn.*
+org.aomedia.avif.android.*
+org.aooshi.j.*
+org.aossie.*
+org.apache-extras.beanshell.*
+org.apache-extras.camel-extra.*
+org.apache-extras.camel-extra.karaf.*
+org.apache-extras.cassandra-jdbc.*
+org.apache-extras.qpid.*
+org.apache.*
+org.apache.abdera.*
+org.apache.accumulo.*
+org.apache.ace.*
+org.apache.activemq.*
+org.apache.activemq.examples.*
+org.apache.activemq.examples.amqp.*
+org.apache.activemq.examples.broker-connection.*
+org.apache.activemq.examples.broker.*
+org.apache.activemq.examples.broker.camel.*
+org.apache.activemq.examples.clustered.*
+org.apache.activemq.examples.core.*
+org.apache.activemq.examples.failover.*
+org.apache.activemq.examples.federation.*
+org.apache.activemq.examples.jms.*
+org.apache.activemq.examples.modules.*
+org.apache.activemq.examples.mqtt.*
+org.apache.activemq.examples.openwire.*
+org.apache.activemq.examples.protocols.*
+org.apache.activemq.examples.rest.*
+org.apache.activemq.examples.soak.*
+org.apache.activemq.examples.stomp.*
+org.apache.activemq.protobuf.*
+org.apache.activemq.rest.*
+org.apache.activemq.tooling.*
+org.apache.airavata.*
+org.apache.ambari.*
+org.apache.amber.*
+org.apache.anakia.*
+org.apache.ant.*
+org.apache.any23.*
+org.apache.any23.plugins.*
+org.apache.apache.resources.*
+org.apache.apex.*
+org.apache.apisix.*
+org.apache.archiva.*
+org.apache.archiva.karaf.*
+org.apache.archiva.redback.*
+org.apache.archiva.redback.components.*
+org.apache.archiva.redback.components.cache.*
+org.apache.archiva.redback.components.modello.*
+org.apache.archiva.redback.components.registry.*
+org.apache.aries.*
+org.apache.aries.application.*
+org.apache.aries.application.itest.twitter.*
+org.apache.aries.async.*
+org.apache.aries.blueprint.*
+org.apache.aries.cdi.*
+org.apache.aries.component-dsl.*
+org.apache.aries.ejb.*
+org.apache.aries.jax.rs.*
+org.apache.aries.jax.rs.cxf.repackage.*
+org.apache.aries.jmx.*
+org.apache.aries.jndi.*
+org.apache.aries.jpa.*
+org.apache.aries.jpa.example.*
+org.apache.aries.jpa.itest.*
+org.apache.aries.jpa.javax.persistence.*
+org.apache.aries.proxy.*
+org.apache.aries.quiesce.*
+org.apache.aries.rsa.*
+org.apache.aries.rsa.discovery.*
+org.apache.aries.rsa.examples.*
+org.apache.aries.rsa.examples.echofastbin.*
+org.apache.aries.rsa.examples.echotcp.*
+org.apache.aries.rsa.itests.*
+org.apache.aries.rsa.provider.*
+org.apache.aries.samples.*
+org.apache.aries.samples.ariestrader.*
+org.apache.aries.samples.blog.*
+org.apache.aries.samples.blueprint.*
+org.apache.aries.samples.blueprint.helloworld.*
+org.apache.aries.samples.blueprint.idverifier.*
+org.apache.aries.samples.twitter.*
+org.apache.aries.spec.*
+org.apache.aries.spifly.*
+org.apache.aries.spifly.examples.*
+org.apache.aries.subsystem.*
+org.apache.aries.testsupport.*
+org.apache.aries.transaction.*
+org.apache.aries.tx-control.*
+org.apache.aries.typedevent.*
+org.apache.aries.typedevent.remote.*
+org.apache.aries.typedevent.remote.remoteservices.*
+org.apache.aries.versioning.*
+org.apache.aries.web.*
+org.apache.arrow.*
+org.apache.arrow.adbc.*
+org.apache.arrow.gandiva.*
+org.apache.arrow.orc.*
+org.apache.asterix.*
+org.apache.atlas.*
+org.apache.aurora.*
+org.apache.avalon.*
+org.apache.avalon.cornerstone.*
+org.apache.avalon.cornerstone.connection.*
+org.apache.avalon.cornerstone.datasources.*
+org.apache.avalon.cornerstone.scheduler.*
+org.apache.avalon.cornerstone.sockets.*
+org.apache.avalon.cornerstone.store.*
+org.apache.avalon.cornerstone.threads.*
+org.apache.avalon.framework.*
+org.apache.avalon.logkit.*
+org.apache.avro.*
+org.apache.axis.*
+org.apache.axis2.*
+org.apache.axis2.archetype.*
+org.apache.axis2.maven2.*
+org.apache.bahir.*
+org.apache.batchee.*
+org.apache.bcel.*
+org.apache.beam.*
+org.apache.beam.runners.dataflow.*
+org.apache.beehive.*
+org.apache.bigtop.*
+org.apache.bigtop.itest.*
+org.apache.bookkeeper.*
+org.apache.bookkeeper.http.*
+org.apache.bookkeeper.metadata.drivers.*
+org.apache.bookkeeper.stats.*
+org.apache.bookkeeper.tests.*
+org.apache.brooklyn.*
+org.apache.brooklyn.camp.*
+org.apache.brooklyn.example.*
+org.apache.brooklyn.ui.*
+org.apache.brooklyn.ui.modularity.*
+org.apache.brooklyn.ui.modules.*
+org.apache.bsf.*
+org.apache.bval.*
+org.apache.cactus.*
+org.apache.calcite.*
+org.apache.calcite.avatica.*
+org.apache.camel.*
+org.apache.camel.archetypes.*
+org.apache.camel.component.linkedin.*
+org.apache.camel.component.olingo2.*
+org.apache.camel.example.*
+org.apache.camel.k.*
+org.apache.camel.kafkaconnector.*
+org.apache.camel.kafkaconnector.archetypes.*
+org.apache.camel.kamelets.*
+org.apache.camel.karaf.*
+org.apache.camel.karavan.*
+org.apache.camel.maven.*
+org.apache.camel.quarkus.*
+org.apache.camel.springboot.*
+org.apache.camel.tests.*
+org.apache.camel.tests.bundles.*
+org.apache.carbondata.*
+org.apache.cassandra.*
+org.apache.cassandra.deps.*
+org.apache.causeway.*
+org.apache.causeway.app.*
+org.apache.causeway.commons.*
+org.apache.causeway.core.*
+org.apache.causeway.extensions.*
+org.apache.causeway.mavendeps.*
+org.apache.causeway.persistence.*
+org.apache.causeway.security.*
+org.apache.causeway.testing.*
+org.apache.causeway.valuetypes.*
+org.apache.causeway.viewer.*
+org.apache.cayenne.*
+org.apache.cayenne.build-tools.*
+org.apache.cayenne.modeler.*
+org.apache.cayenne.parents.*
+org.apache.cayenne.plugins.*
+org.apache.cayenne.tutorials.*
+org.apache.cayenne.unpublished.*
+org.apache.celeborn.*
+org.apache.chemistry.opencmis.*
+org.apache.clerezza.*
+org.apache.clerezza.commons-rdf.*
+org.apache.clerezza.ext.*
+org.apache.clerezza.provisioning.*
+org.apache.clerezza.releases.*
+org.apache.clerezza.scala.*
+org.apache.click.*
+org.apache.cocoon.*
+org.apache.cocoon.all.*
+org.apache.cocoon.archetype-block.*
+org.apache.cocoon.archetype-parent.*
+org.apache.cocoon.archetype-sample.*
+org.apache.cocoon.archetype-webapp.*
+org.apache.cocoon.controller.*
+org.apache.cocoon.monitoring.*
+org.apache.cocoon.optional.*
+org.apache.cocoon.parent.*
+org.apache.cocoon.pipeline.*
+org.apache.cocoon.profiling.*
+org.apache.cocoon.rest.*
+org.apache.cocoon.root.*
+org.apache.cocoon.sample.*
+org.apache.cocoon.sax.*
+org.apache.cocoon.servlet.*
+org.apache.cocoon.sitemap.*
+org.apache.cocoon.stax.*
+org.apache.cocoon.stringtemplate.*
+org.apache.cocoon.wicket.*
+org.apache.commons.*
+org.apache.continuum.*
+org.apache.cordova.*
+org.apache.crail.*
+org.apache.creadur.tentacles.*
+org.apache.crunch.*
+org.apache.ctakes.*
+org.apache.curator.*
+org.apache.cxf.*
+org.apache.cxf.archetype.*
+org.apache.cxf.build-utils.*
+org.apache.cxf.dosgi.*
+org.apache.cxf.dosgi.samples.*
+org.apache.cxf.dosgi.systests.*
+org.apache.cxf.fediz.*
+org.apache.cxf.fediz.examples.*
+org.apache.cxf.fediz.examples.simpleWebapp.*
+org.apache.cxf.fediz.examples.webservice.*
+org.apache.cxf.fediz.examples.wsclientWebapp.*
+org.apache.cxf.fediz.examples.wsclientWebapp.webservice.*
+org.apache.cxf.fediz.systests.*
+org.apache.cxf.fediz.systests.federation.*
+org.apache.cxf.fediz.systests.webapps.*
+org.apache.cxf.karaf.*
+org.apache.cxf.osgi.itests.*
+org.apache.cxf.services.*
+org.apache.cxf.services.sts.*
+org.apache.cxf.services.sts.systests.*
+org.apache.cxf.services.ws-discovery.*
+org.apache.cxf.services.wsn.*
+org.apache.cxf.services.xkms.*
+org.apache.cxf.systests.*
+org.apache.cxf.systests.wsdl_maven.*
+org.apache.cxf.xjc-utils.*
+org.apache.cxf.xjcplugins.*
+org.apache.cxf.xjcplugins.tests.*
+org.apache.daffodil.*
+org.apache.datafu.*
+org.apache.datasketches.*
+org.apache.db.torque.*
+org.apache.ddlutils.*
+org.apache.deltaspike.*
+org.apache.deltaspike.cdictrl.*
+org.apache.deltaspike.core.*
+org.apache.deltaspike.distribution.*
+org.apache.deltaspike.examples.*
+org.apache.deltaspike.modules.*
+org.apache.deltaspike.test.*
+org.apache.derby.*
+org.apache.devicemap.*
+org.apache.directmemory.*
+org.apache.directmemory.itests.*
+org.apache.directmemory.karaf.*
+org.apache.directmemory.server.*
+org.apache.directory.*
+org.apache.directory.api.*
+org.apache.directory.buildtools.*
+org.apache.directory.client.ldap.*
+org.apache.directory.daemon.*
+org.apache.directory.fortress.*
+org.apache.directory.installers.*
+org.apache.directory.jdbm.*
+org.apache.directory.junit.*
+org.apache.directory.mavibot.*
+org.apache.directory.mina.*
+org.apache.directory.project.*
+org.apache.directory.server.*
+org.apache.directory.server.http.*
+org.apache.directory.shared.*
+org.apache.directory.skins.*
+org.apache.directory.studio.*
+org.apache.distributedlog.*
+org.apache.dolphinscheduler.*
+org.apache.doris.*
+org.apache.drill.*
+org.apache.drill.contrib.*
+org.apache.drill.contrib.data.*
+org.apache.drill.contrib.storage-hive.*
+org.apache.drill.exec.*
+org.apache.drill.memory.*
+org.apache.drill.metastore.*
+org.apache.drill.tools.*
+org.apache.droids.*
+org.apache.druid.*
+org.apache.druid.extensions.*
+org.apache.druid.extensions.contrib.*
+org.apache.druid.integration-tests.*
+org.apache.dubbo.*
+org.apache.dubbo.extensions.*
+org.apache.dvsl.*
+org.apache.eagle.*
+org.apache.edgent.*
+org.apache.edgent.android.*
+org.apache.edgent.java7.*
+org.apache.empire-db.*
+org.apache.eventmesh.*
+org.apache.excalibur.*
+org.apache.excalibur.component.*
+org.apache.excalibur.components.*
+org.apache.excalibur.containerkit.*
+org.apache.excalibur.deprecated.*
+org.apache.excalibur.event.*
+org.apache.excalibur.fortress.*
+org.apache.excalibur.fortress.bean.*
+org.apache.excalibur.fortress.container.*
+org.apache.excalibur.fortress.examples.*
+org.apache.excalibur.fortress.meta.*
+org.apache.excalibur.fortress.migration.*
+org.apache.excalibur.fortress.platform.*
+org.apache.excalibur.fortress.testcase.*
+org.apache.excalibur.testcase.*
+org.apache.falcon.*
+org.apache.felix.*
+org.apache.felix.atomos.*
+org.apache.felix.atomos.utils.*
+org.apache.felix.commons.*
+org.apache.felix.gogo.*
+org.apache.felix.karaf.*
+org.apache.felix.karaf.admin.*
+org.apache.felix.karaf.demos.*
+org.apache.felix.karaf.deployer.*
+org.apache.felix.karaf.features.*
+org.apache.felix.karaf.jaas.*
+org.apache.felix.karaf.shell.*
+org.apache.felix.karaf.tooling.*
+org.apache.felix.karaf.webconsole.*
+org.apache.flex.*
+org.apache.flex.blazeds.*
+org.apache.flex.flexjs.*
+org.apache.flex.flexjs.compiler.*
+org.apache.flex.flexjs.framework.*
+org.apache.flex.flexjs.typedefs.*
+org.apache.flex.utilities.converter.*
+org.apache.flink.*
+org.apache.flume.*
+org.apache.flume.flume-ng-channels.*
+org.apache.flume.flume-ng-clients.*
+org.apache.flume.flume-ng-configfilters.*
+org.apache.flume.flume-ng-legacy-sources.*
+org.apache.flume.flume-ng-sinks.*
+org.apache.flume.flume-ng-sources.*
+org.apache.flume.flume-shared.*
+org.apache.fluo.*
+org.apache.ftpserver.*
+org.apache.ftpserver.examples.*
+org.apache.fulcrum.*
+org.apache.gearpump.*
+org.apache.geode.*
+org.apache.geronimo.*
+org.apache.geronimo.applications.*
+org.apache.geronimo.applications.console.*
+org.apache.geronimo.applications.examples.*
+org.apache.geronimo.applications.magicGball.*
+org.apache.geronimo.arthur.*
+org.apache.geronimo.arthur.knights.*
+org.apache.geronimo.assemblies.*
+org.apache.geronimo.blueprint.*
+org.apache.geronimo.buildsupport.*
+org.apache.geronimo.bundles.*
+org.apache.geronimo.components.*
+org.apache.geronimo.config.*
+org.apache.geronimo.configs.*
+org.apache.geronimo.daytrader.*
+org.apache.geronimo.daytrader.assemblies.*
+org.apache.geronimo.daytrader.assemblies.javaee.*
+org.apache.geronimo.daytrader.assemblies.web.*
+org.apache.geronimo.daytrader.javaee6.*
+org.apache.geronimo.daytrader.modules.*
+org.apache.geronimo.daytrader.plugins.*
+org.apache.geronimo.devtools.*
+org.apache.geronimo.ext.aries.blueprint.*
+org.apache.geronimo.ext.openejb.*
+org.apache.geronimo.ext.tomcat.*
+org.apache.geronimo.framework.*
+org.apache.geronimo.framework.assemblies.*
+org.apache.geronimo.framework.plugingroups.*
+org.apache.geronimo.genesis.*
+org.apache.geronimo.genesis.bunk.*
+org.apache.geronimo.genesis.config.*
+org.apache.geronimo.genesis.plugins.*
+org.apache.geronimo.gshell.*
+org.apache.geronimo.gshell.commands.*
+org.apache.geronimo.gshell.remote.*
+org.apache.geronimo.gshell.support.*
+org.apache.geronimo.gshell.wisdom.*
+org.apache.geronimo.javamail.*
+org.apache.geronimo.mail.*
+org.apache.geronimo.modules.*
+org.apache.geronimo.plugingroups.*
+org.apache.geronimo.plugins.*
+org.apache.geronimo.plugins.classloaders.*
+org.apache.geronimo.plugins.monitoring.*
+org.apache.geronimo.safeguard.*
+org.apache.geronimo.samples.*
+org.apache.geronimo.samples.daytrader.*
+org.apache.geronimo.samples.daytrader.assemblies.*
+org.apache.geronimo.samples.daytrader.assemblies.web.*
+org.apache.geronimo.samples.daytrader.modules.*
+org.apache.geronimo.samples.daytrader.plugins.*
+org.apache.geronimo.samples.javaee5.*
+org.apache.geronimo.samples.javaee6.*
+org.apache.geronimo.samples.osgi.*
+org.apache.geronimo.samples.osgi.showmethemoney.*
+org.apache.geronimo.schema.*
+org.apache.geronimo.specs.*
+org.apache.geronimo.testsuite.*
+org.apache.geronimo.testsupport.*
+org.apache.giraph.*
+org.apache.gobblin.*
+org.apache.gora.*
+org.apache.gossip.*
+org.apache.griffin.*
+org.apache.groovy.*
+org.apache.guacamole.*
+org.apache.hadoop.*
+org.apache.hadoop.applications.mawo.*
+org.apache.hadoop.contrib.*
+org.apache.hadoop.thirdparty.*
+org.apache.hama.*
+org.apache.hbase.*
+org.apache.hbase.connectors.*
+org.apache.hbase.connectors.kafka.*
+org.apache.hbase.connectors.spark.*
+org.apache.hbase.filesystem.*
+org.apache.hbase.operator.tools.*
+org.apache.hbase.thirdparty.*
+org.apache.hcatalog.*
+org.apache.helix.*
+org.apache.heron.*
+org.apache.hive.*
+org.apache.hive.hcatalog.*
+org.apache.hive.shims.*
+org.apache.hivemall.*
+org.apache.hivemind.*
+org.apache.hop.*
+org.apache.htrace.*
+org.apache.httpcomponents.*
+org.apache.httpcomponents.client5.*
+org.apache.httpcomponents.core5.*
+org.apache.hudi.*
+org.apache.hugegraph.*
+org.apache.hyracks.*
+org.apache.hyracks.examples.*
+org.apache.hyracks.examples.btree.*
+org.apache.hyracks.examples.text.*
+org.apache.hyracks.examples.tpch.*
+org.apache.ibatis.*
+org.apache.iceberg.*
+org.apache.ignite.*
+org.apache.inlong.*
+org.apache.iotdb.*
+org.apache.iotdb.tools.*
+org.apache.isis.*
+org.apache.isis.app.*
+org.apache.isis.archetype.*
+org.apache.isis.commons.*
+org.apache.isis.core.*
+org.apache.isis.extensions.*
+org.apache.isis.mappings.*
+org.apache.isis.mavendeps.*
+org.apache.isis.module.*
+org.apache.isis.objectstore.*
+org.apache.isis.persistence.*
+org.apache.isis.progmodels.*
+org.apache.isis.runtimes.*
+org.apache.isis.runtimes.dflt.*
+org.apache.isis.runtimes.dflt.bytecode.*
+org.apache.isis.runtimes.dflt.objectstores.*
+org.apache.isis.runtimes.dflt.profilestores.*
+org.apache.isis.runtimes.dflt.remoting.*
+org.apache.isis.security.*
+org.apache.isis.skins.*
+org.apache.isis.subdomains.*
+org.apache.isis.tck.*
+org.apache.isis.testing.*
+org.apache.isis.tool.*
+org.apache.isis.valuetypes.*
+org.apache.isis.viewer.*
+org.apache.ivy.*
+org.apache.jackrabbit.*
+org.apache.jackrabbit.vault.*
+org.apache.james.*
+org.apache.james.examples.*
+org.apache.james.hupa.*
+org.apache.james.jdkim.*
+org.apache.james.jspf.*
+org.apache.james.karaf.*
+org.apache.james.protocols.*
+org.apache.jclouds.*
+org.apache.jclouds.api.*
+org.apache.jclouds.chef.*
+org.apache.jclouds.cli.*
+org.apache.jclouds.common.*
+org.apache.jclouds.driver.*
+org.apache.jclouds.karaf.*
+org.apache.jclouds.karaf.bundles.*
+org.apache.jclouds.karaf.chef.*
+org.apache.jclouds.labs.*
+org.apache.jclouds.labs.management.*
+org.apache.jclouds.labs.representations.*
+org.apache.jclouds.provider.*
+org.apache.jcs.*
+org.apache.jdbm.*
+org.apache.jdo.*
+org.apache.jena.*
+org.apache.jmeter.*
+org.apache.johnzon.*
+org.apache.joshua.*
+org.apache.jspwiki.*
+org.apache.jspwiki.it.*
+org.apache.jspwiki.wikipages.*
+org.apache.juddi.*
+org.apache.juddi.bootstrap.*
+org.apache.juddi.client.plugins.*
+org.apache.juddi.example.*
+org.apache.juddi.juddi-docs.*
+org.apache.juddi.scout.*
+org.apache.juneau.*
+org.apache.kafka.*
+org.apache.kalumet.*
+org.apache.kalumet.controller.*
+org.apache.karaf.*
+org.apache.karaf.admin.*
+org.apache.karaf.archetypes.*
+org.apache.karaf.assemblies.*
+org.apache.karaf.assemblies.features.*
+org.apache.karaf.audit.*
+org.apache.karaf.bundle.*
+org.apache.karaf.cave.*
+org.apache.karaf.cave.deployer.*
+org.apache.karaf.cave.gateway.*
+org.apache.karaf.cave.repository.*
+org.apache.karaf.cave.server.*
+org.apache.karaf.cellar.*
+org.apache.karaf.cellar.http.*
+org.apache.karaf.cellar.samples.*
+org.apache.karaf.cellar.samples.camel.hazelcast.*
+org.apache.karaf.cellar.samples.dosgi.greeter.*
+org.apache.karaf.config.*
+org.apache.karaf.decanter.*
+org.apache.karaf.decanter.alerting.*
+org.apache.karaf.decanter.appender.*
+org.apache.karaf.decanter.collector.*
+org.apache.karaf.decanter.marshaller.*
+org.apache.karaf.decanter.parser.*
+org.apache.karaf.decanter.processor.*
+org.apache.karaf.decanter.scheduler.*
+org.apache.karaf.decanter.sla.*
+org.apache.karaf.demos.*
+org.apache.karaf.demos.deployer.bundle.*
+org.apache.karaf.demos.deployer.feature.*
+org.apache.karaf.demos.deployer.kar.*
+org.apache.karaf.demos.deployer.wrap.*
+org.apache.karaf.demos.profiles.*
+org.apache.karaf.deployer.*
+org.apache.karaf.diagnostic.*
+org.apache.karaf.docker.*
+org.apache.karaf.eik.*
+org.apache.karaf.eik.archetypes.*
+org.apache.karaf.eik.features.*
+org.apache.karaf.eik.plugins.*
+org.apache.karaf.examples.*
+org.apache.karaf.features.*
+org.apache.karaf.http.*
+org.apache.karaf.instance.*
+org.apache.karaf.itests.*
+org.apache.karaf.jaas.*
+org.apache.karaf.jaas.blueprint.*
+org.apache.karaf.jdbc.*
+org.apache.karaf.jms.*
+org.apache.karaf.jndi.*
+org.apache.karaf.jpa.*
+org.apache.karaf.kar.*
+org.apache.karaf.log.*
+org.apache.karaf.management.*
+org.apache.karaf.management.mbeans.*
+org.apache.karaf.maven.*
+org.apache.karaf.minho.*
+org.apache.karaf.minho.tooling.*
+org.apache.karaf.obr.*
+org.apache.karaf.package.*
+org.apache.karaf.profile.*
+org.apache.karaf.region.*
+org.apache.karaf.scheduler.*
+org.apache.karaf.scr.*
+org.apache.karaf.scr.examples.*
+org.apache.karaf.service.*
+org.apache.karaf.services.*
+org.apache.karaf.shell.*
+org.apache.karaf.specs.*
+org.apache.karaf.subsystem.*
+org.apache.karaf.system.*
+org.apache.karaf.tooling.*
+org.apache.karaf.tooling.exam.*
+org.apache.karaf.web.*
+org.apache.karaf.webconsole.*
+org.apache.karaf.wrapper.*
+org.apache.kerby.*
+org.apache.knox.*
+org.apache.kudu.*
+org.apache.kylin.*
+org.apache.kyuubi.*
+org.apache.lens.*
+org.apache.linkis.*
+org.apache.livy.*
+org.apache.logging.*
+org.apache.logging.log4j.*
+org.apache.logging.log4j.adapters.*
+org.apache.logging.log4j.osgi.*
+org.apache.logging.log4j.samples.*
+org.apache.lucene.*
+org.apache.mahout.*
+org.apache.mahout.commons.*
+org.apache.mahout.hadoop.*
+org.apache.mahout.hbase.*
+org.apache.mahout.jets3t.*
+org.apache.mahout.kosmofs.*
+org.apache.mahout.kosmosfs.*
+org.apache.mahout.uncommons.math.*
+org.apache.mahout.watchmaker.*
+org.apache.marmotta.*
+org.apache.marmotta.webjars.*
+org.apache.marvin.*
+org.apache.maven.*
+org.apache.maven.archetype.*
+org.apache.maven.archetypes.*
+org.apache.maven.archiva.*
+org.apache.maven.artifact.*
+org.apache.maven.continuum.*
+org.apache.maven.continuum.jpox.*
+org.apache.maven.doxia.*
+org.apache.maven.enforcer.*
+org.apache.maven.extensions.*
+org.apache.maven.indexer.*
+org.apache.maven.its.*
+org.apache.maven.jxr.*
+org.apache.maven.mae.*
+org.apache.maven.mae.components.*
+org.apache.maven.mercury.*
+org.apache.maven.plugin-testing.*
+org.apache.maven.plugin-tools.*
+org.apache.maven.plugins.*
+org.apache.maven.release.*
+org.apache.maven.reporting.*
+org.apache.maven.resolver.*
+org.apache.maven.scm.*
+org.apache.maven.shared.*
+org.apache.maven.skins.*
+org.apache.maven.surefire.*
+org.apache.maven.wagon.*
+org.apache.maven.wrapper.*
+org.apache.meecrowave.*
+org.apache.mesos.*
+org.apache.metamodel.*
+org.apache.metamodel.membrane.*
+org.apache.mina.*
+org.apache.mrunit.*
+org.apache.mxnet.*
+org.apache.mxnet.contrib.clojure.*
+org.apache.myfaces.*
+org.apache.myfaces.buildtools.*
+org.apache.myfaces.commons.*
+org.apache.myfaces.core.*
+org.apache.myfaces.core.extensions.*
+org.apache.myfaces.core.extensions.quarkus.*
+org.apache.myfaces.core.internal.*
+org.apache.myfaces.extensions.cdi.*
+org.apache.myfaces.extensions.cdi.bundles.*
+org.apache.myfaces.extensions.cdi.core.*
+org.apache.myfaces.extensions.cdi.examples.*
+org.apache.myfaces.extensions.cdi.modules.*
+org.apache.myfaces.extensions.cdi.modules.alternative.*
+org.apache.myfaces.extensions.cdi.modules.component-support.*
+org.apache.myfaces.extensions.cdi.modules.jee5-support.*
+org.apache.myfaces.extensions.cdi.test.*
+org.apache.myfaces.extensions.scripting.*
+org.apache.myfaces.extensions.validator.*
+org.apache.myfaces.extensions.validator.component-support-modules.*
+org.apache.myfaces.extensions.validator.examples.*
+org.apache.myfaces.extensions.validator.validation-modules.*
+org.apache.myfaces.maven.*
+org.apache.myfaces.orchestra.*
+org.apache.myfaces.portlet-bridge.*
+org.apache.myfaces.shared.*
+org.apache.myfaces.test.*
+org.apache.myfaces.tobago.*
+org.apache.myfaces.tomahawk.*
+org.apache.myfaces.trinidad.*
+org.apache.myfaces.trinidadbuild.*
+org.apache.neethi.*
+org.apache.nemo.*
+org.apache.netbeans.*
+org.apache.netbeans.archetypes.*
+org.apache.netbeans.modules.jackpot30.*
+org.apache.netbeans.native.*
+org.apache.netbeans.utilities.*
+org.apache.nifi.*
+org.apache.nifi.minifi.*
+org.apache.nifi.registry.*
+org.apache.nlpcraft.*
+org.apache.npanday.*
+org.apache.npanday.its.*
+org.apache.npanday.plugins.*
+org.apache.npanday.visualstudio.*
+org.apache.nutch.*
+org.apache.ode.*
+org.apache.ode.examples.*
+org.apache.odftoolkit.*
+org.apache.olingo.*
+org.apache.oltu.*
+org.apache.oltu.commons.*
+org.apache.oltu.jose.*
+org.apache.oltu.oauth2.*
+org.apache.omid.*
+org.apache.onami.*
+org.apache.onami.converters.*
+org.apache.onami.logging.*
+org.apache.onami.spi.*
+org.apache.oodt.*
+org.apache.oozie.*
+org.apache.oozie.test.*
+org.apache.opendal.*
+org.apache.openejb.*
+org.apache.openejb.itests.*
+org.apache.openejb.maven.*
+org.apache.openejb.patch.*
+org.apache.openejb.shade.*
+org.apache.openejb.staticweb.*
+org.apache.openjpa.*
+org.apache.openjpa.openjpa-examples.*
+org.apache.openmeetings.*
+org.apache.opennlp.*
+org.apache.openwebbeans.*
+org.apache.openwebbeans.arquillian.*
+org.apache.openwebbeans.bom.*
+org.apache.openwebbeans.build-tools.*
+org.apache.openwebbeans.samples.*
+org.apache.openwebbeans.test.*
+org.apache.optiq.*
+org.apache.orc.*
+org.apache.ozone.*
+org.apache.paimon.*
+org.apache.parquet.*
+org.apache.pdfbox.*
+org.apache.pekko.*
+org.apache.pekko.grpc.gradle.*
+org.apache.phoenix.*
+org.apache.phoenix.thirdparty.*
+org.apache.photark.*
+org.apache.pig.*
+org.apache.pinot.*
+org.apache.pinot.plugins.*
+org.apache.pirk.*
+org.apache.pivot.*
+org.apache.plc4x.*
+org.apache.plc4x.examples.*
+org.apache.plc4x.plugins.*
+org.apache.plc4x.sandbox.*
+org.apache.pluto.*
+org.apache.poi.*
+org.apache.poi.DELETE.*
+org.apache.polygene.core.*
+org.apache.polygene.extensions.*
+org.apache.polygene.libraries.*
+org.apache.polygene.tools.*
+org.apache.portals.*
+org.apache.portals.applications.*
+org.apache.portals.bridges.*
+org.apache.portals.jetspeed-2.*
+org.apache.portals.pluto.*
+org.apache.portals.pluto.archetype.*
+org.apache.portals.pluto.demo.*
+org.apache.portals.pluto.templating.*
+org.apache.predictionio.*
+org.apache.provisionr.*
+org.apache.pulsar.*
+org.apache.pulsar.examples.*
+org.apache.pulsar.tests.*
+org.apache.qpid.*
+org.apache.rampart.*
+org.apache.ranger.*
+org.apache.rat.*
+org.apache.ratis.*
+org.apache.rave.*
+org.apache.rave.integration-tests.*
+org.apache.reef.*
+org.apache.river.*
+org.apache.river.examples.*
+org.apache.rocketmq.*
+org.apache.royale.compiler.*
+org.apache.royale.framework.*
+org.apache.royale.framework.distribution.*
+org.apache.royale.typedefs.*
+org.apache.rya.*
+org.apache.s2graph.*
+org.apache.samoa.*
+org.apache.samza.*
+org.apache.sandesha2.*
+org.apache.sanselan.*
+org.apache.santuario.*
+org.apache.seatunnel.*
+org.apache.sedona.*
+org.apache.sentry.*
+org.apache.servicecomb.*
+org.apache.servicecomb.archetypes.*
+org.apache.servicecomb.pack.*
+org.apache.servicecomb.saga.*
+org.apache.servicecomb.saga.discovery.*
+org.apache.servicecomb.saga.transports.*
+org.apache.servicecomb.toolkit.*
+org.apache.servicemix.*
+org.apache.servicemix.activemq.*
+org.apache.servicemix.activiti.*
+org.apache.servicemix.assemblies.*
+org.apache.servicemix.assemblies.features.*
+org.apache.servicemix.bundles.*
+org.apache.servicemix.camel.*
+org.apache.servicemix.camel.bundles.*
+org.apache.servicemix.cxf.*
+org.apache.servicemix.cxf.bundles.*
+org.apache.servicemix.document.*
+org.apache.servicemix.drools.*
+org.apache.servicemix.examples.*
+org.apache.servicemix.examples.bridge-camel.*
+org.apache.servicemix.examples.bridge.*
+org.apache.servicemix.examples.camel.*
+org.apache.servicemix.examples.cxf-wsdl-first-osgi-package.*
+org.apache.servicemix.examples.cxf-wsdl-first.*
+org.apache.servicemix.examples.interceptors.*
+org.apache.servicemix.examples.loan-broker.*
+org.apache.servicemix.examples.wsdl-first.*
+org.apache.servicemix.features.*
+org.apache.servicemix.geronimo.*
+org.apache.servicemix.itests.*
+org.apache.servicemix.jbi.*
+org.apache.servicemix.jbi.cluster.*
+org.apache.servicemix.jboss.*
+org.apache.servicemix.kernel.*
+org.apache.servicemix.kernel.bundles.*
+org.apache.servicemix.kernel.demos.*
+org.apache.servicemix.kernel.gshell.*
+org.apache.servicemix.kernel.jaas.*
+org.apache.servicemix.kernel.testing.*
+org.apache.servicemix.legal.*
+org.apache.servicemix.logging.*
+org.apache.servicemix.management.*
+org.apache.servicemix.naming.*
+org.apache.servicemix.nmr.*
+org.apache.servicemix.nmr.bundles.*
+org.apache.servicemix.nmr.examples.*
+org.apache.servicemix.nmr.examples.interceptors.*
+org.apache.servicemix.parent.*
+org.apache.servicemix.platform.testing.*
+org.apache.servicemix.samples.*
+org.apache.servicemix.samples.bridge-camel.*
+org.apache.servicemix.samples.bridge.*
+org.apache.servicemix.samples.cxf-wsdl-first.*
+org.apache.servicemix.samples.loan-broker.*
+org.apache.servicemix.samples.wsdl-first.*
+org.apache.servicemix.servicemix.*
+org.apache.servicemix.servicemix.activemq.*
+org.apache.servicemix.specs.*
+org.apache.servicemix.testing.*
+org.apache.servicemix.tooling.*
+org.apache.servicemix.tooling.archetypes.*
+org.apache.servicemix.transaction.*
+org.apache.servicemix.transaction.bundles.*
+org.apache.servicemix.war.*
+org.apache.servicemix.war.bundles.*
+org.apache.shale.*
+org.apache.shale.extras.*
+org.apache.shardingsphere.*
+org.apache.shardingsphere.elasticjob.*
+org.apache.shenyu.*
+org.apache.shindig.*
+org.apache.shiro.*
+org.apache.shiro.crypto.*
+org.apache.shiro.integrationtests.*
+org.apache.shiro.samples.*
+org.apache.shiro.tools.*
+org.apache.sirona.*
+org.apache.sis.*
+org.apache.sis.application.*
+org.apache.sis.cloud.*
+org.apache.sis.core.*
+org.apache.sis.non-free.*
+org.apache.sis.profiles.*
+org.apache.sis.storage.*
+org.apache.skywalking.*
+org.apache.slider.*
+org.apache.slider.packages.*
+org.apache.sling.*
+org.apache.sling.ide.*
+org.apache.sling.samples.*
+org.apache.solr.*
+org.apache.solr.solr.*
+org.apache.spark.*
+org.apache.sqoop.*
+org.apache.sqoop.connector.*
+org.apache.sqoop.execution.*
+org.apache.sqoop.repository.*
+org.apache.sqoop.submission.*
+org.apache.sshd.*
+org.apache.stanbol.*
+org.apache.storm.*
+org.apache.stratos.*
+org.apache.stratos.cc.*
+org.apache.stratos.elb.*
+org.apache.stratos.load.balancer.*
+org.apache.streampark.*
+org.apache.streampipes.*
+org.apache.streams.*
+org.apache.streams.examples.*
+org.apache.streams.osgi.components.*
+org.apache.streams.plugins.*
+org.apache.struts.*
+org.apache.struts.shale.*
+org.apache.struts.xwork.*
+org.apache.submarine.*
+org.apache.synapse.*
+org.apache.syncope.*
+org.apache.syncope.client.*
+org.apache.syncope.client.am.*
+org.apache.syncope.client.idm.*
+org.apache.syncope.client.idrepo.*
+org.apache.syncope.common.*
+org.apache.syncope.common.am.*
+org.apache.syncope.common.idm.*
+org.apache.syncope.common.idrepo.*
+org.apache.syncope.common.keymaster.*
+org.apache.syncope.common.keymaster.self.*
+org.apache.syncope.core.*
+org.apache.syncope.core.am.*
+org.apache.syncope.core.idm.*
+org.apache.syncope.core.idrepo.*
+org.apache.syncope.ext.*
+org.apache.syncope.ext.camel.*
+org.apache.syncope.ext.elasticsearch.*
+org.apache.syncope.ext.flowable.*
+org.apache.syncope.ext.oidcc4ui.*
+org.apache.syncope.ext.oidcclient.*
+org.apache.syncope.ext.saml2sp.*
+org.apache.syncope.ext.saml2sp4ui.*
+org.apache.syncope.ext.scimv2.*
+org.apache.syncope.fit.*
+org.apache.syncope.wa.*
+org.apache.systemds.*
+org.apache.systemml.*
+org.apache.taglibs.*
+org.apache.tajo.*
+org.apache.tamaya.*
+org.apache.tamaya.examples.*
+org.apache.tamaya.ext.*
+org.apache.tamaya.ext.examples.*
+org.apache.tapestry.*
+org.apache.taverna.*
+org.apache.taverna.commandline.*
+org.apache.taverna.commonactivities.*
+org.apache.taverna.engine.*
+org.apache.taverna.language.*
+org.apache.taverna.osgi.*
+org.apache.taverna.server.*
+org.apache.teaclave.javasdk.*
+org.apache.teaclave.javasdk.thirdpartylibs.*
+org.apache.tephra.*
+org.apache.texen.*
+org.apache.tez.*
+org.apache.thrift.*
+org.apache.thrift.tools.*
+org.apache.tika.*
+org.apache.tiles.*
+org.apache.tiles.autotag.plugin.*
+org.apache.tinkerpop.*
+org.apache.tomcat.*
+org.apache.tomcat.embed.*
+org.apache.tomcat.experimental.*
+org.apache.tomcat.extras.*
+org.apache.tomcat.maven.*
+org.apache.tomee.*
+org.apache.tomee.bom.*
+org.apache.tomee.gradle.*
+org.apache.tomee.itests.*
+org.apache.tomee.jakarta.*
+org.apache.tomee.maven.*
+org.apache.tomee.patch.*
+org.apache.tomee.patch.archetype.*
+org.apache.tomee.patch.karaf.*
+org.apache.tomee.patch.services.*
+org.apache.tomee.patch.services.sts.*
+org.apache.tomee.patch.services.sts.systests.*
+org.apache.tomee.patch.services.wsn.*
+org.apache.tomee.patch.systests.*
+org.apache.tomee.patch.systests.wsdl_maven.*
+org.apache.toree.*
+org.apache.torque.*
+org.apache.trafodion.jdbc.t4.*
+org.apache.training.*
+org.apache.tubemq.*
+org.apache.turbine.*
+org.apache.tuscany.maven.plugins.*
+org.apache.tuscany.sca.*
+org.apache.tuscany.sca.aggregation.*
+org.apache.tuscany.sca.samples.*
+org.apache.tuscany.sca.shades.*
+org.apache.tuscany.sdo.*
+org.apache.tuweni.*
+org.apache.twill.*
+org.apache.uima.*
+org.apache.unomi.*
+org.apache.velocity.*
+org.apache.velocity.tools.*
+org.apache.vxquery.*
+org.apache.vysper.*
+org.apache.vysper.examples.*
+org.apache.vysper.extensions.*
+org.apache.wayang.*
+org.apache.whirr.*
+org.apache.whirr.karaf.*
+org.apache.wicket.*
+org.apache.wicket.experimental.wicket6.*
+org.apache.wicket.experimental.wicket7.*
+org.apache.wicket.experimental.wicket8.*
+org.apache.wicket.experimental.wicket9.*
+org.apache.winegrower.*
+org.apache.winegrower.cepages.*
+org.apache.winegrower.examples.*
+org.apache.wink.*
+org.apache.wink.example.*
+org.apache.woden.*
+org.apache.wookie.*
+org.apache.ws.*
+org.apache.ws.commons.*
+org.apache.ws.commons.axiom.*
+org.apache.ws.commons.neethi.*
+org.apache.ws.commons.schema.*
+org.apache.ws.commons.util.*
+org.apache.ws.jaxme.*
+org.apache.ws.schema.*
+org.apache.ws.scout.*
+org.apache.ws.security.*
+org.apache.ws.xmlrpc.*
+org.apache.ws.xmlschema.*
+org.apache.wss4j.*
+org.apache.xbean.*
+org.apache.xmlbeans.*
+org.apache.xmlgraphics.*
+org.apache.xmlrpc.*
+org.apache.yetus.*
+org.apache.yoko.*
+org.apache.zeppelin.*
+org.apache.zipkin.*
+org.apache.zipkin.brave.cassandra.*
+org.apache.zipkin.brave.karaf.*
+org.apache.zipkin.dependencies.*
+org.apache.zipkin.layout.*
+org.apache.zipkin.proto3.*
+org.apache.zipkin.reporter2.*
+org.apache.zipkin.zipkin2.*
+org.apache.zookeeper.*
+org.apdplat.*
+org.apereo.*
+org.apereo.cas.*
+org.apereo.cas.client.*
+org.apereo.inspektr.*
+org.apereo.service.persondir.*
+org.apereo.springwebflow.*
+org.apereo.uportal.*
+org.apertereports.*
+org.aperteworkflow.*
+org.aperteworkflow.contrib.*
+org.apfloat.*
+org.api-typeable-pojos.*
+org.api4.*
+org.apiaddicts.apitools.apigen.*
+org.apiaddicts.apitools.dosonarapi.*
+org.apiaddicts.apitools.dosonarapi.sslr.*
+org.apidesign.*
+org.apidesign.bck2brwsr.*
+org.apidesign.bck2brwsr.ide.editor.*
+org.apidesign.canvas.*
+org.apidesign.html.*
+org.apidesign.javadoc.*
+org.apifocal.*
+org.apifocal.activemix.*
+org.apifocal.activemix.jaas.*
+org.apifocal.activemix.tools.*
+org.apifocal.activemix.xbean.*
+org.apifocal.health.*
+org.apiguardian.*
+org.apithefire.*
+org.apiwatch.*
+org.apktool.*
+org.apmem.tools.*
+org.aposin.licensescout.*
+org.appconn.*
+org.appdapter.*
+org.appenders.log4j.*
+org.appenders.logging.*
+org.appenders.st.*
+org.appfuse.*
+org.appfuse.archetypes.*
+org.appfuse.plugins.*
+org.appng.*
+org.appng.maven.*
+org.appops.*
+org.apposed.*
+org.appspy.*
+org.appspy.admin.*
+org.appspy.client.*
+org.appspy.core.*
+org.appspy.distrib.*
+org.appspy.perf.*
+org.appspy.server.*
+org.appspy.viewer.*
+org.appsweaver.*
+org.appsweaver.starter.*
+org.appsweaver.starter.apps.*
+org.appsweaver.starter.apps.apm.*
+org.appsweaver.starter.apps.eureka.*
+org.appsweaver.starter.apps.gateway.*
+org.appsweaver.starter.apps.uaam.*
+org.appsweaver.starter.commons.*
+org.appsweaver.starter.commons.messaging.*
+org.appsweaver.starter.commons.models.*
+org.appsweaver.starter.commons.spring.*
+org.appsweaver.starter.commons.utilities.*
+org.appsweaver.starter.oss-commons.*
+org.appsweaver.starter.oss-commons.messaging.*
+org.appsweaver.starter.oss-commons.models.*
+org.appsweaver.starter.oss-commons.spring.*
+org.appsweaver.starter.oss-commons.utilities.*
+org.appverse.web.framework.archetypes.gwt.*
+org.appverse.web.framework.archetypes.gwtproject.*
+org.appverse.web.framework.archetypes.jsf2.*
+org.appverse.web.framework.archetypes.rest.*
+org.appverse.web.framework.modules.backend.aspect.*
+org.appverse.web.framework.modules.backend.batch.*
+org.appverse.web.framework.modules.backend.core.api.*
+org.appverse.web.framework.modules.backend.core.cache.*
+org.appverse.web.framework.modules.backend.core.enterprise.aop.*
+org.appverse.web.framework.modules.backend.core.enterprise.converters.*
+org.appverse.web.framework.modules.backend.core.enterprise.log.*
+org.appverse.web.framework.modules.backend.core.persistence.*
+org.appverse.web.framework.modules.backend.core.persistence.eclipselink.*
+org.appverse.web.framework.modules.backend.core.persistence.hibernate.*
+org.appverse.web.framework.modules.backend.core.persistence.jpa.*
+org.appverse.web.framework.modules.backend.core.persistence.jpacore.*
+org.appverse.web.framework.modules.backend.core.rest.*
+org.appverse.web.framework.modules.backend.core.standard.*
+org.appverse.web.framework.modules.backend.core.ws.*
+org.appverse.web.framework.modules.backend.ecm.alfresco.*
+org.appverse.web.framework.modules.backend.ecm.cmis.*
+org.appverse.web.framework.modules.backend.ecm.core.*
+org.appverse.web.framework.modules.backend.ecm.filesystem.*
+org.appverse.web.framework.modules.backend.frontfacade.gwt.*
+org.appverse.web.framework.modules.backend.frontfacade.gxt.*
+org.appverse.web.framework.modules.backend.frontfacade.json.*
+org.appverse.web.framework.modules.backend.frontfacade.mvc.*
+org.appverse.web.framework.modules.backend.frontfacade.mvc.schema.*
+org.appverse.web.framework.modules.backend.frontfacade.mvc.swagger.*
+org.appverse.web.framework.modules.backend.frontfacade.rest.*
+org.appverse.web.framework.modules.backend.frontfacade.websocket.*
+org.appverse.web.framework.modules.backend.messaging.*
+org.appverse.web.framework.modules.backend.reporting.*
+org.appverse.web.framework.modules.backend.security.authentication.*
+org.appverse.web.framework.modules.backend.security.oauth2.*
+org.appverse.web.framework.modules.backend.security.xs.*
+org.appverse.web.framework.modules.backend.tests.frontfacade-mvc.*
+org.appverse.web.framework.modules.backend.tests.persistence.jpa.eclipselink.*
+org.appverse.web.framework.modules.backend.tests.persistence.jpa.hibernate.*
+org.appverse.web.framework.modules.backend.tests.security.oauth2.*
+org.appverse.web.framework.modules.backend.tests.security.xs.*
+org.appverse.web.framework.modules.backend.tests.test-utilities.frontfacade-mvc.*
+org.appverse.web.framework.modules.backend.tests.test-utilities.oauth2.*
+org.appverse.web.framework.modules.frontend.gwt.api.*
+org.appverse.web.framework.modules.frontend.gwt.theme.*
+org.appverse.web.framework.poms.*
+org.appverse.web.framework.poms.archetypes.*
+org.appverse.web.framework.poms.frontend.gwt.*
+org.appverse.web.framework.poms.modules.*
+org.appverse.web.framework.poms.modules.backend.*
+org.appverse.web.framework.poms.modules.backend.core.*
+org.appverse.web.framework.poms.modules.backend.core.parent.*
+org.appverse.web.framework.poms.modules.backend.core.persistence.*
+org.appverse.web.framework.poms.modules.backend.ecm.*
+org.appverse.web.framework.poms.modules.backend.frontfacade.*
+org.appverse.web.framework.poms.modules.backend.security.*
+org.appverse.web.framework.poms.modules.frontend.*
+org.appverse.web.framework.poms.modules.frontend.gwt.*
+org.appverse.web.framework.poms.modules.frontend.gwt.parent.*
+org.appverse.web.framework.poms.tools.*
+org.appverse.web.framework.poms.tools.archetypes.*
+org.appverse.web.framework.poms.tools.jpaddlgenerator.*
+org.appverse.web.framework.poms.tools.jpaddlgenerator.plugin.*
+org.appverse.web.framework.tools.archetypes.gwtproject.*
+org.appverse.web.tools.archetypegenerator.*
+org.appverse.web.tools.codegenerator.*
+org.appverse.web.tools.jaxws.client.*
+org.appverse.web.tools.jpaddlgenerator.*
+org.appverse.web.tools.poms.*
+org.appverse.web.tools.projectgenerator.*
+org.arakhne.afc.*
+org.arakhne.afc.advanced.*
+org.arakhne.afc.bootique.*
+org.arakhne.afc.core.*
+org.arakhne.afc.gis.*
+org.arakhne.afc.gis.ui.*
+org.arakhne.afc.maven.*
+org.arakhne.afc.p2.*
+org.arakhne.afc.slf4j.*
+org.arakhne.afc.ui.*
+org.araneforseti.boundary.*
+org.arangodb.*
+org.araqnid.app-status.*
+org.araqnid.eventstore.*
+org.araqnid.hamkrest.*
+org.araqnid.kotlin.arg-parser.*
+org.araqnid.kotlin.assert-that.*
+org.araqnid.kotlin.resteasy.*
+org.archguard.*
+org.archguard.aaac.*
+org.archguard.codedb.*
+org.archguard.comate.*
+org.archguard.scanner.*
+org.archifacts.*
+org.archive.*
+org.archive.heritrix.*
+org.archmix.*
+org.archmix.triady.*
+org.ardulink.*
+org.arecap.*
+org.argot-sdk.*
+org.arkecosystem.*
+org.arm4.*
+org.armadillojava.*
+org.armedbear.lisp.*
+org.arquillian.*
+org.arquillian.algeron.*
+org.arquillian.ape.*
+org.arquillian.container.*
+org.arquillian.cube.*
+org.arquillian.cube.q.*
+org.arquillian.droidium.*
+org.arquillian.extension.*
+org.arquillian.liferay.*
+org.arquillian.liferay.maven.*
+org.arquillian.pact.*
+org.arquillian.protocol.*
+org.arquillian.reporter.*
+org.arquillian.rusheye.*
+org.arquillian.smart.testing.*
+org.arquillian.spacelift.*
+org.arquillian.spacelift.gradle.*
+org.arquillian.tck.*
+org.arquillian.tck.container.*
+org.arquillian.universe.*
+org.arrahtec.*
+org.arrowwood.*
+org.artifactory.*
+org.arvados.*
+org.asarkar.grpc.*
+org.ascheja.xmlrpc.*
+org.asciidoctor.*
+org.askchapter.simplejdbc.*
+org.asm-labs.*
+org.asmatron.*
+org.aspectj.*
+org.assertj.*
+org.astarte-platform.*
+org.asteriskjava.*
+org.asux.*
+org.asyncflows.*
+org.asynchttpclient.*
+org.atemsource.*
+org.atlanmod.commons.*
+org.atlanmod.neoemf.*
+org.atlanmod.zoo.*
+org.atmosphere.*
+org.atmosphere.client.*
+org.atmosphere.extensions.*
+org.atmosphere.jboss.as.*
+org.atmosphere.nettosphere.samples.*
+org.atmosphere.org.timepedia.exporter.*
+org.atmosphere.patches.*
+org.atmosphere.plugins.*
+org.atmosphere.samples.*
+org.atmosphere.vertx.samples.*
+org.atmosphere.wasync.samples.*
+org.atnos.*
+org.atomserver.*
+org.atomspace.camel.*
+org.atp-fivt.*
+org.atteo.*
+org.atteo.classindex.*
+org.atteo.config.*
+org.atteo.dollarbrace.*
+org.atteo.filtering.*
+org.atteo.moonshine.*
+org.atteo.urlhandlers.*
+org.attoparser.*
+org.attribyte.*
+org.audit4j.*
+org.audiveris.*
+org.augustjune.*
+org.auroboros.*
+org.autogui.*
+org.automanlang.*
+org.automerge.*
+org.automon.*
+org.automorph.*
+org.automvc.*
+org.autotdd.*
+org.autumnframework.*
+org.autumnframework.shopify.*
+org.auxis.*
+org.auxis.commons.tree.*
+org.auxis.maven.*
+org.avacodo.*
+org.availlang.*
+org.avaje.*
+org.avaje.archetype.*
+org.avaje.composite.*
+org.avaje.docker.*
+org.avaje.ebean.*
+org.avaje.ebean.tile.*
+org.avaje.ebeanorm.*
+org.avaje.experiment.*
+org.avaje.glue.*
+org.avaje.incubating.*
+org.avaje.incubation.*
+org.avaje.jersey.*
+org.avaje.jetty.*
+org.avaje.k8s.*
+org.avaje.metric.*
+org.avaje.moduuid.*
+org.avaje.resteasy.*
+org.avaje.shaded-nima.*
+org.avaje.test.*
+org.avaje.tile.*
+org.aviran.cookiebar2.*
+org.avmteam.pantheon.*
+org.awaitility.*
+org.awake-file.*
+org.awake-sql.*
+org.awknet.*
+org.aws4s.*
+org.awsutils.*
+org.axle-lang.*
+org.axonframework.*
+org.axonframework.com.lmax.*
+org.axonframework.experimental.*
+org.axonframework.extensions.amqp.*
+org.axonframework.extensions.cdi.*
+org.axonframework.extensions.jgroups.*
+org.axonframework.extensions.jobrunrpro.*
+org.axonframework.extensions.kafka.*
+org.axonframework.extensions.kotlin.*
+org.axonframework.extensions.mongo.*
+org.axonframework.extensions.multitenancy.*
+org.axonframework.extensions.reactor.*
+org.axonframework.extensions.spring-aot.*
+org.axonframework.extensions.springcloud.*
+org.axonframework.extensions.tracing.*
+org.axonframework.incubator.*
+org.axonframework.samples.*
+org.axonframework.scynapse.*
+org.axsl.org.w3c.dom.mathml.*
+org.axsl.org.w3c.dom.smil.*
+org.axsl.org.w3c.dom.svg.*
+org.axway.grapes.*
+org.aya-prover.*
+org.aya-prover.anqur.*
+org.aya-prover.box2d-editor.*
+org.aya-prover.gdx-box2d.*
+org.aya-prover.guest0x0.*
+org.aya-prover.upstream.*
+org.azeckoski.*
+org.azolla.com.alibaba.*
+org.azolla.l.*
+org.azolla.open.*
+org.azolla.p.*
+org.azolla.w.*
+org.azyva.dragom.*
+org.b1.pack.*
+org.b3log.*
+org.b3nk3i.*
+org.babyfish.*
+org.babyfish.graphql.provider.*
+org.babyfish.jimmer.*
+org.babyfish.kimmer.*
+org.backlog4j.*
+org.backuity.*
+org.backuity.clist.*
+org.backuity.clit.*
+org.backuity.p2s.*
+org.badiff.*
+org.baessie.*
+org.bahmni.module.*
+org.bahmni.test.*
+org.bakeneko.*
+org.ballistacompute.*
+org.baracus.*
+org.baracus.application.*
+org.bardframework.*
+org.bardframework.commons.*
+org.bardframework.crud.*
+org.bardframework.filestore.*
+org.bardframework.form.*
+org.bardframework.validator.*
+org.barfuin.texttree.*
+org.basecamp4j.*
+org.basepom.*
+org.basepom.inline.*
+org.basepom.m2e.*
+org.basepom.maven.*
+org.basex.*
+org.basinmc.*
+org.basinmc.blackwater.*
+org.basinmc.blackwater.artifacts.*
+org.basinmc.blackwater.tasks.*
+org.basinmc.plunger.*
+org.baswell.*
+org.batcha.gradle.plugins.*
+org.batoo.common.*
+org.batoo.jpa.*
+org.battelle.*
+org.bayofmany.peapod.*
+org.bblfsh.*
+org.bboxdb.*
+org.bdgenomics.adam.*
+org.bdgenomics.avocado.*
+org.bdgenomics.bdg-formats.*
+org.bdgenomics.bdg-utils.*
+org.bdgenomics.cannoli.*
+org.bdgenomics.convert.*
+org.bdgenomics.deca.*
+org.bdgenomics.mango.*
+org.bdgenomics.qc-metrics.*
+org.bdgenomics.quinine.*
+org.bdgenomics.utils.*
+org.bdware.*
+org.bdware.bdcontract.*
+org.bdware.bdosclient.*
+org.bdware.doaclient.*
+org.bdware.doip.*
+org.bdware.mockjava.*
+org.bdware.sc.*
+org.beamfoundry.bundles.*
+org.beamfoundry.bundles.spring-data-jpa.*
+org.beamfoundry.bundles.spring-data-jpa.test.*
+org.beamfoundry.bundles.spring-data-mongodb.*
+org.beamfoundry.bundles.spring-data-mongodb.test.*
+org.beamfoundry.bundles.spring-data.*
+org.beamfoundry.bundles.spring-dm.*
+org.beamfoundry.bundles.spring-osgi.*
+org.beandiff.*
+org.beanfabrics.*
+org.beangle.*
+org.beangle.as.*
+org.beangle.boot.*
+org.beangle.build.*
+org.beangle.bundles.*
+org.beangle.cache.*
+org.beangle.cdi.*
+org.beangle.commons.*
+org.beangle.data.*
+org.beangle.db.*
+org.beangle.doc.*
+org.beangle.ems.*
+org.beangle.hibernate.*
+org.beangle.http.*
+org.beangle.ids.*
+org.beangle.ids.cas.*
+org.beangle.ioc.*
+org.beangle.jakarta.*
+org.beangle.maven.*
+org.beangle.micdn.*
+org.beangle.notification.*
+org.beangle.notify.*
+org.beangle.orm.*
+org.beangle.otk.*
+org.beangle.parent.*
+org.beangle.repo.*
+org.beangle.sas.*
+org.beangle.security.*
+org.beangle.serializer.*
+org.beangle.spring.*
+org.beangle.struts.*
+org.beangle.struts2.*
+org.beangle.style.*
+org.beangle.template.*
+org.beangle.test.*
+org.beangle.tomcat.*
+org.beangle.tools.*
+org.beangle.web.*
+org.beangle.webmvc.*
+org.beangle.webui.*
+org.beanio.*
+org.beanone.*
+org.beanshell.*
+org.beanstalk4j.*
+org.bedework.*
+org.bedework.bw-cat.*
+org.bedework.bw-synch.*
+org.bedework.bw-tzsvr.*
+org.bedework.bwwebcl.*
+org.bedework.bwxsl.*
+org.bedework.caleng.*
+org.bedework.deploy.*
+org.bedework.evreg.*
+org.bedework.ical4j.*
+org.bedework.notifier.*
+org.bedework.selfreg.*
+org.beer30.*
+org.beetl.*
+org.beetlframework.*
+org.beigesoft.*
+org.beiter.michael.authn.jaas.*
+org.beiter.michael.authn.jaas.loginmodules.*
+org.beiter.michael.authn.jaas.loginmodules.password.*
+org.beiter.michael.authn.jaas.loginmodules.password.authenticators.*
+org.beiter.michael.authn.jaas.loginmodules.password.validators.*
+org.beiter.michael.crypto4j.*
+org.beiter.michael.eaudit4j.*
+org.beiter.michael.eaudit4j.processors.*
+org.beiter.michael.util.*
+org.bekit.*
+org.bekwam.*
+org.benf.*
+org.beryx.*
+org.beryx.jfxgauge.*
+org.beryx.viewreka.*
+org.bessantlab.*
+org.betteridiots.ddf.*
+org.betteridiots.mojo.*
+org.betterjapanese.spock.*
+org.beyene.*
+org.beyene.sius.*
+org.beykery.*
+org.bgee.log4jdbc-log4j2.*
+org.bgee.psp4jdbc.*
+org.biacode.escommons.*
+org.biacode.jcronofy.*
+org.biacode.joverheid.*
+org.bidib.buildnumber.*
+org.bidib.com.akathist.maven.plugins.launch4j.*
+org.bidib.com.embeddedunveiled.*
+org.bidib.com.ftdi.*
+org.bidib.com.github.andriydruk.*
+org.bidib.com.github.fracpete.*
+org.bidib.com.github.markusbernhardt.*
+org.bidib.com.github.purejavacomm.*
+org.bidib.com.jidesoft.*
+org.bidib.com.neuronrobotics.*
+org.bidib.com.pi4j.*
+org.bidib.com.serialpundit.*
+org.bidib.com.surelogic.*
+org.bidib.com.thoughtworks.paranamer.*
+org.bidib.eu.ondryaso.*
+org.bidib.jbidib.*
+org.bidib.jbidib.com.vldocking.*
+org.bidib.jbidib.de.akquinet.jbosscc.maven.*
+org.bidib.jbidib.de.perdian.maven.plugins.*
+org.bidib.jbidib.eu.hansolo.*
+org.bidib.jbidib.org.qbang.rxtx.*
+org.bidib.jbidib.swinglabs.swingx.*
+org.bidib.net.sf.launch4j.*
+org.bidib.no.uib.*
+org.bidib.org.codehaus.izpack.*
+org.bidib.org.oxbow.*
+org.bidib.org.picocontainer.*
+org.bigbluebutton.*
+org.bigml.*
+org.bigtester.*
+org.bigtesting.*
+org.biins.*
+org.bin2.jag-dao.*
+org.biodatageeks.*
+org.biojava.*
+org.biojava.thirdparty.*
+org.biokotlin.*
+org.biopax.paxtools.*
+org.biopax.validator.*
+org.biopragmatics.curies.*
+org.bioquery.*
+org.biouno.*
+org.birchframework.*
+org.biscuitsec.*
+org.bitbucket.*
+org.bitbucket.Muhammad_Zahoor.*
+org.bitbucket.aaronmwilliams.*
+org.bitbucket.abdysamat.*
+org.bitbucket.abuwandi.*
+org.bitbucket.akornilov.kotlin.*
+org.bitbucket.alex_richardson.*
+org.bitbucket.alezhka.*
+org.bitbucket.andriichukandrii.*
+org.bitbucket.anupharp.*
+org.bitbucket.ascendcorp.*
+org.bitbucket.askllc.fermenter.*
+org.bitbucket.askllc.fermenter.ale.*
+org.bitbucket.askllc.fermenter.brett.*
+org.bitbucket.askllc.fermenter.cider.*
+org.bitbucket.askllc.fermenter.stout.*
+org.bitbucket.askllc.krausening.*
+org.bitbucket.b_c.*
+org.bitbucket.bradleysmithllc.etl-agent.*
+org.bitbucket.bradleysmithllc.etlunit.*
+org.bitbucket.bradleysmithllc.java-cl-parser.*
+org.bitbucket.bradleysmithllc.json-validator.*
+org.bitbucket.bradleysmithllc.maven-repository-launcher.*
+org.bitbucket.bradleysmithllc.regular-expression-proxy-compiler.*
+org.bitbucket.bradleysmithllc.star-schema-commander.*
+org.bitbucket.bradleysmithllc.webserviceshubclient.*
+org.bitbucket.brunneng.br.*
+org.bitbucket.brunneng.deepdiff.*
+org.bitbucket.brunneng.introspection.*
+org.bitbucket.brunneng.ot.*
+org.bitbucket.brunneng.qb.*
+org.bitbucket.charlbrink.*
+org.bitbucket.codezarvis.*
+org.bitbucket.comthingsdev.*
+org.bitbucket.cowwoc.*
+org.bitbucket.cowwoc.diff-match-patch.*
+org.bitbucket.cowwoc.pouch.*
+org.bitbucket.cowwoc.preconditions.*
+org.bitbucket.cowwoc.requirements.*
+org.bitbucket.cowwoc.servicelocator.*
+org.bitbucket.cpointe.habushu.*
+org.bitbucket.cpointe.mash.*
+org.bitbucket.cpointe.mojohaus.*
+org.bitbucket.cpointe.prime.*
+org.bitbucket.cpointe.reinheitsgebot.*
+org.bitbucket.cpointe.taproom.*
+org.bitbucket.cy6erGn0m.*
+org.bitbucket.daniel_schreiber.release-manager-for-bitbucket.*
+org.bitbucket.daveyarwood.*
+org.bitbucket.davidmc24.mongodb.aggregate.*
+org.bitbucket.deepdiff.*
+org.bitbucket.dkintu.*
+org.bitbucket.dollar.*
+org.bitbucket.dpenkin.*
+org.bitbucket.draganbjedov.*
+org.bitbucket.dunglv90.*
+org.bitbucket.easygeoing.*
+org.bitbucket.eunjeon.*
+org.bitbucket.f97one.*
+org.bitbucket.farahatieh.*
+org.bitbucket.farahatieh96.*
+org.bitbucket.fishbowlindiadeveloper.*
+org.bitbucket.flamurey.*
+org.bitbucket.franck44.*
+org.bitbucket.franck44.automat.*
+org.bitbucket.franck44.expect.*
+org.bitbucket.franck44.scalasmt.*
+org.bitbucket.frankmonza.*
+org.bitbucket.fredguedespereira.*
+org.bitbucket.fwilhelm.*
+org.bitbucket.gabysbrain.*
+org.bitbucket.gaidhlig.passwordfield.*
+org.bitbucket.gkutiel.*
+org.bitbucket.goalhub.*
+org.bitbucket.goalhub.grammar.*
+org.bitbucket.goalhub.grammar.cognitiveKrLanguages.*
+org.bitbucket.goalhub.krTools.*
+org.bitbucket.goalhub.krTools.krLanguages.*
+org.bitbucket.goalhub.mentalstate.*
+org.bitbucket.goalhub.mentalstate.msStates.*
+org.bitbucket.goalhub.messaging.*
+org.bitbucket.goalhub.simpleide.*
+org.bitbucket.googolplex.devourer.*
+org.bitbucket.gt_tech.*
+org.bitbucket.gthimm.junitextras.*
+org.bitbucket.hartree.*
+org.bitbucket.iamkenos.*
+org.bitbucket.ibencher.*
+org.bitbucket.icebergteam.*
+org.bitbucket.idensitylab.*
+org.bitbucket.inkytonik.dsinfo.*
+org.bitbucket.inkytonik.dsprofile.*
+org.bitbucket.inkytonik.kiama.*
+org.bitbucket.intenscom.*
+org.bitbucket.jancellor.*
+org.bitbucket.javapda.*
+org.bitbucket.javatek.*
+org.bitbucket.johness.*
+org.bitbucket.joxley.*
+org.bitbucket.jplantdev.*
+org.bitbucket.jrsofty.*
+org.bitbucket.jrsofty.pom.*
+org.bitbucket.jscl.*
+org.bitbucket.kienerj.*
+org.bitbucket.komarevsky.*
+org.bitbucket.kudaopenapi.*
+org.bitbucket.kyrosprogrammer.*
+org.bitbucket.leito.*
+org.bitbucket.lendle.*
+org.bitbucket.lp.*
+org.bitbucket.lvncnt.*
+org.bitbucket.manor-on-volga.*
+org.bitbucket.markuskramer.*
+org.bitbucket.maverick-prashant.*
+org.bitbucket.mawdoo3.*
+org.bitbucket.mcmichailidis.*
+org.bitbucket.memoryi.*
+org.bitbucket.michal_msapps.*
+org.bitbucket.miyakawa_taku.*
+org.bitbucket.mstrobel.*
+org.bitbucket.mtngroup.*
+org.bitbucket.muhatashim.*
+org.bitbucket.net-practice.*
+org.bitbucket.omargameelsalem.*
+org.bitbucket.openisoj.*
+org.bitbucket.openisoj2.*
+org.bitbucket.pablo127.*
+org.bitbucket.pauloloboneto.*
+org.bitbucket.pirosoft.*
+org.bitbucket.pragya-spice.*
+org.bitbucket.pshirshov.*
+org.bitbucket.pshirshov.izumi.*
+org.bitbucket.pshirshov.izumitk.*
+org.bitbucket.pshirshov.sbt.*
+org.bitbucket.pukanito.*
+org.bitbucket.pulquero.*
+org.bitbucket.quikx.*
+org.bitbucket.radistao.test.*
+org.bitbucket.restgap.*
+org.bitbucket.rfnetwork.*
+org.bitbucket.risu8.*
+org.bitbucket.robinye.*
+org.bitbucket.rokejits.*
+org.bitbucket.rossetilab.*
+org.bitbucket.sagiforbes.resteasy.*
+org.bitbucket.samsamann.*
+org.bitbucket.samuel8mille.*
+org.bitbucket.seqly.*
+org.bitbucket.shreya-development.*
+org.bitbucket.sic43xx-family.*
+org.bitbucket.simon_massey.*
+org.bitbucket.stefanodp91.*
+org.bitbucket.sunicorns.*
+org.bitbucket.svcrvlh.*
+org.bitbucket.swattu.*
+org.bitbucket.t1ck.*
+org.bitbucket.tbrugz.*
+org.bitbucket.team99array.*
+org.bitbucket.tek-nik.*
+org.bitbucket.theromefather.*
+org.bitbucket.thibaudledent.j8583.*
+org.bitbucket.thinbus.*
+org.bitbucket.timemachine.*
+org.bitbucket.topdoctors.*
+org.bitbucket.tradedom.*
+org.bitbucket.txdrive.*
+org.bitbucket.unaszole.xsdnormaliser.*
+org.bitbucket.vahidi.*
+org.bitbucket.vhly.*
+org.bitbucket.vietduc179.*
+org.bitbucket.wagnerfonseca.luizalabs.*
+org.bitbucket.wallisfalk.*
+org.bitbucket.wanikirtesh.*
+org.bitbucket.white_sdev.*
+org.bitbucket.xaviergillard.*
+org.bitbucket.yahor_makouski.*
+org.bitbucket.ygrigoreva.*
+org.bitbucket.zenturas.*
+org.bitbundle.*
+org.bitbundle.boot.*
+org.bitcoin-s.*
+org.bitcoindevkit.*
+org.bitcoinj.*
+org.bithill.*
+org.bithon.*
+org.bithon.agent.*
+org.bitlap.*
+org.bitlet.*
+org.bitsofinfo.*
+org.bitstrings.eclipse.m2e.*
+org.bitstrings.eclipse.m2e.connectors.*
+org.bitstrings.eclipse.m2e.connectors.dependencypath.*
+org.bitstrings.eclipse.m2e.connectors.generic.*
+org.bitstrings.eclipse.m2e.connectors.jaxb2.*
+org.bitstrings.eclipse.m2e.connectors.xmlbeans.*
+org.bitstrings.maven.*
+org.bitstrings.maven.plugins.*
+org.bitstrings.maven.plugins.ext.*
+org.bitstrings.test.*
+org.bizobj.*
+org.bklab.*
+org.bkvm.*
+org.blackdread.*
+org.blackdread.lib.*
+org.blazingcache.*
+org.blinkenlights.jid3.*
+org.blinkmob.*
+org.blobbase.*
+org.blobit.*
+org.blocks4j.commons.*
+org.blocks4j.feature.toggle.*
+org.blocks4j.reconf.*
+org.blogtree.*
+org.bluecabin.textoo.*
+org.blueobelisk.*
+org.blueoxygen.cimande.*
+org.bluestemsoftware.eoa.*
+org.bluestemsoftware.eoa.apis.*
+org.bluestemsoftware.license.header.*
+org.bluestemsoftware.open.eoa.alakai.*
+org.bluestemsoftware.open.eoa.application.spring.*
+org.bluestemsoftware.open.eoa.engine.spring.*
+org.bluestemsoftware.open.eoa.example.*
+org.bluestemsoftware.open.eoa.example.application.spring10.*
+org.bluestemsoftware.open.eoa.ext.*
+org.bluestemsoftware.open.eoa.ext.dependency.*
+org.bluestemsoftware.open.eoa.shared.*
+org.bluestemsoftware.open.eoa.treleis.*
+org.bluestemsoftware.open.maven.*
+org.bluestemsoftware.open.maven.plugin.*
+org.bluestemsoftware.open.maven.tparty.*
+org.bluestemsoftware.specification.eoa.*
+org.bluestemsoftware.specification.eoa.ext.*
+org.blufin.*
+org.blynder.*
+org.bndly.common.*
+org.bndly.common.antivirus.*
+org.bndly.common.bpm.*
+org.bndly.common.code.*
+org.bndly.common.crypto.*
+org.bndly.common.data.*
+org.bndly.common.event.*
+org.bndly.common.graph.*
+org.bndly.common.ical.*
+org.bndly.common.mail.*
+org.bndly.common.pdf.*
+org.bndly.common.rest.*
+org.bndly.common.schema.*
+org.bndly.common.search.*
+org.bndly.common.service.*
+org.bndly.common.ssl.*
+org.bndly.common.templating.*
+org.bndly.common.testfixture.*
+org.bndly.features.*
+org.bndtools.*
+org.bom4v.ti.*
+org.bomba-lang.*
+org.bondolo.*
+org.bongiorno.*
+org.bongiorno.dto.typadapters.*
+org.bongiorno.io.*
+org.bongiorno.tools.*
+org.bongiorno.validation.*
+org.bongiorno.ws.*
+org.bonitasoft.actorfilter.*
+org.bonitasoft.archetypes.*
+org.bonitasoft.connectors.*
+org.bonitasoft.console.*
+org.bonitasoft.distrib.*
+org.bonitasoft.engine.*
+org.bonitasoft.engine.data.*
+org.bonitasoft.maven.*
+org.bonitasoft.platform.*
+org.bonitasoft.runtime.*
+org.bonitasoft.web.*
+org.boofcv.*
+org.bookmc.*
+org.boomevents.*
+org.bootenv.*
+org.boothub.*
+org.boretti.drools.integration.*
+org.bouncycastle.*
+org.bouncycastle.bcmail-jdk15on.1.57.org.bouncycastle.*
+org.bouncycastle.bcpg-jdk15on.1.57.org.bouncycastle.*
+org.bouncycastle.bcpkix-jdk15on.1.57.org.bouncycastle.*
+org.bouncycastle.bcprov-ext-jdk15on.1.57.org.bouncycastle.*
+org.bouncycastle.bcprov-jdk15on.1.57.org.bouncycastle.*
+org.bouncycastle.bctls-jdk15on.1.57.org.bouncycastle.*
+org.boundbox.*
+org.bovinegenius.*
+org.bowlerframework.*
+org.bradfordmiller.*
+org.brandao.*
+org.breizhbeans.thrift.tools.*
+org.bremersee.*
+org.brewcode.*
+org.brianmckenna.*
+org.briarproject.*
+org.brickred.*
+org.bridgedb.*
+org.bridgedb.examples.*
+org.bridgedb.webservice.*
+org.bridje.*
+org.brightify.hyperdrive.*
+org.brightify.torch.*
+org.brillien.*
+org.brillien.streamline.*
+org.brioscia.javaz.*
+org.broadinstitute.*
+org.broadleafcommerce.*
+org.broskiclan.*
+org.brotli.*
+org.browsermob.*
+org.brunocvcunha.coinpayments.*
+org.brunocvcunha.dense4j.*
+org.brunocvcunha.digesteroids.*
+org.brunocvcunha.ghostme4j.*
+org.brunocvcunha.instagram4j.*
+org.brunocvcunha.inutils4j.*
+org.brunocvcunha.jiphy.*
+org.brunocvcunha.opennode-java.*
+org.brunocvcunha.phantranslator.*
+org.brunocvcunha.seleneasy.*
+org.brunocvcunha.sockettester.*
+org.brutusin.*
+org.brylex.*
+org.brylex.maven.*
+org.bsc.*
+org.bsc.bean.*
+org.bsc.framework.*
+org.bsc.maven.*
+org.bsc.maven.plugin.*
+org.bsc.processor.*
+org.bsc.util.*
+org.bspfsystems.*
+org.bspfsystems.bungeeipc.*
+org.bstats.*
+org.btc4j.*
+org.btrplace.*
+org.bubenheimer.instancelimit.*
+org.bubuabu.parallelrunner.*
+org.buffalo-coders.*
+org.buffalo-coders.aws.*
+org.buffalo-coders.aws.lambda.*
+org.buffalo-coders.aws.lambda.jaxrs.*
+org.buildobjects.*
+org.buildsomethingawesome.lib.*
+org.bulbit.maven.*
+org.buldakov.huawei.modem.client.*
+org.buraktamturk.*
+org.burningwave.*
+org.burnoutcrew.composereorderable.*
+org.bushe.*
+org.butterfaces.*
+org.bychan.*
+org.bykn.*
+org.bytedeco.*
+org.bytedeco.gradle-javacpp-build.*
+org.bytedeco.gradle-javacpp-platform.*
+org.bytedeco.javacpp-presets.*
+org.bytedesk.*
+org.byteio.*
+org.bytemechanics.*
+org.bytemechanics.filesystem.*
+org.bytemechanics.maven.*
+org.bytesizebook.com.guide.boot.*
+org.bytesoft.*
+org.c02e.jpgpj.*
+org.c64.attitude.*
+org.cache2k.*
+org.cacheonix.*
+org.cacoo4j.*
+org.cactoos.*
+org.cadixdev.*
+org.cafejojo.schaapi.*
+org.cafejojo.schaapi.models.*
+org.cafesip.sipunit.*
+org.caffetranslator.*
+org.caffinitas.bcverify.*
+org.caffinitas.dump-maven-model.*
+org.caffinitas.gradle.aggregatetestresults.*
+org.caffinitas.gradle.antlr.*
+org.caffinitas.gradle.compilecommand.*
+org.caffinitas.gradle.jflex.*
+org.caffinitas.gradle.microbench.*
+org.caffinitas.gradle.testrerun.*
+org.caffinitas.gradle.testsummary.*
+org.caffinitas.junitvintagetimeout.*
+org.caffinitas.mapper.*
+org.caffinitas.ohc.*
+org.caffinitas.protobuf-maven.*
+org.cafienne.*
+org.caiguoqing.*
+org.cakeframework.*
+org.cakeframework.tools.*
+org.callbackparams.*
+org.calrissian.accumulorecipes.*
+org.calrissian.flowmix.*
+org.calrissian.insight.*
+org.calrissian.mango.*
+org.calrissian.restdoclet.*
+org.calypsonet.keyple.*
+org.calypsonet.terminal.*
+org.campagnelab.dl.*
+org.campagnelab.ext.*
+org.campagnelab.goby.*
+org.campagnelab.icb.*
+org.camunda.*
+org.camunda.bpm.*
+org.camunda.bpm.archetype.*
+org.camunda.bpm.assert.*
+org.camunda.bpm.assert.project.*
+org.camunda.bpm.cockpit.plugin.*
+org.camunda.bpm.cycle.*
+org.camunda.bpm.dmn.*
+org.camunda.bpm.ext.*
+org.camunda.bpm.extension.*
+org.camunda.bpm.extension.batch.*
+org.camunda.bpm.extension.batch.example.*
+org.camunda.bpm.extension.batch.project.*
+org.camunda.bpm.extension.camel.*
+org.camunda.bpm.extension.dmn.*
+org.camunda.bpm.extension.dmn.scala.*
+org.camunda.bpm.extension.example.*
+org.camunda.bpm.extension.examples.*
+org.camunda.bpm.extension.feel.scala.*
+org.camunda.bpm.extension.graphql.*
+org.camunda.bpm.extension.grpc.externaltask.*
+org.camunda.bpm.extension.grpc.externaltask.project.*
+org.camunda.bpm.extension.migration.*
+org.camunda.bpm.extension.mockito.*
+org.camunda.bpm.extension.osgi.*
+org.camunda.bpm.extension.reactor.*
+org.camunda.bpm.extension.reactor.example.*
+org.camunda.bpm.extension.reactor.project.*
+org.camunda.bpm.extension.rest.*
+org.camunda.bpm.extension.scenario.*
+org.camunda.bpm.extension.scenario.project.*
+org.camunda.bpm.extension.springboot.*
+org.camunda.bpm.extension.springboot.example.*
+org.camunda.bpm.extension.springboot.gradle.*
+org.camunda.bpm.extension.springboot.maven.*
+org.camunda.bpm.extension.springboot.project.*
+org.camunda.bpm.extension.swagger.*
+org.camunda.bpm.extension.swagger.example.*
+org.camunda.bpm.extension.swagger.maven.*
+org.camunda.bpm.extension.swagger.project.*
+org.camunda.bpm.extension.xslt.*
+org.camunda.bpm.extension.xslt.distro.*
+org.camunda.bpm.identity.*
+org.camunda.bpm.javaee.*
+org.camunda.bpm.juel.*
+org.camunda.bpm.model.*
+org.camunda.bpm.qa.*
+org.camunda.bpm.quarkus.*
+org.camunda.bpm.rpa.*
+org.camunda.bpm.springboot.*
+org.camunda.bpm.springboot.project.*
+org.camunda.bpm.webapp.*
+org.camunda.commons.*
+org.camunda.community.*
+org.camunda.community.automator.*
+org.camunda.community.batch.*
+org.camunda.community.batch.example.*
+org.camunda.community.client.*
+org.camunda.community.cloud.migration.*
+org.camunda.community.extension.kotlin.coworker.*
+org.camunda.community.extension.zeebe.exporter.jobworker.*
+org.camunda.community.migration.*
+org.camunda.community.mockito.*
+org.camunda.community.process_test_coverage.*
+org.camunda.community.rest.*
+org.camunda.community.template.engine.*
+org.camunda.community.template.generator.*
+org.camunda.community.vanillabp.*
+org.camunda.community.webmodeler.*
+org.camunda.connect.*
+org.camunda.consulting.snippets.*
+org.camunda.feel.*
+org.camunda.spin.*
+org.camunda.template-engines.*
+org.canedata.*
+org.canedata.module.*
+org.canedata.provider.*
+org.caoilte.*
+org.caotc.*
+org.capnproto.*
+org.carbonateresearch.*
+org.cardanofoundation.*
+org.carewebframework.*
+org.carlspring.*
+org.carlspring.cloud.aws.*
+org.carlspring.commons.*
+org.carlspring.logging.*
+org.carlspring.maven.*
+org.carrot2.*
+org.carrot2.attributes.*
+org.carrot2.dcs.*
+org.carrot2.forks.commons.*
+org.carrot2.lang.*
+org.carrot2.shaded.*
+org.casbin.*
+org.caseine.*
+org.cassandraunit.*
+org.cat73.*
+org.catools.*
+org.ccil.cowan.tagsoup.*
+org.cddcore.*
+org.cdecode.firebase.*
+org.cdisource.*
+org.cdisource.beancontainer.*
+org.cdisource.testing.*
+org.cdisource.web.*
+org.cdk8s.*
+org.cdlflex.*
+org.cdmckay.coffeedom.*
+org.cementframework.*
+org.cempaka.cyclone.*
+org.cert.netsa.*
+org.certificate-transparency.*
+org.certificateservices.messages.*
+org.cethos.tools.*
+org.ceylon-lang.*
+org.cfg4j.*
+org.cfmlprojects.*
+org.chabala.brick.*
+org.chafed.*
+org.chainmaker.*
+org.chalup.*
+org.chalup.microorm.*
+org.chalup.thneed.*
+org.chare.maven.plugins.*
+org.charik.*
+org.charik.sparktools.*
+org.chartistjsf.*
+org.chasen.mecab.*
+org.chat21.android.*
+org.chboston.cnlp.*
+org.checkerframework.*
+org.checkerframework.annotatedlib.*
+org.cheffo.*
+org.chenillekit.*
+org.chenliang.oggus.*
+org.chenmin.open.*
+org.chepiov.*
+org.chess4j.*
+org.chessplorer.*
+org.chiachat.*
+org.chiknrice.*
+org.chipsalliance.*
+org.chobit.*
+org.chobit.ar4j.*
+org.chobit.common.*
+org.chobit.commons.*
+org.chobit.spring.*
+org.chobit.wp.*
+org.choco-solver.*
+org.chorusbdd.*
+org.chrisjaehnen.openlib.*
+org.chrisjaehnen.tibco.*
+org.chrisjr.*
+org.christor.*
+org.chromattic.*
+org.chronos-eaas.*
+org.chsrobotics.lib.*
+org.chtijbug.drools.*
+org.chtijbug.jboss.*
+org.chtijbug.osgi.*
+org.cicirello.*
+org.cicomponents.*
+org.cid15.aem.groovy.console.*
+org.cid15.aem.veneer.*
+org.cikit.*
+org.cikit.kotlin_script.*
+org.cikit.syslog.*
+org.cinchapi.*
+org.cip4.lib.jdf.*
+org.cip4.lib.ptk.*
+org.cip4.lib.xjdf.*
+org.cip4.lib.xprinttalk.*
+org.cip4.tools.*
+org.cip4.tools.jdfutility.*
+org.citationstyles.*
+org.citrusframework.*
+org.citrusframework.archetypes.*
+org.citrusframework.mvn.*
+org.citrusframework.yaks.*
+org.citygml4j.*
+org.citygml4j.ade.*
+org.citygml4j.tools.*
+org.civis-blockchain.ssm.*
+org.ciwise.*
+org.ciwise.commons.*
+org.cjan.*
+org.clapper.*
+org.classdump.luna.*
+org.clawiz.bpm.*
+org.clawiz.core.*
+org.clawiz.etl.*
+org.clawiz.metadata.*
+org.clawiz.portal.*
+org.clawiz.ui.*
+org.clawiz.ui.html.*
+org.clazzes.login.*
+org.clazzes.util.*
+org.cleaninsights.sdk.*
+org.cleartk.*
+org.clevermore.*
+org.clojars.smee.*
+org.clojure.*
+org.clojure.typed.*
+org.cloudbees.sdk.plugins.*
+org.cloudbird.spark.extensions.*
+org.cloudburstmc.*
+org.cloudera.htrace.*
+org.cloudfoundry.*
+org.cloudfoundry.community.*
+org.cloudfoundry.identity.*
+org.cloudfoundry.multiapps.*
+org.cloudfoundry.tools.*
+org.cloudfun.*
+org.cloudgraph.*
+org.cloudhoist.*
+org.cloudhoist.plugin.*
+org.cloudi.*
+org.cloudsimplus.*
+org.cloudsmith.stackhammer.*
+org.clueweb.*
+org.clulab.*
+org.clustering4ever.*
+org.clyze.*
+org.cobaltians.*
+org.cobraparser.*
+org.cocolian.*
+org.coconut.*
+org.coconut.cache.*
+org.coconut.cache.test.*
+org.coconut.core.*
+org.coconut.event.*
+org.coconut.forkjoin.*
+org.coconut.internal.*
+org.coconut.management.*
+org.coconut.test.*
+org.codarama.diet.*
+org.code-house.*
+org.code-house.bacnet4j.*
+org.code-house.eaio-uuid.*
+org.code-house.eaio-uuid.jackson.*
+org.code-house.jackson.*
+org.code-house.validation.*
+org.code-house.validation.example.*
+org.code4everything.*
+org.codeandmagic.android.*
+org.codeartisans.*
+org.codeartisans.android-toolbox.*
+org.codeartisans.asadmin-java.*
+org.codeartisans.asadmin-maven-plugin.*
+org.codeartisans.asadmin.*
+org.codeartisans.java.*
+org.codeartisans.javafx.*
+org.codeartisans.jsw-maven-plugin.*
+org.codeartisans.qipki.*
+org.codeartisans.qipki.clients.*
+org.codeartisans.qipki.qipki-clients.*
+org.codeartisans.qipki.qipki-http.*
+org.codeartisans.qipki.qipki-tools.*
+org.codeartisans.shiro.*
+org.codeartisans.spicyplates.*
+org.codeartisans.swing-on-steroids.*
+org.codeartisans.thirdparties.jsw.*
+org.codeartisans.thirdparties.swing.*
+org.codebies.*
+org.codebrewer.intellij.platform.*
+org.codeconsole.*
+org.codeconsole.sitemesh.*
+org.codecraftgame.*
+org.codedoers.maven.*
+org.codedoers.util.*
+org.codefeedr.*
+org.codefetti.proxy.*
+org.codefilarete.*
+org.codefilarete.stalactite.*
+org.codeforamerica.open311.*
+org.codeforamerica.platform.*
+org.codefx.libfx.*
+org.codefx.maven.plugin.*
+org.codefx.mvn.*
+org.codegas.*
+org.codegeny.*
+org.codegeny.jakartron.*
+org.codegist.*
+org.codegist.crest.*
+org.codehaus.*
+org.codehaus.btm.*
+org.codehaus.cake.*
+org.codehaus.cake.attributes.*
+org.codehaus.cake.cache.*
+org.codehaus.cake.cache.test.*
+org.codehaus.cake.forkjoin.*
+org.codehaus.cake.internal.*
+org.codehaus.cake.management.*
+org.codehaus.cake.ops.*
+org.codehaus.cake.service.*
+org.codehaus.cake.test.*
+org.codehaus.cake.util.*
+org.codehaus.cargo.*
+org.codehaus.castor.*
+org.codehaus.cjcook.*
+org.codehaus.cuanto.*
+org.codehaus.enunciate.*
+org.codehaus.enunciate.archetypes.*
+org.codehaus.fabric3.*
+org.codehaus.fabric3.api.*
+org.codehaus.fabric3.development.*
+org.codehaus.fabric3.fabric3-db-exist.*
+org.codehaus.fabric3.itest.*
+org.codehaus.fabric3.spec.*
+org.codehaus.fabric3.standalone.*
+org.codehaus.fabric3.tomcat.*
+org.codehaus.fabric3.webapp.*
+org.codehaus.fabric3.weblogic.*
+org.codehaus.fitnesse-web.*
+org.codehaus.gant.*
+org.codehaus.geb.*
+org.codehaus.generama.*
+org.codehaus.gmaven.*
+org.codehaus.gmaven.archetypes.*
+org.codehaus.gmaven.examples.*
+org.codehaus.gmaven.feature.*
+org.codehaus.gmaven.runtime.*
+org.codehaus.gmaven.support.*
+org.codehaus.gmavenplus.*
+org.codehaus.gpars.*
+org.codehaus.grepo.*
+org.codehaus.griffon.*
+org.codehaus.griffon.maven.*
+org.codehaus.griffon.plugins.*
+org.codehaus.groovy.*
+org.codehaus.groovy.groovy-all.3.0.8.repo.org.codehaus.groovy.*
+org.codehaus.groovy.maven.*
+org.codehaus.groovy.maven.archetypes.*
+org.codehaus.groovy.maven.examples.*
+org.codehaus.groovy.maven.feature.*
+org.codehaus.groovy.maven.runtime.*
+org.codehaus.groovy.maven.support.*
+org.codehaus.groovy.modules.*
+org.codehaus.groovy.modules.groosh.*
+org.codehaus.groovy.modules.http-builder.*
+org.codehaus.groovy.modules.remote.*
+org.codehaus.groovy.modules.scriptom.*
+org.codehaus.groovyfx.*
+org.codehaus.guessencoding.*
+org.codehaus.httpcache4j.*
+org.codehaus.httpcache4j.clients.*
+org.codehaus.httpcache4j.resolvers.*
+org.codehaus.httpcache4j.spring.*
+org.codehaus.httpcache4j.storage.*
+org.codehaus.httpcache4j.uribuilder.*
+org.codehaus.hydra-cache.*
+org.codehaus.izpack.*
+org.codehaus.jackson.*
+org.codehaus.janino.*
+org.codehaus.javancss.*
+org.codehaus.jcsp.*
+org.codehaus.jedi.*
+org.codehaus.jet.*
+org.codehaus.jettison.*
+org.codehaus.jra.*
+org.codehaus.jremoting.*
+org.codehaus.jsr166-mirror.*
+org.codehaus.jstestrunner.*
+org.codehaus.jtstand.*
+org.codehaus.larex.*
+org.codehaus.mevenide.*
+org.codehaus.mevenide.plugins.*
+org.codehaus.modello.*
+org.codehaus.mojo.*
+org.codehaus.mojo.appassembler.*
+org.codehaus.mojo.archetypes.*
+org.codehaus.mojo.chronos-samples.*
+org.codehaus.mojo.dbupgrade.*
+org.codehaus.mojo.enchanter.*
+org.codehaus.mojo.groovy.*
+org.codehaus.mojo.groovy.examples.*
+org.codehaus.mojo.groovy.feature.*
+org.codehaus.mojo.groovy.runtime.*
+org.codehaus.mojo.groovy.support.*
+org.codehaus.mojo.hibernate3.*
+org.codehaus.mojo.jspc.*
+org.codehaus.mojo.natives.*
+org.codehaus.mojo.signature.*
+org.codehaus.mojo.unix.*
+org.codehaus.mojo.versions.*
+org.codehaus.mojo.webstart-maven-plugin.*
+org.codehaus.mojo.webstart.*
+org.codehaus.mvel.*
+org.codehaus.openxma.*
+org.codehaus.plexus.*
+org.codehaus.plexus.cache.*
+org.codehaus.plexus.examples.*
+org.codehaus.plexus.redback.*
+org.codehaus.plexus.redback.old.*
+org.codehaus.plexus.registry.*
+org.codehaus.plexus.security.*
+org.codehaus.plexus.webdav.*
+org.codehaus.redback.*
+org.codehaus.redback.components.*
+org.codehaus.redback.components.cache.*
+org.codehaus.redback.components.registry.*
+org.codehaus.service-conduit.*
+org.codehaus.service-conduit.spec.*
+org.codehaus.service-conduit.webapp.*
+org.codehaus.sonar-ide.*
+org.codehaus.sonar-ide.eclipse.*
+org.codehaus.sonar-plugins.*
+org.codehaus.sonar-plugins.android.*
+org.codehaus.sonar-plugins.css.*
+org.codehaus.sonar-plugins.cxx.*
+org.codehaus.sonar-plugins.dotnet.*
+org.codehaus.sonar-plugins.dotnet.csharp.*
+org.codehaus.sonar-plugins.dotnet.tests.*
+org.codehaus.sonar-plugins.dotnet.tools.*
+org.codehaus.sonar-plugins.erlang.*
+org.codehaus.sonar-plugins.flex.*
+org.codehaus.sonar-plugins.fxcop.*
+org.codehaus.sonar-plugins.java.*
+org.codehaus.sonar-plugins.javascript.*
+org.codehaus.sonar-plugins.jmeter.*
+org.codehaus.sonar-plugins.jproperties.*
+org.codehaus.sonar-plugins.json.*
+org.codehaus.sonar-plugins.l10n.*
+org.codehaus.sonar-plugins.pdf-report.*
+org.codehaus.sonar-plugins.php.*
+org.codehaus.sonar-plugins.plsqltoad.*
+org.codehaus.sonar-plugins.python.*
+org.codehaus.sonar-plugins.resharper.*
+org.codehaus.sonar-plugins.scm-activity.*
+org.codehaus.sonar-plugins.stylecop.*
+org.codehaus.sonar-plugins.toxicity-chart.*
+org.codehaus.sonar-plugins.visualstudio.*
+org.codehaus.sonar-plugins.xml.*
+org.codehaus.sonar.*
+org.codehaus.sonar.archetypes.*
+org.codehaus.sonar.common-rules.*
+org.codehaus.sonar.dotnet.fxcop.*
+org.codehaus.sonar.dotnet.tests.*
+org.codehaus.sonar.plugins.*
+org.codehaus.sonar.runner.*
+org.codehaus.sonar.sslr-squid-bridge.*
+org.codehaus.sonar.sslr.*
+org.codehaus.spring-security-oauth.*
+org.codehaus.staxmate.*
+org.codehaus.stomp.*
+org.codehaus.swizzle.*
+org.codehaus.tycho.*
+org.codehaus.wadi.*
+org.codehaus.waffle.*
+org.codehaus.woodstox.*
+org.codehaus.xdas4j.*
+org.codehaus.xdoclet.*
+org.codehaus.xfire.*
+org.codehaus.xfire.plugins.*
+org.codehaus.xharness.*
+org.codehaus.xsite.*
+org.codehaus.yfaces.*
+org.codejargon.*
+org.codejargon.feather.*
+org.codejive.*
+org.codejuicer.*
+org.codekaizen.testing.*
+org.codelabor.*
+org.codelamb.*
+org.codelibs.*
+org.codelibs.elasticsearch.lib.*
+org.codelibs.elasticsearch.module.*
+org.codelibs.fesen.*
+org.codelibs.fesen.client.*
+org.codelibs.fesen.lib.*
+org.codelibs.fesen.module.*
+org.codelibs.fesen.test.*
+org.codelibs.fesen.tool.*
+org.codelibs.fess.*
+org.codelibs.fione.*
+org.codelibs.gitbucket.*
+org.codelibs.opensearch.*
+org.codelibs.robot.*
+org.codelibs.xerces.*
+org.codelogger.*
+org.codelogger.plugin.*
+org.codemonkey.javareflection.*
+org.codemonkey.simplejavamail.*
+org.codemonkey.swiftsocketserver.*
+org.codenarc.*
+org.codepond.*
+org.codeprimate.*
+org.codeprimate.build.*
+org.coderclan.*
+org.coderoller.*
+org.coderu.*
+org.coderu.apirecorder.*
+org.coderu.aspectlog.*
+org.coderu.caspects.*
+org.codeswarm.*
+org.codetome.*
+org.codetome.hexameter.*
+org.codetome.riptide.*
+org.codetome.zircon.*
+org.codingmatters.*
+org.codingmatters.poom.*
+org.codingmatters.poom.ci.*
+org.codingmatters.poom.crons.*
+org.codingmatters.rest.*
+org.codingmatters.tests.*
+org.codingmatters.value.objects.*
+org.codroid.*
+org.coffeebreaks.yui.*
+org.cogchar.*
+org.cognitor.cassandra.*
+org.cogroo.*
+org.cogroo.jspellbr.*
+org.cogroo.lang.*
+org.cogroo.lang.pt_br.*
+org.coindirect.*
+org.coinspark.library.*
+org.cojen.*
+org.colapietro.maven.plugins.*
+org.coldis.*
+org.coldis.library.*
+org.colhome.*
+org.coliper.*
+org.colllib.*
+org.colomoto.*
+org.combinators.*
+org.cometd.*
+org.cometd.archetypes.*
+org.cometd.dojox.*
+org.cometd.java.*
+org.cometd.java.tests.*
+org.cometd.javascript.*
+org.cometd.jquery.*
+org.cometd.tests.*
+org.cometd.tutorials.*
+org.comixedproject.*
+org.commandmosaic.*
+org.commcarehq.commcare.*
+org.commonjava.*
+org.commonjava.aprox.*
+org.commonjava.aprox.boot.*
+org.commonjava.aprox.docker.*
+org.commonjava.aprox.embed.*
+org.commonjava.aprox.jarex.*
+org.commonjava.aprox.launch.*
+org.commonjava.aprox.tools.*
+org.commonjava.aprox.ui.*
+org.commonjava.aprox.wars.*
+org.commonjava.arqas.*
+org.commonjava.atlas.*
+org.commonjava.atservice.*
+org.commonjava.auditquery.*
+org.commonjava.boms.*
+org.commonjava.cartographer.*
+org.commonjava.cartographer.deploy.*
+org.commonjava.cdi.util.*
+org.commonjava.couch.*
+org.commonjava.couch.test.*
+org.commonjava.couch.web.*
+org.commonjava.emb.*
+org.commonjava.emb.components.*
+org.commonjava.emb.event.*
+org.commonjava.emb.infra.*
+org.commonjava.emb.integration.*
+org.commonjava.freeki.*
+org.commonjava.googlecode.markdown4j.*
+org.commonjava.honeycomb.beeline.*
+org.commonjava.indy.*
+org.commonjava.indy.boot.*
+org.commonjava.indy.docker.*
+org.commonjava.indy.embed.*
+org.commonjava.indy.launch.*
+org.commonjava.indy.rest.*
+org.commonjava.indy.service.*
+org.commonjava.indy.tools.*
+org.commonjava.indy.ui.*
+org.commonjava.maven.*
+org.commonjava.maven.assembly.*
+org.commonjava.maven.atlas.*
+org.commonjava.maven.cartographer.*
+org.commonjava.maven.enforcer.*
+org.commonjava.maven.ext.*
+org.commonjava.maven.galley.*
+org.commonjava.maven.plugins.*
+org.commonjava.mimeparse.*
+org.commonjava.propulsor.*
+org.commonjava.propulsor.camel.*
+org.commonjava.propulsor.client.*
+org.commonjava.propulsor.config.*
+org.commonjava.propulsor.content-audit.*
+org.commonjava.propulsor.metrics.*
+org.commonjava.qarqas.*
+org.commonjava.redhat.*
+org.commonjava.redhat.maven.*
+org.commonjava.resilience.otel.*
+org.commonjava.rwx.*
+org.commonjava.shelflife.*
+org.commonjava.sshwrap.*
+org.commonjava.ssl.*
+org.commonjava.tensor.*
+org.commonjava.test.*
+org.commonjava.util.*
+org.commonjava.vertx.*
+org.commonjava.web.*
+org.commonmark.*
+org.commonsources.*
+org.commonvox.*
+org.commonvox.collections.*
+org.compass-project.*
+org.compass.*
+org.compevol.*
+org.complate.*
+org.complykit.*
+org.computate.*
+org.computelab.*
+org.comroid.*
+org.comtel2000.*
+org.conbere.*
+org.conceptoriented.*
+org.concordion.*
+org.conf4j.*
+org.congocc.*
+org.connectbot.*
+org.connectopensource.*
+org.connectorio.*
+org.connectorio.addons.*
+org.connectorio.binding.*
+org.connectorio.binding.compute.*
+org.connectorio.binding.features.*
+org.connectorio.binding.features.distributions.*
+org.connectorio.binding.media.*
+org.connectorio.binding.plc4x.*
+org.connectorio.binding.transformation.*
+org.connectorio.cloud.*
+org.connectorio.openapi.*
+org.connectorio.openapi.generators.*
+org.connectorio.persistence.*
+org.connectorio.plc4x.*
+org.connectorio.plc4x.extras.*
+org.connectorio.plc4x.extras.features.*
+org.connectorio.security.*
+org.connectorio.telemetry.*
+org.connectorio.telemetry.probe.*
+org.connectorio.testcontainers.*
+org.connid.*
+org.connid.bundles.*
+org.connid.bundles.db.*
+org.connid.bundles.soap.*
+org.connid.testbundles.*
+org.conscrypt.*
+org.consensusresearch.*
+org.constretto.*
+org.contextmapper.*
+org.continuousassurance.swamp.*
+org.contract4j5.*
+org.controlsfx.*
+org.conventionsframework.*
+org.cooder.*
+org.cooder.tinylog.*
+org.coodex.*
+org.coodex.concrete.*
+org.coodex.concrete.amqp.*
+org.coodex.concrete.dubbo.*
+org.coodex.concrete.jaxrs.*
+org.coodex.concrete.websocket.*
+org.coody.framework.*
+org.coosproject.*
+org.coosproject.api.*
+org.coosproject.build-tools.*
+org.coosproject.build-tools.org.apache.felix.*
+org.coosproject.build-tools.org.knopflerfish.ant.*
+org.coosproject.build-tools.org.ops4j.*
+org.coosproject.examples.*
+org.coosproject.extender.*
+org.coosproject.maven.*
+org.coosproject.maven.archetypes.*
+org.coosproject.messaging.*
+org.coosproject.messaging.org.apache.xmlbeans.*
+org.coosproject.plugins.*
+org.copper-engine.*
+org.core4j.*
+org.coreasm.*
+org.corefine.common.*
+org.corefine.demo.*
+org.corehunter.*
+org.corejet.*
+org.cornutum.regexp.*
+org.cornutum.tcases.*
+org.cornutum.testing.*
+org.cornutum.wordle.*
+org.corpus-tools.*
+org.correomqtt.*
+org.cortx.*
+org.cosinuscode.swing.*
+org.cosoc.DIYConfig.*
+org.cosplayengine.*
+org.couch4j.*
+org.courio.*
+org.coursera.*
+org.coursera.android.*
+org.coursera.common.*
+org.coursera.courier.*
+org.coursera.naptime.*
+org.cowboyprogrammer.orgparser.*
+org.cprover.util.*
+org.cqfn.*
+org.cqfn.diktat.*
+org.cqfn.diktat.diktat-gradle-plugin.*
+org.cqfn.save.*
+org.crac.*
+org.craftercms.*
+org.craftercms.mariaDB4j.*
+org.craftercms.social.*
+org.craftsmenlabs.gareth.*
+org.craftsmenlabs.gareth.examples.*
+org.craftsmenlabs.gareth.rest.*
+org.craftsmenlabs.gareth.rest.example.*
+org.craftsmenlabs.scheduler.akka.*
+org.crashub.*
+org.crazycake.*
+org.crazyjavahacking.astvisualizer.*
+org.crazyyak.apis.*
+org.crazyyak.app.*
+org.crazyyak.demo.*
+org.crazyyak.dev.*
+org.crazyyak.embedded.*
+org.crazyyak.lib.*
+org.creativemines.schemaorg4j.*
+org.creativescala.*
+org.creekservice.*
+org.creekservice.schema.json.*
+org.creekservice.system.test.*
+org.cricketmsf.*
+org.cristalise.*
+org.criteria4jpa.*
+org.criticalsection.*
+org.criticalsection.commons-exec.*
+org.criticalsection.maven.*
+org.criticalsection.mtn4java.*
+org.crosslibs.*
+org.crossmobile.*
+org.crowdnotifier.*
+org.crsh.*
+org.crud2.*
+org.crud2.spring.boot.*
+org.crumbleworks.forge.crumbprops.*
+org.crumbleworks.forge.crumbutil.*
+org.cruxframework.*
+org.cruxframework.plugin.*
+org.cryptable.zap.*
+org.cryptacular.*
+org.cryptimeleon.*
+org.cryptoclassloader.*
+org.cryptomator.*
+org.cryptonode.jncryptor.*
+org.csanchez.kubernetes.*
+org.csc.*
+org.cssless.*
+org.cstamas.*
+org.cstamas.vertx.bitsy.*
+org.cstamas.vertx.orientdb.*
+org.cstamas.vertx.sisu.*
+org.csveed.*
+org.cthul.*
+org.cthul.api4j.*
+org.cthul.fixsure.*
+org.cthul.matchers.fluent.*
+org.cthul.nagios.*
+org.ctoolkit.agent.*
+org.ctoolkit.api.*
+org.ctoolkit.archetype.*
+org.ctoolkit.gwt.*
+org.ctoolkit.maven.*
+org.ctoolkit.maven.plugins.*
+org.ctoolkit.restapi.*
+org.ctoolkit.services.*
+org.ctoolkit.test.*
+org.ctoolkit.turnonline.*
+org.ctoolkit.wicket.*
+org.cubeengine.*
+org.cubeengine.maven.archetypes.*
+org.cubeengine.maven.plugins.*
+org.cuberact.*
+org.cukesalad.*
+org.culturegraph.*
+org.cuongnv.*
+org.cuongnv.bytearraypool.*
+org.cuongnv.consoleformatter.*
+org.cuongnv.disklinkedlist.*
+org.cuongnv.lancet.*
+org.cuongnv.viewbindingdelegate.*
+org.cups4j.*
+org.curioswitch.curiostack.*
+org.curjent.*
+org.cvogt.*
+org.cyanogenmod.*
+org.cyberborean.*
+org.cybergarage.upnp.*
+org.cybergarage.upnp.std.*
+org.cyberneko.pull.*
+org.cyclonedx.*
+org.cyclopsgroup.*
+org.d2ab.*
+org.dafny.*
+org.dagcoin.*
+org.dagobuh.*
+org.daijie.*
+org.daisy.*
+org.daisy.bindings.*
+org.daisy.braille.*
+org.daisy.dotify.*
+org.daisy.libs.*
+org.daisy.maven.*
+org.daisy.pipeline.*
+org.daisy.pipeline.bindings.*
+org.daisy.pipeline.build.*
+org.daisy.pipeline.modules.*
+org.daisy.pipeline.modules.braille.*
+org.daisy.streamline.*
+org.daisy.validation.*
+org.daisy.xprocspec.*
+org.daiv.appendable.*
+org.daiv.coroutines.*
+org.daiv.dependency.*
+org.daiv.dependency.VersionsPlugin.*
+org.daiv.jpersistence.*
+org.daiv.physics.units.*
+org.daiv.timebased.datacompress.*
+org.daiv.util.*
+org.daiv.websocket.*
+org.dajlab.*
+org.dalesbred.*
+org.danbrough.*
+org.danbrough.klog.*
+org.danbrough.kotlinx.*
+org.danbrough.kotlinxtras.*
+org.danbrough.kotlinxtras.binaries.*
+org.danbrough.kotlinxtras.consumer.*
+org.danbrough.kotlinxtras.core.*
+org.danbrough.kotlinxtras.curl.*
+org.danbrough.kotlinxtras.curl.binaries.*
+org.danbrough.kotlinxtras.iconv.*
+org.danbrough.kotlinxtras.iconv.binaries.*
+org.danbrough.kotlinxtras.openssl.*
+org.danbrough.kotlinxtras.openssl.binaries.*
+org.danbrough.kotlinxtras.properties.*
+org.danbrough.kotlinxtras.provider.*
+org.danbrough.kotlinxtras.sonatype.*
+org.danbrough.kotlinxtras.sqlite.*
+org.danbrough.kotlinxtras.sqlite.binaries.*
+org.danbrough.kotlinxtras.xtras.*
+org.danbrough.ktor.*
+org.danbrough.okio.*
+org.danbrough.sqldelight.*
+org.danbrough.touchlab.*
+org.danekja.*
+org.danekja.discussment.*
+org.danekja.discussment.db.*
+org.danielnixon.*
+org.danielnixon.progressive.*
+org.danilopianini.*
+org.danilopianini.Template-for-Gradle-Plugins.*
+org.danilopianini.gradle-java-qa.*
+org.danilopianini.gradle-kotlin-qa.*
+org.danilopianini.gradle-pre-commit-git-hooks.*
+org.danilopianini.multi-jvm-test-plugin.*
+org.danilopianini.publish-on-central.*
+org.danvk.*
+org.dapacode.tree4j.*
+org.darkphoenixs.*
+org.dasein.*
+org.dashbuilder.*
+org.dashj.*
+org.dashj.android.*
+org.databene.*
+org.databrary.*
+org.datacentric.*
+org.dataconservancy.fcrepo.*
+org.dataconservancy.packaging.*
+org.dataconservancy.pass.*
+org.dataconservancy.pass.deposit.*
+org.dataconservancy.pass.deposit.package.providers.*
+org.dataconservancy.pass.notify.*
+org.dataconservancy.pass.support.messaging.*
+org.datacrafts.*
+org.dataglot.*
+org.dataj.*
+org.datakurator.*
+org.datanucleus.*
+org.dataone.*
+org.dataone.dspace.*
+org.datapunch.*
+org.datarocks.*
+org.datasyslab.*
+org.datatransferproject.*
+org.datavec.*
+org.dataverse.*
+org.datayoo.caiser.*
+org.datayoo.moql.*
+org.datayoo.tripod.*
+org.datoin.net.*
+org.daverog.*
+org.davidbild.*
+org.db4j.*
+org.dbaumann.*
+org.dbdoclet.*
+org.dberg.*
+org.dbflute.*
+org.dbflute.jetty.*
+org.dbflute.lasta.*
+org.dbflute.mail.*
+org.dbflute.report.*
+org.dbflute.testing.*
+org.dbflute.tomcat.*
+org.dbflute.utflute.*
+org.dbflute.xls.*
+org.dbist.*
+org.dblock.log4jna.*
+org.dbmaintain.*
+org.dbpedia.*
+org.dbpedia.databus.*
+org.dbpedia.databus.archetype.*
+org.dbpedia.extraction.*
+org.dbpedia.lookup.*
+org.dbpedia.spotlight.*
+org.dbquerywatch.*
+org.dbrain.*
+org.dbrain.lib.*
+org.dbrain.platform.*
+org.dbrain.tool.*
+org.dbtools.*
+org.dbunit.*
+org.dd4t.*
+org.ddahl.*
+org.ddbstoolkit.toolkit.*
+org.ddbstoolkit.toolkit.core.*
+org.ddbstoolkit.toolkit.jdbc.*
+org.ddbstoolkit.toolkit.modules.datastore.jena.*
+org.ddbstoolkit.toolkit.modules.datastore.mysql.*
+org.ddbstoolkit.toolkit.modules.datastore.postgresql.*
+org.ddbstoolkit.toolkit.modules.datastore.sqlite.*
+org.ddbstoolkit.toolkit.modules.middleware.jgroups.*
+org.ddbstoolkit.toolkit.modules.middleware.sqlspaces.*
+org.dddjava.jig.*
+org.ddogleg.*
+org.debugtrace.*
+org.debux.webmotion.*
+org.decafcode.crest.*
+org.decampo.*
+org.decembrist.*
+org.decembrist.spring.*
+org.decimal4j.*
+org.decision-deck.*
+org.decsync.*
+org.deejdev.database.handysqlite.*
+org.deejdev.database.sqlitecursorloader.*
+org.deejdev.rxaction.*
+org.deejdev.rxaction3.*
+org.deepboof.*
+org.deephacks.*
+org.deephacks.cached.*
+org.deephacks.graphene.*
+org.deephacks.jobpipe.*
+org.deephacks.launcher.*
+org.deephacks.lmdb.*
+org.deephacks.lmdbjni.*
+org.deephacks.rxlmdb.*
+org.deephacks.streamql.*
+org.deephacks.tools4j.*
+org.deephacks.vals.*
+org.deephacks.vertxrs.*
+org.deephacks.westty.*
+org.deeplearning4j.*
+org.deepspeech.*
+org.deepsymmetry.*
+org.defendev.*
+org.definitylabs.flue2ent.*
+org.deflaker.*
+org.defne.*
+org.defne.samples.*
+org.dei.perla.*
+org.deletethis.mejico.*
+org.delia-lang.*
+org.dellroad.*
+org.deltafi.*
+org.demen.android.opencv.*
+org.demoiselle.jee.*
+org.demoiselle.signer.*
+org.dependencytrack.*
+org.depsea.*
+org.deri.xsparql.*
+org.derive4j.*
+org.derive4j.hkt.*
+org.designwizard.*
+org.dessertj.*
+org.dev-core.*
+org.devcake.groovy.*
+org.devefx.*
+org.devefx.spring.boot.*
+org.develrulez.thinjar.*
+org.devlib.schmidt.*
+org.devlive.sdk.*
+org.devnull.*
+org.devocative.*
+org.devocative.artemis.*
+org.devocative.thallo.*
+org.devopology.*
+org.devopsix.*
+org.devotionit.*
+org.devoxx4kids.bukkit.plugins.*
+org.devoxx4kids.spigot.plugins.*
+org.devunited.*
+org.devzendo.*
+org.dexr.*
+org.df4j.*
+org.dfasdl.*
+org.dhallj.*
+org.dhatim.*
+org.dhatim.io.dropwizard.*
+org.diablitozzz.*
+org.diagramsascode.*
+org.diana-hep.*
+org.didcommx.*
+org.didcommx.peerdid.*
+org.diet4j.*
+org.digibooster.retryable.*
+org.digibooster.spring.batch.*
+org.digidoc4j.*
+org.digidoc4j.dss.*
+org.digitalforge.*
+org.digitalmediaserver.*
+org.dihedron.activities.*
+org.dihedron.commons.*
+org.dihedron.crypto.*
+org.dihedron.strutlets.*
+org.dihedron.zephyr.*
+org.diirt.*
+org.diirt.javafx.*
+org.diirt.support.*
+org.directcode.jpower.*
+org.directcode.samrg472.*
+org.directtruststandards.*
+org.directwebremoting.*
+org.dirtylabcoat.*
+org.discotools.gwt.*
+org.disges.*
+org.dishevelled.*
+org.dishevelled.bundled.software.aws.healthai.*
+org.dispatchhttp.*
+org.disq-bio.*
+org.dita-ot.*
+org.divxdede.*
+org.dizitart.*
+org.djodjo.comm.*
+org.djodjo.json.*
+org.djodjo.tarator.*
+org.djodjo.widget.*
+org.djunits.*
+org.djutils.*
+org.dkpro.*
+org.dkpro.argumentation.*
+org.dkpro.c4corpus.*
+org.dkpro.core.*
+org.dkpro.jotl.*
+org.dkpro.jowkl.*
+org.dkpro.jwktl.*
+org.dkpro.lab.*
+org.dkpro.meta.*
+org.dkpro.script.*
+org.dkpro.similarity.*
+org.dkpro.statistics.*
+org.dkpro.tc.*
+org.dm.gradle.*
+org.dmfs.*
+org.dmilne.*
+org.dmonix.*
+org.dmonix.akka.*
+org.dmonix.functional.*
+org.dmonix.junit.*
+org.dmonix.pool.*
+org.dmonix.servlet.*
+org.dmonix.util.*
+org.dmonix.zookeeper.*
+org.dnal-lang.*
+org.dnsjava.*
+org.dnwiebe.*
+org.docbook.*
+org.docetproject.*
+org.dockbox.hartshorn.*
+org.dockingframes.*
+org.docshare.*
+org.docstr.*
+org.doctester.*
+org.doctribute.xml.*
+org.docx4j.*
+org.docx4j.org.apache.*
+org.docx4j.org.capaxit.textimage.*
+org.dodgybits.shuffle.*
+org.dojofaces.*
+org.dojotoolkit.*
+org.doktorodata.ohdata.*
+org.dom4j.*
+org.domdrides.*
+org.domeos.*
+org.dominokit.*
+org.dominokit.domino.*
+org.dominokit.domino.api.*
+org.dominokit.domino.apt.*
+org.dominokit.domino.archetypes.*
+org.dominokit.domino.impl.*
+org.dominokit.domino.logging.*
+org.dominokit.domino.test.*
+org.dominokit.i18n.*
+org.dominokit.jackson.*
+org.dotwebstack.*
+org.dotwebstack.framework.*
+org.dousi.*
+org.dpppt.*
+org.draegerlab.*
+org.dragonli.service.*
+org.drakosha.tools.calctable.*
+org.drasyl.*
+org.dreamcat.*
+org.dreamcat.jwrap.*
+org.drewcarlson.*
+org.driangle.*
+org.drizzle.jdbc.*
+org.drjekyll.*
+org.drmcrop.*
+org.droidparts.*
+org.droidparts.dexmaker.*
+org.droitateddb.*
+org.dromara.*
+org.dromara.dynamictp.*
+org.dromara.easy-es.*
+org.dromara.hutool.*
+org.dromara.jpom.*
+org.dromara.jpom.agent-transport.*
+org.dromara.jpom.plugins.*
+org.dromara.jpom.storage-module.*
+org.dromara.mybatis-jpa-extra.*
+org.dromara.sms4j.*
+org.dromara.solon-plugins.*
+org.dromara.stream-query.*
+org.dromara.x-easypdf.*
+org.drombler.*
+org.drombler.acp.*
+org.drombler.commons.*
+org.drombler.event.*
+org.drombler.fx.*
+org.drombler.identity.*
+org.drombler.iso9660fs.*
+org.drombler.jstore.*
+org.drombler.jstore.protocol.*
+org.drombler.media.*
+org.dronda.lib.*
+org.drools.*
+org.drools.planner.*
+org.drools.solver.*
+org.drools.testcoverage.*
+org.droolsassert.*
+org.dshops.*
+org.dsnp.activitycontent.*
+org.dspace.*
+org.dspace.dependencies.*
+org.dspace.dependencies.cocoon.*
+org.dspace.dependencies.jmockit.*
+org.dspace.dependencies.solr.*
+org.dspace.discovery.*
+org.dspace.dnsjava.*
+org.dspace.maven.plugins.*
+org.dspace.modules.*
+org.dspace.modules.imscp.*
+org.dspace.oclc.*
+org.dspace.xmlui.*
+org.dspace.xmlui.cocoon.*
+org.dspace.xmlui.concurrent.*
+org.dspace.xmlui.eclipse.*
+org.dspace.xmlui.ehcache.*
+org.dspace.xmlui.excalibur.*
+org.dspace.xmlui.jakarta.*
+org.dspace.xmlui.javac.*
+org.dspace.xmlui.jcs.*
+org.dspace.xmlui.rhino.*
+org.dspace.xmlui.xml.*
+org.dstadler.*
+org.dtangler.*
+org.du-lab.Mummichog.*
+org.du-lab.adap-big.*
+org.du-lab.javanmf.*
+org.du-lab.jsparsehc.*
+org.duckapter.*
+org.duckdb.*
+org.duckitgo.*
+org.duelengine.*
+org.duineframework.*
+org.dungba.*
+org.duracloud.*
+org.duracloud.db.*
+org.duracloud.mill.*
+org.duracloud.snapshot.*
+org.duracloud.tools.*
+org.duraspace.*
+org.duraspace.fcrepo-cloudsync.*
+org.dustinl.argparse4k.*
+org.duuba.xades.*
+org.dvare.*
+org.dwcj.*
+org.dxworks.utils.*
+org.dyn4j.*
+org.dynalang.*
+org.dynamicloud.api.*
+org.dynamide.*
+org.dynamise.*
+org.dynamoframework.*
+org.dynaresume.*
+org.dynjs.*
+org.dyvil.*
+org.e-hoffman.build.*
+org.e-hoffman.crypto.*
+org.e-hoffman.maven.*
+org.e-hoffman.testing.*
+org.easetech.*
+org.easyarch.*
+org.easyb.*
+org.easybatch.*
+org.easycluster.*
+org.easygson.*
+org.easymetrics.*
+org.easymock.*
+org.easyrules.*
+org.easysoc.*
+org.easystub.*
+org.easytesting.*
+org.easytravelapi.*
+org.eaxy.*
+org.ebayopensource.winder.*
+org.ebaysf.web.*
+org.ec4j.ant.*
+org.ec4j.core.*
+org.ec4j.linters.*
+org.ec4j.maven.*
+org.eccosolutions.osaf.cosmo.*
+org.echocat.*
+org.echocat.java-stream-utils.*
+org.echocat.jemoni.*
+org.echocat.jomon.*
+org.echocat.jomon.demo.*
+org.echocat.jomon.maven.*
+org.echocat.jomon.maven.plugins.*
+org.echocat.jomon.net.*
+org.echocat.jomon.spring.*
+org.echocat.locela.api.*
+org.echocat.marquardt.*
+org.echocat.maven.plugins.*
+org.echocat.repo4j.*
+org.echocat.rundroid.*
+org.echocat.units4j.*
+org.echovantage.*
+org.eclairjs.*
+org.eclipse.*
+org.eclipse.aether.*
+org.eclipse.angus.*
+org.eclipse.ant.*
+org.eclipse.app4mc.*
+org.eclipse.app4mc.build.*
+org.eclipse.app4mc.migration.*
+org.eclipse.basyx.*
+org.eclipse.birt.*
+org.eclipse.birt.UI.*
+org.eclipse.birt.birt-packages.birt-charts.*
+org.eclipse.birt.build.*
+org.eclipse.birt.build.package.*
+org.eclipse.birt.build.package.nl.*
+org.eclipse.birt.chart.*
+org.eclipse.birt.common.*
+org.eclipse.birt.core.*
+org.eclipse.birt.data.*
+org.eclipse.birt.docs.*
+org.eclipse.birt.engine.*
+org.eclipse.birt.features.*
+org.eclipse.birt.model.*
+org.eclipse.birt.nl.*
+org.eclipse.birt.runtime.*
+org.eclipse.birt.runtime.3_7_1.*
+org.eclipse.birt.testsuites.*
+org.eclipse.birt.viewer.*
+org.eclipse.birt.xtab.*
+org.eclipse.californium.*
+org.eclipse.che.*
+org.eclipse.che.core.*
+org.eclipse.che.dashboard.*
+org.eclipse.che.depmgt.*
+org.eclipse.che.dev.*
+org.eclipse.che.dockerfiles.*
+org.eclipse.che.docs.*
+org.eclipse.che.infrastructure.*
+org.eclipse.che.infrastructure.docker.*
+org.eclipse.che.lib.*
+org.eclipse.che.ls.jdt.*
+org.eclipse.che.multiuser.*
+org.eclipse.che.parent.*
+org.eclipse.che.plugin.*
+org.eclipse.che.sample.*
+org.eclipse.che.selenium.*
+org.eclipse.che.typescript.dto.*
+org.eclipse.che.workspace.loader.*
+org.eclipse.collections.*
+org.eclipse.concierge.*
+org.eclipse.core.*
+org.eclipse.core.databinding.*
+org.eclipse.core.filesystem.*
+org.eclipse.core.filesystem.linux.*
+org.eclipse.core.filesystem.solaris.*
+org.eclipse.core.filesystem.win32.*
+org.eclipse.core.resources.*
+org.eclipse.core.runtime.*
+org.eclipse.core.runtime.compatibility.*
+org.eclipse.cvs.*
+org.eclipse.dataspaceconnector.*
+org.eclipse.debug.*
+org.eclipse.digitaltwin.aas4j.*
+org.eclipse.dirigible.*
+org.eclipse.dirigible.releng.*
+org.eclipse.dirigible.releng.nexus.*
+org.eclipse.ditto.*
+org.eclipse.ecf.*
+org.eclipse.ecf.core.*
+org.eclipse.ecf.discovery.*
+org.eclipse.ecf.example.*
+org.eclipse.ecf.example.collab.*
+org.eclipse.ecf.examples.*
+org.eclipse.ecf.filetransfer.*
+org.eclipse.ecf.presence.*
+org.eclipse.ecf.presence.collab.*
+org.eclipse.ecf.protocol.*
+org.eclipse.ecf.provider.*
+org.eclipse.ecf.provider.bittorrent.*
+org.eclipse.ecf.provider.filetransfer.*
+org.eclipse.ecf.provider.irc.*
+org.eclipse.ecf.provider.msn.*
+org.eclipse.ecf.provider.xmpp.*
+org.eclipse.ecf.server.*
+org.eclipse.ecf.telephony.*
+org.eclipse.ecf.telephony.call.*
+org.eclipse.edc.*
+org.eclipse.edc.autodoc.*
+org.eclipse.edc.edc-build-base.*
+org.eclipse.edc.edc-build.*
+org.eclipse.edc.module-names.*
+org.eclipse.edc.openapi-merger.*
+org.eclipse.edc.test-summary.*
+org.eclipse.ee4j.*
+org.eclipse.elk.*
+org.eclipse.emf.*
+org.eclipse.emf.codegen.*
+org.eclipse.emf.codegen.ecore.*
+org.eclipse.emf.common.*
+org.eclipse.emf.commonj.*
+org.eclipse.emf.ecore.*
+org.eclipse.emf.ecore.change.*
+org.eclipse.emf.ecore.sdo.*
+org.eclipse.emf.edit.*
+org.eclipse.emf.importer.*
+org.eclipse.emf.mapping.*
+org.eclipse.emf.mapping.ecore.*
+org.eclipse.emf.mapping.ecore2ecore.*
+org.eclipse.emf.mapping.ecore2xml.*
+org.eclipse.emf.mapping.xsd2ecore.*
+org.eclipse.emf.ocl.*
+org.eclipse.emf.parsley.*
+org.eclipse.emf.query.*
+org.eclipse.emf.query.ocl.*
+org.eclipse.emf.transaction.*
+org.eclipse.emf.validation.*
+org.eclipse.emf.validation.ocl.*
+org.eclipse.emf.validation.ui.*
+org.eclipse.emf.workspace.*
+org.eclipse.emfatic.*
+org.eclipse.emfcloud.*
+org.eclipse.emfcloud.modelserver.*
+org.eclipse.emfcloud.modelserver.glsp.*
+org.eclipse.emt4j.*
+org.eclipse.epsilon.*
+org.eclipse.epsilon.labs.*
+org.eclipse.equinox.*
+org.eclipse.equinox.http.*
+org.eclipse.equinox.jmx.*
+org.eclipse.equinox.jmx.client.*
+org.eclipse.equinox.jmx.server.*
+org.eclipse.equinox.jsp.*
+org.eclipse.equinox.jsp.jasper.*
+org.eclipse.equinox.launcher.carbon.*
+org.eclipse.equinox.launcher.gtk.linux.*
+org.eclipse.equinox.launcher.gtk.solaris.*
+org.eclipse.equinox.launcher.motif.aix.*
+org.eclipse.equinox.launcher.win32.win32.*
+org.eclipse.equinox.launcher.wpf.win32.*
+org.eclipse.equinox.preferences.*
+org.eclipse.equinox.registry.*
+org.eclipse.esmf.*
+org.eclipse.gemini.blueprint.*
+org.eclipse.glsp.*
+org.eclipse.glsp.example.*
+org.eclipse.gmf.*
+org.eclipse.gmf.bridge.*
+org.eclipse.gmf.bridge.ui.*
+org.eclipse.gmf.codegen.*
+org.eclipse.gmf.doc.*
+org.eclipse.gmf.ecore.*
+org.eclipse.gmf.graphdef.*
+org.eclipse.gmf.graphdef.codegen.*
+org.eclipse.gmf.map.*
+org.eclipse.gmf.runtime.*
+org.eclipse.gmf.runtime.common.*
+org.eclipse.gmf.runtime.common.ui.*
+org.eclipse.gmf.runtime.common.ui.action.*
+org.eclipse.gmf.runtime.common.ui.printing.*
+org.eclipse.gmf.runtime.common.ui.services.*
+org.eclipse.gmf.runtime.common.ui.services.dnd.*
+org.eclipse.gmf.runtime.diagram.*
+org.eclipse.gmf.runtime.diagram.ui.*
+org.eclipse.gmf.runtime.diagram.ui.printing.*
+org.eclipse.gmf.runtime.diagram.ui.providers.*
+org.eclipse.gmf.runtime.diagram.ui.resources.*
+org.eclipse.gmf.runtime.diagram.ui.resources.editor.*
+org.eclipse.gmf.runtime.draw2d.*
+org.eclipse.gmf.runtime.draw2d.ui.*
+org.eclipse.gmf.runtime.draw2d.ui.render.*
+org.eclipse.gmf.runtime.emf.*
+org.eclipse.gmf.runtime.emf.clipboard.*
+org.eclipse.gmf.runtime.emf.commands.*
+org.eclipse.gmf.runtime.emf.type.*
+org.eclipse.gmf.runtime.emf.ui.*
+org.eclipse.gmf.runtime.gef.*
+org.eclipse.gmf.runtime.notation.*
+org.eclipse.gmf.tooldef.*
+org.eclipse.golo.*
+org.eclipse.hawk.*
+org.eclipse.hawkbit.*
+org.eclipse.help.*
+org.eclipse.hono.*
+org.eclipse.hudson.*
+org.eclipse.hudson.main.*
+org.eclipse.hudson.plugins.*
+org.eclipse.hudson.stapler.*
+org.eclipse.hudson.tools.*
+org.eclipse.hyades.probekit.doc.*
+org.eclipse.january.*
+org.eclipse.jdt.*
+org.eclipse.jdt.apt.*
+org.eclipse.jdt.apt.pluggable.*
+org.eclipse.jdt.compiler.*
+org.eclipse.jdt.core.*
+org.eclipse.jdt.core.compiler.*
+org.eclipse.jdt.debug.*
+org.eclipse.jdt.doc.*
+org.eclipse.jdt.junit.*
+org.eclipse.jdt.junit4.*
+org.eclipse.jdt.launching.*
+org.eclipse.jdt.source.macosx.carbon.*
+org.eclipse.jem.*
+org.eclipse.jemo.*
+org.eclipse.jet.*
+org.eclipse.jetty.*
+org.eclipse.jetty.aggregate.*
+org.eclipse.jetty.alpn.*
+org.eclipse.jetty.build.*
+org.eclipse.jetty.cdi.*
+org.eclipse.jetty.demos.*
+org.eclipse.jetty.documentation.*
+org.eclipse.jetty.drafts.*
+org.eclipse.jetty.ee10.*
+org.eclipse.jetty.ee10.demos.*
+org.eclipse.jetty.ee10.osgi.*
+org.eclipse.jetty.ee10.websocket.*
+org.eclipse.jetty.ee8.*
+org.eclipse.jetty.ee8.demos.*
+org.eclipse.jetty.ee8.websocket.*
+org.eclipse.jetty.ee9.*
+org.eclipse.jetty.ee9.demos.*
+org.eclipse.jetty.ee9.osgi.*
+org.eclipse.jetty.ee9.websocket.*
+org.eclipse.jetty.example-async-rest.*
+org.eclipse.jetty.examples.*
+org.eclipse.jetty.fcgi.*
+org.eclipse.jetty.gcloud.*
+org.eclipse.jetty.http2.*
+org.eclipse.jetty.http3.*
+org.eclipse.jetty.memcached.*
+org.eclipse.jetty.npn.*
+org.eclipse.jetty.orbit.*
+org.eclipse.jetty.osgi.*
+org.eclipse.jetty.quic.*
+org.eclipse.jetty.spdy.*
+org.eclipse.jetty.tests.*
+org.eclipse.jetty.toolchain.*
+org.eclipse.jetty.toolchain.setuid.*
+org.eclipse.jetty.websocket.*
+org.eclipse.jface.*
+org.eclipse.jgit.*
+org.eclipse.jkube.*
+org.eclipse.jkube.kubernetes.*
+org.eclipse.jkube.openshift.*
+org.eclipse.jnosql.*
+org.eclipse.jnosql.artemis.*
+org.eclipse.jnosql.artemis.reactive.*
+org.eclipse.jnosql.communication.*
+org.eclipse.jnosql.databases.*
+org.eclipse.jnosql.diana.*
+org.eclipse.jnosql.mapping.*
+org.eclipse.jnosql.mapping.reactive.*
+org.eclipse.jsch.*
+org.eclipse.jst.*
+org.eclipse.jst.common.*
+org.eclipse.jst.common.annotations.*
+org.eclipse.jst.common.project.facet.*
+org.eclipse.jst.ejb.*
+org.eclipse.jst.ejb.doc.*
+org.eclipse.jst.j2ee.*
+org.eclipse.jst.j2ee.doc.*
+org.eclipse.jst.j2ee.ejb.annotation.*
+org.eclipse.jst.j2ee.ejb.annotations.*
+org.eclipse.jst.j2ee.jca.*
+org.eclipse.jst.j2ee.navigator.*
+org.eclipse.jst.j2ee.webservice.*
+org.eclipse.jst.j2ee.xdoclet.*
+org.eclipse.jst.jee.*
+org.eclipse.jst.jsf.*
+org.eclipse.jst.jsf.common.*
+org.eclipse.jst.jsf.doc.*
+org.eclipse.jst.jsf.facesconfig.*
+org.eclipse.jst.jsf.standard.*
+org.eclipse.jst.jsp.*
+org.eclipse.jst.jsp.ui.*
+org.eclipse.jst.pagedesigner.jsf.*
+org.eclipse.jst.pagedesigner.jsp.*
+org.eclipse.jst.server.*
+org.eclipse.jst.server.generic.*
+org.eclipse.jst.server.preview.*
+org.eclipse.jst.server.tomcat.*
+org.eclipse.jst.server.ui.*
+org.eclipse.jst.server.ui.doc.*
+org.eclipse.jst.server.websphere.*
+org.eclipse.jst.servlet.*
+org.eclipse.jst.servlet.ui.*
+org.eclipse.jst.standard.*
+org.eclipse.jst.ws.*
+org.eclipse.jst.ws.axis.*
+org.eclipse.jst.ws.axis.consumption.*
+org.eclipse.jst.ws.axis.creation.*
+org.eclipse.jst.ws.axis.ui.doc.*
+org.eclipse.jst.ws.axis2.*
+org.eclipse.jst.ws.axis2.consumption.*
+org.eclipse.jst.ws.axis2.creation.*
+org.eclipse.jst.ws.consumption.*
+org.eclipse.jst.ws.consumption.ui.doc.*
+org.eclipse.jst.ws.creation.*
+org.eclipse.jst.ws.creation.ejb.*
+org.eclipse.jst.ws.doc.*
+org.eclipse.kapua.*
+org.eclipse.keyple.*
+org.eclipse.krazo.*
+org.eclipse.krazo.ext.*
+org.eclipse.leshan.*
+org.eclipse.lsp4j.*
+org.eclipse.ltk.core.*
+org.eclipse.ltk.ui.*
+org.eclipse.lyo.*
+org.eclipse.lyo.clients.*
+org.eclipse.lyo.core.query.*
+org.eclipse.lyo.oslc4j.core.*
+org.eclipse.lyo.oslc4j.server.*
+org.eclipse.lyo.server.*
+org.eclipse.lyo.store.*
+org.eclipse.lyo.trs.*
+org.eclipse.microprofile.*
+org.eclipse.microprofile.config.*
+org.eclipse.microprofile.context-propagation.*
+org.eclipse.microprofile.fault-tolerance.*
+org.eclipse.microprofile.graphql.*
+org.eclipse.microprofile.health.*
+org.eclipse.microprofile.health.specs.*
+org.eclipse.microprofile.jwt.*
+org.eclipse.microprofile.lra.*
+org.eclipse.microprofile.metrics.*
+org.eclipse.microprofile.openapi.*
+org.eclipse.microprofile.opentracing.*
+org.eclipse.microprofile.reactive-streams-operators.*
+org.eclipse.microprofile.reactive.messaging.*
+org.eclipse.microprofile.reactive.streams.*
+org.eclipse.microprofile.rest.client.*
+org.eclipse.microprofile.telemetry.*
+org.eclipse.microprofile.telemetry.tracing.*
+org.eclipse.milo.*
+org.eclipse.mylar.*
+org.eclipse.mylar.bugzilla.*
+org.eclipse.mylar.context.*
+org.eclipse.mylar.jira.*
+org.eclipse.mylar.monitor.*
+org.eclipse.mylar.tasks.*
+org.eclipse.mylar.trac.*
+org.eclipse.mylyn.*
+org.eclipse.mylyn.bugzilla.*
+org.eclipse.mylyn.context.*
+org.eclipse.mylyn.docs.*
+org.eclipse.mylyn.github.*
+org.eclipse.mylyn.help.*
+org.eclipse.mylyn.ide.*
+org.eclipse.mylyn.java.*
+org.eclipse.mylyn.jira.*
+org.eclipse.mylyn.monitor.*
+org.eclipse.mylyn.pde.*
+org.eclipse.mylyn.resources.*
+org.eclipse.mylyn.tasks.*
+org.eclipse.mylyn.team.*
+org.eclipse.mylyn.trac.*
+org.eclipse.mylyn.web.*
+org.eclipse.mylyn.wikitext.*
+org.eclipse.nebula.widgets.nattable.*
+org.eclipse.neoscada.base.*
+org.eclipse.neoscada.chart.*
+org.eclipse.neoscada.core.*
+org.eclipse.neoscada.hmi.*
+org.eclipse.neoscada.ide.*
+org.eclipse.neoscada.protocols.*
+org.eclipse.neoscada.utils.*
+org.eclipse.ocl.*
+org.eclipse.ocl.uml.*
+org.eclipse.oneofour.*
+org.eclipse.osgi.*
+org.eclipse.packagedrone.*
+org.eclipse.packager.*
+org.eclipse.paho.*
+org.eclipse.parsson.*
+org.eclipse.pass.*
+org.eclipse.pass.deposit.*
+org.eclipse.pass.deposit.package.providers.*
+org.eclipse.pass.notify.*
+org.eclipse.pass.support.messaging.*
+org.eclipse.passage.*
+org.eclipse.pde.*
+org.eclipse.pde.doc.*
+org.eclipse.pde.junit.*
+org.eclipse.pde.ui.*
+org.eclipse.persistence.*
+org.eclipse.platform.*
+org.eclipse.platform.doc.*
+org.eclipse.platform.source.linux.gtk.*
+org.eclipse.platform.source.macosx.carbon.*
+org.eclipse.platform.source.solaris.gtk.*
+org.eclipse.platform.source.win32.win32.*
+org.eclipse.platform.source.win32.wpf.*
+org.eclipse.proviso.*
+org.eclipse.rap.*
+org.eclipse.rcp.*
+org.eclipse.rcp.source.aix.motif.*
+org.eclipse.rcp.source.linux.gtk.*
+org.eclipse.rcp.source.macosx.carbon.*
+org.eclipse.rcp.source.solaris.gtk.*
+org.eclipse.rcp.source.win32.win32.*
+org.eclipse.rcp.source.win32.wpf.*
+org.eclipse.rdf4j.*
+org.eclipse.scalamodules.*
+org.eclipse.scout.*
+org.eclipse.scout.archetypes.*
+org.eclipse.scout.rt.*
+org.eclipse.scout.sdk.*
+org.eclipse.scout.sdk.deps.*
+org.eclipse.scout.sdk.s2e.*
+org.eclipse.sisu.*
+org.eclipse.sprotty.*
+org.eclipse.starter.*
+org.eclipse.steady.*
+org.eclipse.swt.*
+org.eclipse.swt.carbon.*
+org.eclipse.swt.gtk.linux.*
+org.eclipse.swt.gtk.solaris.*
+org.eclipse.swt.motif.aix.*
+org.eclipse.swt.org.eclipse.swt.cocoa.macosx.4.3.swt.*
+org.eclipse.swt.org.eclipse.swt.cocoa.macosx.x86_64.4.3.swt.*
+org.eclipse.swt.org.eclipse.swt.gtk.aix.ppc.4.3.swt.*
+org.eclipse.swt.org.eclipse.swt.gtk.aix.ppc64.4.3.swt.*
+org.eclipse.swt.org.eclipse.swt.gtk.hpux.ia64.4.3.swt.*
+org.eclipse.swt.org.eclipse.swt.gtk.linux.ppc.4.3.swt.*
+org.eclipse.swt.org.eclipse.swt.gtk.linux.ppc64.4.3.swt.*
+org.eclipse.swt.org.eclipse.swt.gtk.linux.s390.4.3.swt.*
+org.eclipse.swt.org.eclipse.swt.gtk.linux.s390x.4.3.swt.*
+org.eclipse.swt.org.eclipse.swt.gtk.linux.x86.4.3.swt.*
+org.eclipse.swt.org.eclipse.swt.gtk.linux.x86_64.4.3.swt.*
+org.eclipse.swt.org.eclipse.swt.gtk.solaris.sparc.4.3.swt.*
+org.eclipse.swt.org.eclipse.swt.gtk.solaris.x86.4.3.swt.*
+org.eclipse.swt.org.eclipse.swt.win32.win32.x86.4.3.swt.*
+org.eclipse.swt.org.eclipse.swt.win32.win32.x86_64.4.3.swt.*
+org.eclipse.swt.win32.win32.*
+org.eclipse.swt.wpf.win32.*
+org.eclipse.tahu.*
+org.eclipse.team.*
+org.eclipse.team.cvs.*
+org.eclipse.tesla.*
+org.eclipse.tesla.plugin.*
+org.eclipse.tesla.plugins.*
+org.eclipse.text.*
+org.eclipse.tractusx.edc.*
+org.eclipse.transformer.*
+org.eclipse.tycho.*
+org.eclipse.tycho.ci.*
+org.eclipse.tycho.extras.*
+org.eclipse.tycho.nexus.*
+org.eclipse.ui.*
+org.eclipse.ui.ide.*
+org.eclipse.ui.intro.*
+org.eclipse.ui.navigator.*
+org.eclipse.ui.presentations.*
+org.eclipse.ui.views.properties.*
+org.eclipse.ui.workbench.*
+org.eclipse.uml2.*
+org.eclipse.uml2.codegen.*
+org.eclipse.uml2.codegen.ecore.*
+org.eclipse.uml2.common.*
+org.eclipse.uml2.diagram.*
+org.eclipse.uml2.diagram.codegen.*
+org.eclipse.uml2.examples.*
+org.eclipse.uml2.examples.uml.*
+org.eclipse.uml2.uml.*
+org.eclipse.uml2.uml.ecore.*
+org.eclipse.uml2.uml.profile.*
+org.eclipse.uml2tools.*
+org.eclipse.update.*
+org.eclipse.update.core.*
+org.eclipse.virgo.bundlor.*
+org.eclipse.virgo.util.*
+org.eclipse.vorto.*
+org.eclipse.vorto.utilities.*
+org.eclipse.wst.*
+org.eclipse.wst.command.*
+org.eclipse.wst.command.env.*
+org.eclipse.wst.command.env.doc.*
+org.eclipse.wst.common.*
+org.eclipse.wst.common.emfworkbench.*
+org.eclipse.wst.common.frameworks.*
+org.eclipse.wst.common.project.facet.*
+org.eclipse.wst.common.ui.*
+org.eclipse.wst.css.*
+org.eclipse.wst.doc.*
+org.eclipse.wst.dtd.*
+org.eclipse.wst.dtd.ui.*
+org.eclipse.wst.dtdeditor.doc.*
+org.eclipse.wst.html.*
+org.eclipse.wst.html.ui.*
+org.eclipse.wst.internet.*
+org.eclipse.wst.internet.monitor.*
+org.eclipse.wst.javascript.*
+org.eclipse.wst.javascript.ui.*
+org.eclipse.wst.server.*
+org.eclipse.wst.server.http.*
+org.eclipse.wst.server.preview.*
+org.eclipse.wst.server.ui.*
+org.eclipse.wst.server.ui.doc.*
+org.eclipse.wst.sse.*
+org.eclipse.wst.sse.doc.*
+org.eclipse.wst.sse.ui.*
+org.eclipse.wst.standard.*
+org.eclipse.wst.validation.*
+org.eclipse.wst.web.*
+org.eclipse.wst.web.ui.*
+org.eclipse.wst.webtools.doc.*
+org.eclipse.wst.ws.*
+org.eclipse.wst.wsdl.*
+org.eclipse.wst.wsdl.ui.doc.*
+org.eclipse.wst.wsi.*
+org.eclipse.wst.wsi.ui.doc.*
+org.eclipse.wst.xml.*
+org.eclipse.wst.xml.ui.*
+org.eclipse.wst.xmleditor.doc.*
+org.eclipse.wst.xsd.*
+org.eclipse.wst.xsdeditor.doc.*
+org.eclipse.wtp.*
+org.eclipse.xpand.*
+org.eclipse.xpanse.*
+org.eclipse.xpanse.modules.*
+org.eclipse.xpanse.plugins.*
+org.eclipse.xpect.*
+org.eclipse.xsd.*
+org.eclipse.xsd.ecore.*
+org.eclipse.xsd.mapping.*
+org.eclipse.xsemantics.*
+org.eclipse.xtend.*
+org.eclipse.xtext.*
+org.eclipse.zenoh.*
+org.eclipselabs.*
+org.eclipselabs.osgi-http-service-utils.*
+org.economicsl.*
+org.edla.*
+org.eend.*
+org.efaps.*
+org.efaps.apps.*
+org.efaps.maven.*
+org.effects4s.*
+org.ehcache.*
+org.ehcache.integrations.shiro.*
+org.ehcache.modules.*
+org.ehcache.modules.clustered.*
+org.ehrbase.openehr.*
+org.ehrbase.openehr.sdk.*
+org.eigengo.*
+org.eigengo.akka-extras.*
+org.eiichiro.acidhouse.*
+org.eiichiro.ash.*
+org.eiichiro.bootleg.*
+org.eiichiro.gig.*
+org.eiichiro.jaguar.*
+org.eiichiro.jazzmaster.*
+org.eiichiro.monophony.*
+org.eiichiro.reverb.*
+org.eintr.loglady.*
+org.ejbca.cesecore.*
+org.ejbca.cvc.*
+org.ejml.*
+org.ekrich.*
+org.ekstazi.*
+org.ektorp.*
+org.elasolutions.*
+org.elasql.*
+org.elasticflow.*
+org.elasticmq.*
+org.elasticsearch.*
+org.elasticsearch.client.*
+org.elasticsearch.distribution.*
+org.elasticsearch.distribution.deb.*
+org.elasticsearch.distribution.fully-loaded.*
+org.elasticsearch.distribution.integ-test-zip.*
+org.elasticsearch.distribution.oss-zip.*
+org.elasticsearch.distribution.rpm.*
+org.elasticsearch.distribution.shaded.*
+org.elasticsearch.distribution.tar.*
+org.elasticsearch.distribution.test.*
+org.elasticsearch.distribution.zip.*
+org.elasticsearch.gradle.*
+org.elasticsearch.maven.*
+org.elasticsearch.module.*
+org.elasticsearch.plugin.*
+org.elasticsearch.qa.*
+org.elasticsearch.qa.backwards.*
+org.elasticsearch.test.*
+org.elasticsoftwarefoundation.elasticactors-systems.*
+org.elasticsoftwarefoundation.elasticactors.*
+org.elastos.*
+org.elastos.did.*
+org.elastos.ela.*
+org.elbfisch.*
+org.elder.sourcerer.*
+org.electrologic.*
+org.elevans.*
+org.elsfs.openai.*
+org.eluder.*
+org.eluder.coveralls.*
+org.eluder.freemarker.*
+org.eluder.jersey.*
+org.eluder.juniter.*
+org.elypia.comcord.*
+org.elypia.commandler.*
+org.elypia.converters4deltaspike.*
+org.elypia.elypiai.*
+org.elypia.retropia.*
+org.elypia.webhooker.*
+org.elypia.webserver-testbed.*
+org.elypia.yaml4deltaspike.*
+org.embulk.*
+org.emergent-order.*
+org.emfjson.*
+org.emmalanguage.*
+org.enblom.time.*
+org.encog.*
+org.encry.*
+org.encryptor4j.*
+org.endea.*
+org.endpoints4s.*
+org.energistics.*
+org.enhydra.xmlc.*
+org.enki.*
+org.enmas.*
+org.enodeframework.*
+org.ensime.*
+org.ensime.maven.plugins.*
+org.entailment-dev.*
+org.entando.*
+org.entando.entando.*
+org.entando.entando.apps.*
+org.entando.entando.bundles.*
+org.entando.entando.bundles.app-view.*
+org.entando.entando.bundles.contents.*
+org.entando.entando.bundles.misc.*
+org.entando.entando.bundles.pages.*
+org.entando.entando.bundles.showlets.*
+org.entando.entando.bundles.widgets.*
+org.entando.entando.components.*
+org.entando.entando.plugins.*
+org.enterpriseflowsrepository.api.*
+org.entinae.*
+org.entur.*
+org.entur.gbfs.*
+org.entur.jwt-rs.*
+org.entur.maven.orb.agent.*
+org.entur.ror.*
+org.entur.ror.helpers.*
+org.enumapi.*
+org.enumerable.*
+org.eobjects.analyzerbeans.*
+org.eobjects.build.*
+org.eobjects.datacleaner.*
+org.eobjects.datacleaner.extensions.*
+org.eobjects.datacleaner.extensions.vehicles.*
+org.eobjects.metamodel-extras.*
+org.eobjects.metamodel.*
+org.eobjects.sassyreader.*
+org.eolang.*
+org.eolang.dejump.*
+org.epics.*
+org.epics.channelfinder.*
+org.epos-eu.ics-c.*
+org.eprover.*
+org.equilibriums.utils.*
+org.erasmusmc.data-mining.*
+org.erasmusmc.data-mining.3rd-party.*
+org.erasmusmc.data-mining.ontology.*
+org.erasmusmc.data-mining.peregrine.*
+org.ergoplatform.*
+org.erjia.*
+org.erlang.otp.*
+org.eroq.*
+org.errors4s.*
+org.erwinkok.libp2p.*
+org.erwinkok.multiformat.*
+org.erwinkok.result.*
+org.esbtools.auth.*
+org.esbtools.eventhandler.*
+org.esbtools.gateway.resync.*
+org.esbtools.lightblue-notification-hook.*
+org.esbtools.message.admin.*
+org.escenic.rest.*
+org.esigate.*
+org.esigate.maven.*
+org.essentials4j.*
+org.estonlabs.*
+org.esup-portail.*
+org.esupportail.portlet.filemanager.*
+org.esupportail.sympa.*
+org.etby.*
+org.etby.datacache.*
+org.etcsoft.*
+org.ethelred.*
+org.ethelred.cgi.*
+org.ethereum.*
+org.etourdot.*
+org.etsi.uri.gcm.*
+org.eu.acolyte.*
+org.eu.ingwar.maven.*
+org.eu.ingwar.tools.*
+org.eu.vooo.*
+org.eu.zajc.*
+org.eulerframework.*
+org.eulerframework.boot.*
+org.eurekaclinical.*
+org.evactor.*
+org.evcode.queryfy.*
+org.eventnative.*
+org.eventopist.*
+org.everit.*
+org.everit.atlassian.*
+org.everit.audit.*
+org.everit.authentication.*
+org.everit.authenticator.*
+org.everit.authnr.*
+org.everit.authorization.*
+org.everit.blobstore.*
+org.everit.cache.*
+org.everit.cluster.*
+org.everit.commons.*
+org.everit.config.*
+org.everit.credential.*
+org.everit.email.*
+org.everit.expression.*
+org.everit.forks.*
+org.everit.http.*
+org.everit.i18n.*
+org.everit.jdk.javaagent.*
+org.everit.jetty.*
+org.everit.json.*
+org.everit.osgi.*
+org.everit.osgi.ariesblueprint.*
+org.everit.osgi.bundles.*
+org.everit.osgi.dev.*
+org.everit.osgi.dev.dist.*
+org.everit.osgi.dev.dist.v4_0_0.*
+org.everit.osgi.extension.*
+org.everit.osgi.jmx.*
+org.everit.password.*
+org.everit.persistence.*
+org.everit.propertystore.*
+org.everit.props.*
+org.everit.resource.*
+org.everit.sms.*
+org.everit.templating.*
+org.everit.transaction.*
+org.everit.web.*
+org.everit.web.resources.*
+org.everrest.*
+org.eviline.*
+org.evolvis.bsi.*
+org.evolvis.bsi.kolab-ws.*
+org.evolvis.tartools.*
+org.evolvis.tartools.forked.*
+org.evolvis.tartools.maven-parent.*
+org.evomaster.*
+org.evosuite.*
+org.evosuite.plugins.*
+org.evrete.*
+org.eweb4j.*
+org.exbin.auxiliary.*
+org.exbin.bined.*
+org.exbin.bined.netbeans.*
+org.exbin.deltahex.*
+org.exbin.utils.*
+org.exbin.utils.guipopup.*
+org.exist-db.*
+org.exist-db.maven.plugins.*
+org.exist-db.thirdparty.com.ettrema.*
+org.exist-db.thirdparty.javax.xml.xquery.*
+org.exist-db.thirdparty.org.eclipse.wst.xml.*
+org.exist-db.thirdparty.org.xmldb.*
+org.exist-db.thirdparty.xerces.*
+org.exjson.*
+org.exparity.*
+org.expath.*
+org.expath.crypto.*
+org.expath.http.client.*
+org.expath.packaging.*
+org.expath.tools.*
+org.expedientframework.facilemock.*
+org.expedientframework.uitest.*
+org.expedientframework.workflowlite.*
+org.expressme.*
+org.expretio.capnp.*
+org.expretio.maven.plugins.*
+org.exquery.*
+org.extendj.*
+org.extism.sdk.*
+org.extrema-sistemas.*
+org.extrema-sistemas.loom.*
+org.extremecomponents.*
+org.eyrie.*
+org.ezand.*
+org.ezand.jottakloud.*
+org.ezand.telldus.*
+org.ezlibs.*
+org.f100ded.play.*
+org.f100ded.scala-url-builder.*
+org.fab-os.consul.*
+org.fabric3.*
+org.fabric3.gradle.*
+org.fabrician.maven-plugins.*
+org.facebook4j.*
+org.facsim.*
+org.factcast.*
+org.factcast.rest.jersey.*
+org.factcenter.inchworm.*
+org.factcenter.qilin.*
+org.fairdatapipeline.*
+org.fakereplace.*
+org.fakereplace.fakereplace-google-collections.*
+org.faktorips.*
+org.faktorips.runtimejpa.*
+org.falland.grpc.longlivedstreams.*
+org.familysearch.gedcom.*
+org.fanjr.simplify.*
+org.fanout.*
+org.fao.sola.admin.web.*
+org.fastcatsearch.analyzer.*
+org.fastercode.*
+org.fastercode.marmot.*
+org.fastily.*
+org.fastlight.*
+org.fastnate.*
+org.fastquery.*
+org.fastsql.*
+org.fatcatsolutions.*
+org.fathens.*
+org.faucet-pipeline.*
+org.fbk.cit.hlt.*
+org.fcrepo.*
+org.fcrepo.apix.*
+org.fcrepo.bom.*
+org.fcrepo.camel.*
+org.fcrepo.client.*
+org.fcrepo.fixity.*
+org.fcrepo.importexport.*
+org.fcrepo.migration.*
+org.fcrepo.transform.*
+org.fdroid.*
+org.feasy.cloud.*
+org.featurea.*
+org.features-runner.*
+org.febit.wit.*
+org.fedorahosted.openprops.*
+org.fedorahosted.tennera.*
+org.fedoraproject.xmvn.*
+org.feijoas.*
+org.femtoframework.app.*
+org.femtoframework.coin.*
+org.femtoframework.fork.*
+org.femtoframework.net.*
+org.femtoframework.orm.*
+org.femtoframework.parent.*
+org.femtoframework.service.*
+org.femtoframework.util.*
+org.fenixedu.*
+org.fennecpipeline.*
+org.fernice.*
+org.ferris.*
+org.ferris.flickrj.*
+org.ferris.io.*
+org.ferris.lang.*
+org.ferris.net.*
+org.ferris.swing.*
+org.ferris.util.*
+org.ff-lang.*
+org.ff4j.*
+org.fgsake.hibernate.*
+org.fhir.*
+org.fhirproof.*
+org.fictus.*
+org.fiennes.*
+org.figurate.*
+org.fiirs.*
+org.filesys.*
+org.filteredpush.*
+org.fingerprintsoft.junit.*
+org.finnpic.*
+org.finos-test.*
+org.finos.*
+org.finos.cdm.*
+org.finos.legend-community.*
+org.finos.legend.*
+org.finos.legend.depot.*
+org.finos.legend.engine.*
+org.finos.legend.pure.*
+org.finos.legend.sdlc.*
+org.finos.legend.shared.*
+org.finos.legend.studio.*
+org.finos.morphir.*
+org.finos.springbot.*
+org.finos.springbot.demos.*
+org.finos.springbot.tools.*
+org.finos.symphony.bdk.*
+org.finos.symphony.bdk.ext.*
+org.finos.symphony.toolkit.*
+org.finos.symphony.toolkit.demos.*
+org.finos.symphony.toolkit.tools.*
+org.finos.symphony.wdk.*
+org.finos.timebase-ce.*
+org.finos.tracdap.*
+org.finos.tracdap.plugins.*
+org.finos.tracdap.tools.*
+org.finos.vuu.*
+org.finra.datagenerator.*
+org.finra.fidelius.*
+org.finra.herd-mdl.metastore.*
+org.finra.herd.*
+org.finra.hiveqlunit.*
+org.finra.jtaf.*
+org.finra.megasparkdiff.*
+org.finra.msl.*
+org.fintecy.md.*
+org.fintrace.*
+org.fintrace.core.drivers.*
+org.fintx.*
+org.fiolino.*
+org.firebirdsql.*
+org.firebirdsql.embedded.*
+org.firebirdsql.fbjava.*
+org.firebirdsql.jdbc.*
+org.firepick.*
+org.firepowered.core.*
+org.firestack.*
+org.firstinspires.ftc.*
+org.fisco-bcos.*
+org.fisco-bcos.android-sdk.*
+org.fisco-bcos.code-generator.*
+org.fisco-bcos.java-sdk.*
+org.fishwife.*
+org.fissore.*
+org.fissore.jrecordbind.*
+org.fissore.jrecordbind.example.*
+org.fissore.steroids.*
+org.fitnesse.*
+org.fitnesse.cucumber.*
+org.fitnesse.jbehave.*
+org.fitnesse.plugins.*
+org.fiware.kiara.*
+org.fix4j.*
+org.fizmo.*
+org.flexiblepower.defpi.*
+org.flexlabs.*
+org.flexunit.*
+org.flinkextended.*
+org.flmelody.*
+org.flockdata.*
+org.floggy.*
+org.floggy.3rd.org.eclipse.*
+org.floggy.3rd.org.eclipse.core.*
+org.floggy.3rd.org.eclipse.equinox.*
+org.floggy.3rd.org.eclipse.jdt.*
+org.floggy.3rd.org.eclipse.ui.*
+org.floggy.3rd.org.microemu.*
+org.florescu.android.rangeseekbar.*
+org.flowable.*
+org.flowable.designer.*
+org.flowcomputing.commons.*
+org.flowstep.*
+org.fluentcodes.ihe.*
+org.fluentcodes.projects.elasticobjects.*
+org.fluentcodes.tools.*
+org.fluentd.*
+org.fluentd.kafka.*
+org.fluentlenium.*
+org.fluttercode.datafactory.*
+org.fluttercode.datavalve.*
+org.fluttercode.knappsack.*
+org.flyte.*
+org.flywaydb.*
+org.flywaydb.enterprise.*
+org.flywaydb.flyway-test-extensions.*
+org.flywaydb.flyway-test-extensions.samples.*
+org.flywaydb.flyway-test-extensions.samples.dbunit.*
+org.flywaydb.flyway-test-extensions.samples.spring.*
+org.flywaydb.pro.*
+org.fnlp.*
+org.fomkin.*
+org.fontbox.*
+org.force66.*
+org.forgedbits.*
+org.forgerock.*
+org.forgerock.cuppa.*
+org.forgerock.maven.plugins.*
+org.forkjoin.*
+org.formix.*
+org.fornax.*
+org.fornax.toolsupport.*
+org.forome.*
+org.forome.astorage.*
+org.fortasoft.*
+org.forwoods.*
+org.fosslight.*
+org.fosstrak.capturingapp.*
+org.fosstrak.epcis.*
+org.fosstrak.fc.*
+org.fosstrak.hal.*
+org.fosstrak.llrp.*
+org.fosstrak.reader.*
+org.fosstrak.tdt.*
+org.fosstrak.webadapters.*
+org.foundationdb.*
+org.foundweekends.*
+org.foundweekends.conscript.*
+org.foundweekends.giter8.*
+org.foxlabs.*
+org.fpassembly.*
+org.franca.*
+org.freckler.*
+org.freecompany.redline.*
+org.freecompany.util.*
+org.freedesktop.*
+org.freedesktop.gstreamer.*
+org.freedesktop.tango.*
+org.freedomfinancestack.*
+org.freehep.*
+org.freemarker.*
+org.freeplane.*
+org.freeplane.bulenkov.*
+org.freeplane.de.sciss.*
+org.freeplane.dpolivaev.mnemonicsetter.*
+org.freeplane.emoji.*
+org.freeplane.lightdev.*
+org.freeswitch.esl.client.*
+org.freetle.*
+org.freetrm.*
+org.frege-lang.*
+org.frekele.cielo.*
+org.frekele.demo.*
+org.frekele.elasticsearch.*
+org.frekele.fiscal.*
+org.frekele.fraud.protection.*
+org.freshcookies.*
+org.fressian.*
+org.frgaal.*
+org.friendularity.*
+org.frontcache.*
+org.froporec.*
+org.frozenarc.*
+org.fryske-akademy.*
+org.ftclib.ftclib.*
+org.fuchss.*
+org.fudaa.*
+org.fudaa.business.*
+org.fudaa.business.dodico-h2d.*
+org.fudaa.business.fudaa-ef.*
+org.fudaa.business.fudaa-sig.*
+org.fudaa.com.db4o.*
+org.fudaa.edu.auburn.vgj.*
+org.fudaa.framework.*
+org.fudaa.framework.ctulu.*
+org.fudaa.framework.dico.*
+org.fudaa.framework.dodico.*
+org.fudaa.framework.ebli.*
+org.fudaa.framework.fudaa.*
+org.fudaa.framework.fudaa.fudaa-dico.*
+org.fudaa.pom.*
+org.fudaa.soft.fudaa-dunes.*
+org.fudaa.soft.fudaa-lido.*
+org.fudaa.soft.fudaa-mascaret.*
+org.fudaa.soft.fudaa-mesh.*
+org.fudaa.soft.fudaa-navmer.*
+org.fudaa.soft.fudaa-reflux.*
+org.fudaa.soft.fudaa-refonde.*
+org.fudaa.soft.fudaa-sisyphe.*
+org.fudaa.soft.fudaa-taucomac.*
+org.fudaa.soft.fudaa-test-gitlab.*
+org.fugerit.java.*
+org.fugerit.java.fork.*
+org.fugerit.java.labs.*
+org.fugerit.java.legacy.*
+org.fugerit.java.mvn.*
+org.fugerit.java.poc.*
+org.fugerit.java.stub.*
+org.fugerit.java.universe.*
+org.fuin.*
+org.fuin.archetypes.*
+org.fuin.devsupwiz.*
+org.fuin.dsl.ddd.*
+org.fuin.esc.*
+org.fuin.esmp.*
+org.fuin.jpmsr.*
+org.fuin.marchetyper.*
+org.fuin.smp.*
+org.fuin.srcgen4j.*
+org.fuin.xsample.*
+org.fujion.*
+org.fujion.webjars.*
+org.fulib.*
+org.funcish.*
+org.funcqrs.*
+org.functionaljava.*
+org.furyio.*
+org.fusesource.*
+org.fusesource.bai.*
+org.fusesource.coffeebar.*
+org.fusesource.commonman.*
+org.fusesource.eca.*
+org.fusesource.examples.*
+org.fusesource.examples.fabric-camel-cluster.*
+org.fusesource.examples.fabric-camel-dosgi.*
+org.fusesource.fabric.*
+org.fusesource.fabric.bridge.*
+org.fusesource.fabric.examples.*
+org.fusesource.fabric.fab.*
+org.fusesource.fabric.fab.tests.*
+org.fusesource.fabric.fabric-examples.*
+org.fusesource.fabric.fabric-examples.fabric-camel-cluster.*
+org.fusesource.fabric.fabric-examples.fabric-camel-dosgi.*
+org.fusesource.fabric.itests.*
+org.fusesource.fabric.openshift.*
+org.fusesource.fabric.samples.*
+org.fusesource.fabric.security.*
+org.fusesource.fabric.security.sso.activemq.*
+org.fusesource.fabric.security.sso.client.*
+org.fusesource.fabric.virt.*
+org.fusesource.fabric.virt.bundles.*
+org.fusesource.fuse-extra.*
+org.fusesource.hawtbuf.*
+org.fusesource.hawtdb.*
+org.fusesource.hawtdispatch.*
+org.fusesource.hawtjni.*
+org.fusesource.hawtjournal.*
+org.fusesource.insight.*
+org.fusesource.jansi.*
+org.fusesource.jdbm.*
+org.fusesource.jms.*
+org.fusesource.joram-jms-tests.*
+org.fusesource.jvmassert.*
+org.fusesource.leveldbjni.*
+org.fusesource.maven.doxia.*
+org.fusesource.mop.*
+org.fusesource.mqtt-client.*
+org.fusesource.mvnplugins.*
+org.fusesource.restygwt.*
+org.fusesource.rmiviajms.*
+org.fusesource.rrd4j.*
+org.fusesource.scalamd.*
+org.fusesource.scalate.*
+org.fusesource.scalate.samples.*
+org.fusesource.scalate.sbt.*
+org.fusesource.scalate.tooling.*
+org.fusesource.stomp.*
+org.fusesource.stompjms.*
+org.fusesource.tooling.testing.*
+org.fusesource.wikitext.*
+org.fusio-project.*
+org.fuwjax.oss.*
+org.fuwjin.*
+org.fuzzydb.*
+org.fuzzydb.atom.*
+org.fuzzydb.attrs.*
+org.fuzzypattern.vertx.*
+org.fxmisc.cssfx.*
+org.fxmisc.easybind.*
+org.fxmisc.flowless.*
+org.fxmisc.richtext.*
+org.fxmisc.undo.*
+org.fxmisc.wellbehaved.*
+org.fxyz3d.*
+org.ga4gh.*
+org.gaelyk.*
+org.gagravarr.*
+org.gaixie.*
+org.gaixie.cache.*
+org.gaixie.extjs-wrapped.*
+org.gaixie.jibu.*
+org.gaixie.jibu.assemblies.*
+org.gaixie.jibu.itest.*
+org.gaixie.jibu.plugins.*
+org.gaixie.jibu.web.*
+org.gaixie.jslibs.*
+org.gaixie.json.*
+org.gaixie.sandbox.*
+org.gamedo.*
+org.gamio.*
+org.gandon.tomcat.*
+org.gannacademy.cdf.*
+org.gatein.*
+org.gatein.api.*
+org.gatein.common.*
+org.gatein.pc.*
+org.gaul.*
+org.gautelis.*
+org.gavaghan.*
+org.gawst.*
+org.gcontracts.*
+org.gdal.*
+org.gdl-lang.gdl-tools.*
+org.gdl2.*
+org.gearcode.*
+org.gearman.*
+org.gearvrf.*
+org.gebish.*
+org.geckoprojects.bnd.*
+org.geckoprojects.emf.*
+org.geckoprojects.emf.persistence.*
+org.geckoprojects.emf.utils.*
+org.geckoprojects.equinox.*
+org.geckoprojects.jakartars.*
+org.geckoprojects.mongo.*
+org.geckoprojects.p2.*
+org.geckoprojects.repository.*
+org.geckoprojects.rest.*
+org.geckoprojects.rsa.*
+org.geckoprojects.search.*
+org.gedcom4j.*
+org.gedcomx.*
+org.gedcomx.extensions.familysearch.*
+org.geepawhill.*
+org.geirove.exmeso.*
+org.gemini4j.*
+org.gemoc.git-sync-tools.*
+org.gemoc.image-tools-mavenplugin.*
+org.genantics.*
+org.geneontology.*
+org.geneontology.obographs.*
+org.genesys-pgr.*
+org.geneweaver.*
+org.genomicsdb.*
+org.genthz.*
+org.geohex.geohex4j.*
+org.geojsf.*
+org.geolatte.*
+org.geomajas.*
+org.geomajas.documentation.*
+org.geomajas.hammergwt.*
+org.geomajas.plugin.*
+org.geomajas.project.*
+org.geomajas.widget.*
+org.geomesa.geoserver.*
+org.geomesa.nifi.*
+org.geonames.*
+org.georegression.*
+org.geoserver.*
+org.geoserver.maven.*
+org.geotoolkit.*
+org.gephi.*
+org.gerweck.scala.*
+org.gerweck.scalafx.*
+org.getlantern.*
+org.getodk.*
+org.getshaka.*
+org.gfccollective.*
+org.ghost4j.*
+org.giavacms.*
+org.giavacms.common.*
+org.giiwa.*
+org.gilgamesh-ai.*
+org.gillius.*
+org.giojs.*
+org.gitective.*
+org.github.codefarmer.*
+org.github.evenjn.*
+org.github.leshan.*
+org.gitlab.*
+org.gitlab4j.*
+org.gitorious.jcryptionspring.*
+org.gjgr.*
+org.gjgr.pig.*
+org.gkbrown.*
+org.glamey.*
+org.glassfish-repo.packager.*
+org.glassfish.*
+org.glassfish.admin.*
+org.glassfish.admin.runtime.rtapt.*
+org.glassfish.admingui.*
+org.glassfish.annotations.*
+org.glassfish.api.*
+org.glassfish.appclient.*
+org.glassfish.appclient.server.*
+org.glassfish.branding.*
+org.glassfish.build.*
+org.glassfish.cdi.*
+org.glassfish.cluster.*
+org.glassfish.common.*
+org.glassfish.connectors.*
+org.glassfish.copyright.*
+org.glassfish.corba.*
+org.glassfish.core.*
+org.glassfish.deployment.*
+org.glassfish.distributions.*
+org.glassfish.doc.*
+org.glassfish.docs-l10n.*
+org.glassfish.docs-l10n.help-l10n.*
+org.glassfish.docs-l10n.man-l10n.*
+org.glassfish.docs.*
+org.glassfish.docs.help.*
+org.glassfish.docs.man.*
+org.glassfish.ejb.*
+org.glassfish.embedded.*
+org.glassfish.exousia.*
+org.glassfish.expressly.*
+org.glassfish.external.*
+org.glassfish.external.trinidad.*
+org.glassfish.extras.*
+org.glassfish.fighterfish.*
+org.glassfish.findbugs.*
+org.glassfish.flashlight.*
+org.glassfish.gmbal.*
+org.glassfish.grizzly.*
+org.glassfish.grizzly.osgi.*
+org.glassfish.grizzly.samples.*
+org.glassfish.ha.*
+org.glassfish.hk2.*
+org.glassfish.hk2.auto-depends-test.*
+org.glassfish.hk2.external.*
+org.glassfish.jaxb.*
+org.glassfish.jdbc.*
+org.glassfish.jdbc.jdbc-ra.*
+org.glassfish.jdbc.jdbc-ra.jdbc-core.*
+org.glassfish.jdbc.jdbc-ra.jdbc-ra-distribution.*
+org.glassfish.jdbc.jdbc-ra.jdbc30.*
+org.glassfish.jdbc.jdbc-ra.jdbc40.*
+org.glassfish.jersey.*
+org.glassfish.jersey.archetypes.*
+org.glassfish.jersey.bundles.*
+org.glassfish.jersey.bundles.glassfish.*
+org.glassfish.jersey.bundles.glassfish.v4_0.*
+org.glassfish.jersey.bundles.repackaged.*
+org.glassfish.jersey.connectors.*
+org.glassfish.jersey.containers.*
+org.glassfish.jersey.containers.glassfish.*
+org.glassfish.jersey.core.*
+org.glassfish.jersey.examples.*
+org.glassfish.jersey.examples.helloworld-osgi-webapp.*
+org.glassfish.jersey.examples.osgi-helloworld-webapp.*
+org.glassfish.jersey.examples.osgi-http-service.*
+org.glassfish.jersey.ext.*
+org.glassfish.jersey.ext.cdi.*
+org.glassfish.jersey.ext.microprofile.*
+org.glassfish.jersey.ext.rx.*
+org.glassfish.jersey.incubator.*
+org.glassfish.jersey.inject.*
+org.glassfish.jersey.media.*
+org.glassfish.jersey.security.*
+org.glassfish.jersey.test-framework.*
+org.glassfish.jersey.test-framework.maven.*
+org.glassfish.jersey.test-framework.providers.*
+org.glassfish.jersey.tests.*
+org.glassfish.jersey.tools.plugins.*
+org.glassfish.jms.*
+org.glassfish.jsftemplating.*
+org.glassfish.jsonp.*
+org.glassfish.l10n.*
+org.glassfish.loadbalancer.*
+org.glassfish.main.*
+org.glassfish.main.admin.*
+org.glassfish.main.admingui.*
+org.glassfish.main.admingui.connector.*
+org.glassfish.main.appclient.*
+org.glassfish.main.appclient.client.*
+org.glassfish.main.appclient.server.*
+org.glassfish.main.batch.*
+org.glassfish.main.bean-validator-cdi.*
+org.glassfish.main.bean-validator.*
+org.glassfish.main.cluster.*
+org.glassfish.main.common.*
+org.glassfish.main.concurrent.*
+org.glassfish.main.connectors.*
+org.glassfish.main.core.*
+org.glassfish.main.deployment.*
+org.glassfish.main.deployment.jsr-88.*
+org.glassfish.main.diagnostics.*
+org.glassfish.main.distributions.*
+org.glassfish.main.ejb.*
+org.glassfish.main.elasticity.*
+org.glassfish.main.external.*
+org.glassfish.main.extras.*
+org.glassfish.main.extras.upgrade.*
+org.glassfish.main.featuresets.*
+org.glassfish.main.flashlight.*
+org.glassfish.main.grizzly.*
+org.glassfish.main.ha.*
+org.glassfish.main.hk2.*
+org.glassfish.main.jackson.module.*
+org.glassfish.main.javaee-api.*
+org.glassfish.main.jaxr-ra.*
+org.glassfish.main.jdbc.*
+org.glassfish.main.jdbc.jdbc-ra.*
+org.glassfish.main.jdbc.jdbc-ra.distribution.*
+org.glassfish.main.jdbc.jdbc-ra.jdbc-core.*
+org.glassfish.main.jdbc.jdbc-ra.jdbc-ra-distribution.*
+org.glassfish.main.jdbc.jdbc-ra.jdbc30.*
+org.glassfish.main.jdbc.jdbc-ra.jdbc40.*
+org.glassfish.main.jms.*
+org.glassfish.main.ldapbp.*
+org.glassfish.main.libpam4j.*
+org.glassfish.main.loadbalancer.*
+org.glassfish.main.microprofile.*
+org.glassfish.main.orb.*
+org.glassfish.main.osgi-platforms.*
+org.glassfish.main.packager.*
+org.glassfish.main.persistence.*
+org.glassfish.main.persistence.cmp.*
+org.glassfish.main.registration.*
+org.glassfish.main.resourcebase.resources.*
+org.glassfish.main.resources.*
+org.glassfish.main.romain.*
+org.glassfish.main.security.*
+org.glassfish.main.snapshots.*
+org.glassfish.main.tests.*
+org.glassfish.main.tests.tck.*
+org.glassfish.main.transaction.*
+org.glassfish.main.virtualization.*
+org.glassfish.main.web.*
+org.glassfish.main.web.web-embed.*
+org.glassfish.main.webservices.*
+org.glassfish.maven.plugin.*
+org.glassfish.metro.*
+org.glassfish.mojarra.*
+org.glassfish.mq.*
+org.glassfish.orb.*
+org.glassfish.osgi-platforms.*
+org.glassfish.ozark.*
+org.glassfish.ozark.ext.*
+org.glassfish.ozark.test.*
+org.glassfish.packager.*
+org.glassfish.packager.temp.*
+org.glassfish.persistence.*
+org.glassfish.persistence.cmp.*
+org.glassfish.pfl.*
+org.glassfish.provider.*
+org.glassfish.registration.*
+org.glassfish.samples.*
+org.glassfish.scripting.*
+org.glassfish.scripting.bundle.*
+org.glassfish.scripting.jruby.*
+org.glassfish.scripting.packager.*
+org.glassfish.security.*
+org.glassfish.shoal.*
+org.glassfish.simplestub.*
+org.glassfish.soteria.*
+org.glassfish.soteria.test.*
+org.glassfish.tests.*
+org.glassfish.transaction.*
+org.glassfish.tyrus.*
+org.glassfish.tyrus.archetypes.*
+org.glassfish.tyrus.bundles.*
+org.glassfish.tyrus.ext.*
+org.glassfish.tyrus.samples.*
+org.glassfish.tyrus.tests.*
+org.glassfish.tyrus.tests.qa.*
+org.glassfish.tyrus.tests.servlet.*
+org.glassfish.tyrus.tests.servlet.noappconfig.*
+org.glassfish.tyrus.tests.servlet.oneappconfig.*
+org.glassfish.tyrus.tests.servlet.twoappconfig.*
+org.glassfish.upgrade.*
+org.glassfish.virtualization.*
+org.glassfish.wasp.*
+org.glassfish.web.*
+org.glassfish.webservices.*
+org.glassfish.websocket.*
+org.glassfish.woodstock.*
+org.glassfish.woodstock.external.*
+org.glassmaker.*
+org.glavo.*
+org.glavo.hiper.*
+org.glavo.hmcl.*
+org.glavo.hmcl.mmachina.*
+org.glavo.hmcl.openjfx.*
+org.glavo.kala.*
+org.glavo.materialfx.*
+org.glittum.*
+org.globalbioticinteractions.*
+org.globalnames.*
+org.glom.libglom.*
+org.glowroot.*
+org.glowroot.instrumentation.*
+org.gluster.*
+org.glyptodon.guacamole.*
+org.gmetrics.*
+org.gmock.*
+org.gnieh.*
+org.gnode.*
+org.gnu.*
+org.gnu.gettext.*
+org.gnu.inet.*
+org.godotengine.*
+org.goduun.*
+org.golo-lang.*
+org.gomoob.*
+org.gonn.*
+org.goots.*
+org.goots.hiderdoclet.*
+org.goots.jackson.*
+org.goots.maven.*
+org.goots.maven.extensions.*
+org.goots.maven.plugins.*
+org.gorpipe.*
+org.gorpipe.gor.*
+org.gosu-lang.*
+org.gosu-lang.gosu.*
+org.gosu-lang.gosu.managed.*
+org.gosu-lang.sparkgs.*
+org.got5.*
+org.govariants.*
+org.gowk.*
+org.gowk.cas.*
+org.gowk.jotp.*
+org.gowk.mcms.*
+org.gparallelizer.*
+org.gperfutils.*
+org.graalvm.*
+org.graalvm.buildtools.*
+org.graalvm.buildtools.native.*
+org.graalvm.compiler.*
+org.graalvm.espresso.*
+org.graalvm.js.*
+org.graalvm.nativeimage.*
+org.graalvm.regex.*
+org.graalvm.sdk.*
+org.graalvm.tools.*
+org.graalvm.truffle.*
+org.graalvm.visualvm.api.*
+org.graalvm.visualvm.cluster.*
+org.graalvm.visualvm.modules.*
+org.gradle.*
+org.gradle.api.plugins.*
+org.gradle.exemplar.*
+org.gradle.gradlebuild.*
+org.gradle.jfr.polyfill.*
+org.gradle.profiler.*
+org.gradlefx.*
+org.gradoop.*
+org.grails.*
+org.grails.forge.*
+org.grails.grails-core.*
+org.grails.grails-doc.*
+org.grails.grails-gsp.*
+org.grails.grails-plugin.*
+org.grails.grails-profile.*
+org.grails.grails-web.*
+org.grails.internal.grails-plugin-publish.*
+org.grails.internal.grails-profile-publish.*
+org.grails.plugins.*
+org.grails.plugins.views-json.*
+org.grails.plugins.views-markup.*
+org.grails.profiles.*
+org.gramar.*
+org.graniteds.*
+org.graniteds.archetypes.*
+org.graniteds.grails.*
+org.graniteds.tutorials.*
+org.granitesoft.*
+org.graphast.*
+org.graphchi.*
+org.grapheco.*
+org.grapheco.pandadb.*
+org.graphfoundation.ongdb.*
+org.graphfoundation.ongdb.app.*
+org.graphfoundation.ongdb.assembly.*
+org.graphfoundation.ongdb.build.*
+org.graphfoundation.ongdb.client.*
+org.graphfoundation.ongdb.community.*
+org.graphfoundation.ongdb.licensing-proxy.*
+org.graphfoundation.ongdb.test.*
+org.graphity.*
+org.graphper.*
+org.graphstream.*
+org.graphwalker.*
+org.graxxia.*
+org.graylog.*
+org.graylog.autovalue.*
+org.graylog.cef.*
+org.graylog.jest.*
+org.graylog.metrics.*
+org.graylog.plugins.*
+org.graylog.repackaged.*
+org.graylog.repackaged.mongojack.*
+org.graylog.repackaged.siddhi.*
+org.graylog.shaded.*
+org.graylog.telemetry.*
+org.graylog2.*
+org.graylog2.log4j2.*
+org.graylog2.repackaged.*
+org.greatfire.*
+org.greatfire.envoy.*
+org.greenbytes.http.*
+org.greencheek.caching.*
+org.greencheek.jvmtools.*
+org.greencheek.memcached.*
+org.greencheek.mq.*
+org.greencheek.related.*
+org.greencheek.related.plugins.*
+org.greencheek.spray.*
+org.greeneyed.*
+org.greening.*
+org.greenrobot.*
+org.greports.*
+org.gretty.*
+org.gridfour.*
+org.gridgain.*
+org.gridkit.*
+org.gridkit.3rd.btrace.*
+org.gridkit.binary-extractors.*
+org.gridkit.coherence-search.*
+org.gridkit.coherence-tools.*
+org.gridkit.coherence.utils.*
+org.gridkit.gridbeans.*
+org.gridkit.gzrand.*
+org.gridkit.heapunit.*
+org.gridkit.jvmtool.*
+org.gridkit.lab.*
+org.gridkit.nanoparser.*
+org.gridkit.pds4j.*
+org.gridkit.search.*
+org.gridsuite.*
+org.gridvise.*
+org.griesbacher.jocose.*
+org.grlea.log.*
+org.grlea.log.adapters.*
+org.grobid.*
+org.gromitsoft.*
+org.grooscript.*
+org.groovyfx.*
+org.groovymc.groovyduvet.*
+org.groovymc.modsdotgroovy.*
+org.groovymud.*
+org.groovyutil.*
+org.grouchotools.*
+org.groupcache.*
+org.grouplens.*
+org.grouplens.common.*
+org.grouplens.grapht.*
+org.grouplens.lenskit.*
+org.grpcmock.*
+org.grpcmock.examples.*
+org.grules.*
+org.gservlet.*
+org.gstreamer.*
+org.gteng.*
+org.gtk-kt.*
+org.guangwenz.*
+org.guapswap.*
+org.guohai.*
+org.guppy4j.*
+org.gurux.*
+org.guthix.*
+org.guvnor.*
+org.guzz.*
+org.gvnix.*
+org.gweninterpreter.*
+org.gwizard.*
+org.gwt-jsonmaker.*
+org.gwtbootstrap3.*
+org.gwtmpv.*
+org.gwtmultipage.*
+org.gwtopenmaps.openlayers.*
+org.gwtproject.*
+org.gwtproject.animation.*
+org.gwtproject.aria.*
+org.gwtproject.callback.*
+org.gwtproject.core.*
+org.gwtproject.dom.*
+org.gwtproject.editor.*
+org.gwtproject.event.*
+org.gwtproject.geolocation.*
+org.gwtproject.http.*
+org.gwtproject.json.*
+org.gwtproject.layout.*
+org.gwtproject.place.*
+org.gwtproject.regexp.*
+org.gwtproject.safehtml.*
+org.gwtproject.timer.*
+org.gwtproject.typedarrays.*
+org.gwtproject.user.history.*
+org.gwtproject.user.window.*
+org.gwtproject.web.bindery.*
+org.gwtproject.xhr.*
+org.gwtproject.xml.*
+org.h1r4.common.*
+org.h2.compress.*
+org.h2database.*
+org.haakma.maven.plugins.*
+org.hablapps.*
+org.hackerpeers.*
+org.halcat.*
+org.halfempty.*
+org.hamcrest.*
+org.hammerlab.*
+org.hammerlab.adam.*
+org.hammerlab.bam.*
+org.hammerlab.bdg-utils.*
+org.hammerlab.cli.*
+org.hammerlab.genomics.*
+org.hammerlab.guacamole.*
+org.hammerlab.macros.*
+org.hammerlab.math.*
+org.hammerlab.sbt.*
+org.hammerlab.test.*
+org.hammurapi.*
+org.hansken.plugin.extraction.*
+org.harctoolbox.*
+org.hashids.*
+org.hashtree.jbrainhoney.*
+org.hashtree.stringmetric.*
+org.hawaiiframework.*
+org.hawkore.springframework.boot.*
+org.hawksoft.*
+org.hawkular.*
+org.hawkular.accounts.*
+org.hawkular.agent.*
+org.hawkular.alerts.*
+org.hawkular.apm.*
+org.hawkular.btm.*
+org.hawkular.bus.*
+org.hawkular.client.*
+org.hawkular.cmdgw.*
+org.hawkular.commons.*
+org.hawkular.datamining.*
+org.hawkular.inventory.*
+org.hawkular.metrics.*
+org.hawkular.nest.*
+org.hawkular.services.*
+org.hawkular.titan.*
+org.hbase.*
+org.hbasene.*
+org.hbel.*
+org.hbtalk.open.*
+org.hdfgroup.*
+org.hdiv.*
+org.hdrhistogram.*
+org.heaputils.*
+org.hectorclient.*
+org.hedgecode.maven.*
+org.hedgecode.maven.plugins.*
+org.hedspc.*
+org.heigit.bigspatialdata.*
+org.heigit.ohsome.*
+org.helenus.*
+org.helgoboss.*
+org.hellojavaer.*
+org.hellojavaer.ddal.*
+org.hellojavaer.fatjar.*
+org.hellojsp.*
+org.helmetsrequired.*
+org.henjue.library.*
+org.henrya.*
+org.hepeng.*
+org.herasaf.xacml.core.*
+org.herddb.*
+org.hertsstack.*
+org.hesperides.*
+org.hexworks.amethyst.*
+org.hexworks.cobalt.*
+org.hexworks.zircon.*
+org.hglteam.*
+org.hglteam.archetypes.*
+org.hglteam.platform.*
+org.hglteam.testing.*
+org.hiatusuk.*
+org.hibernate.*
+org.hibernate.apache.lucene.solr.*
+org.hibernate.aws-v4-signer-java-jbossmodules.*
+org.hibernate.beanvalidation.tck.*
+org.hibernate.build.gradle.*
+org.hibernate.common.*
+org.hibernate.elasticsearch-client-jbossmodules.*
+org.hibernate.gson-jbossmodules.*
+org.hibernate.hql.*
+org.hibernate.infra.*
+org.hibernate.java-persistence.*
+org.hibernate.javax.persistence.*
+org.hibernate.jpql.*
+org.hibernate.jsr303.tck.*
+org.hibernate.lucene-jbossmodules.*
+org.hibernate.ogm.*
+org.hibernate.orm.*
+org.hibernate.orm.tooling.*
+org.hibernate.reactive.*
+org.hibernate.search.*
+org.hibernate.tool.*
+org.hibernate.validator.*
+org.hibersap.*
+org.hibnet.*
+org.hid4java.*
+org.hidetake.*
+org.hiforce.base.*
+org.hiforce.lattice.*
+org.highfaces.*
+org.hihn.*
+org.hildan.blueprintjs.*
+org.hildan.checkstyle.*
+org.hildan.chrome.*
+org.hildan.fxgson.*
+org.hildan.generics.*
+org.hildan.har.*
+org.hildan.hashcode.*
+org.hildan.jackstomp.*
+org.hildan.krossbow.*
+org.hildan.livedoc.*
+org.hildan.ocr.*
+org.hildan.socketio.*
+org.hipparchus.*
+org.hisp.*
+org.hisp.dhis.*
+org.hisp.dhis.integration.camel.*
+org.hisp.dhis.integration.sdk.*
+org.hisp.dhis.lib.expression.*
+org.hisp.dhis.parser.*
+org.hisp.dhis.rules.*
+org.hisrc.camel.*
+org.hisrc.db-fahrplan-api.*
+org.hisrc.dbeac.*
+org.hisrc.fasta.*
+org.hisrc.hifaces20.*
+org.hisrc.inspire.*
+org.hisrc.jscm.*
+org.hisrc.jsonix.*
+org.hisrc.juneloop.*
+org.hisrc.lhapi.*
+org.hisrc.w3c.*
+org.hive2hive.*
+org.hiylo.*
+org.hiylo.components.*
+org.hjson.*
+org.hjug.dtangler.*
+org.hjug.dtangler.core.*
+org.hjug.dtangler.domain.*
+org.hjug.dtangler.swingui.*
+org.hjug.dtangler.testdata.cyclicdeps.*
+org.hjug.dtangler.testdata.gooddeps.*
+org.hjug.dtangler.testdata.java.*
+org.hjug.dtangler.testdata.java9.*
+org.hjug.dtangler.testutil.*
+org.hjug.dtangler.ui.*
+org.hjug.dtangler.ui.testutil.*
+org.hjug.refactorfirst.*
+org.hjug.refactorfirst.changepronenessranker.*
+org.hjug.refactorfirst.costbenefitcalculator.*
+org.hjug.refactorfirst.effortranker.*
+org.hjug.refactorfirst.graphdatagenerator.*
+org.hjug.refactorfirst.plugin.*
+org.hjug.refactorfirst.testresources.*
+org.hl7.fhir.publisher.*
+org.hl7.fhir.testcases.*
+org.hnau.*
+org.hnau.android.*
+org.hnau.api.*
+org.hnau.api.client.*
+org.hnau.api.server.*
+org.hnau.db.*
+org.hnau.logging.*
+org.hnau.server.*
+org.hnau.svg.*
+org.hnau.svgpath.*
+org.hobsoft.*
+org.hobsoft.entangle.*
+org.hobsoft.hamcrest.*
+org.hobsoft.microbrowser.*
+org.hobsoft.spring.*
+org.hobsoft.symmetry.*
+org.hobsoft.symmetry.demo.*
+org.hogel.*
+org.holer.*
+org.holmes-validation.*
+org.holodeckb2b.bdxr.*
+org.holodeckb2b.bdxr.smp.client.*
+org.holodeckb2b.commons.*
+org.holoeverywhere.*
+org.homedns.hondou.*
+org.homio.*
+org.homio.addon.*
+org.honton.chas.*
+org.honton.chas.datadog.apm.*
+org.honton.chas.hocon.*
+org.honton.chas.url.*
+org.honton.chas.zookeeper.*
+org.hornetq.*
+org.hornetq.examples.*
+org.hornetq.examples.core.*
+org.hornetq.examples.jms.*
+org.hornetq.rest.*
+org.hortonmachine.*
+org.hospadaruk.*
+org.hothub.*
+org.hothub.module.*
+org.hotpotmaterial.*
+org.hotrodorm.hotrod.*
+org.hotswapagent.*
+org.housecream.parent.*
+org.hoyi.*
+org.hpccsystems.*
+org.hprose.*
+org.hravemzdy.legalios.*
+org.hravemzdy.procezor.*
+org.hrodberaht.*
+org.hrodberaht.directus.*
+org.hrodberaht.inject.*
+org.hrodberaht.inject.core.*
+org.hrodberaht.inject.extension.*
+org.hrodberaht.inject.plugin.*
+org.hrorm.*
+org.hsluv.*
+org.hspconsortium.*
+org.hspconsortium.bilirubin.*
+org.hspconsortium.carewebframework.*
+org.hspconsortium.client.*
+org.hspconsortium.gallery.*
+org.hspconsortium.reference.*
+org.hspconsortium.release.*
+org.hspconsortium.sandbox.*
+org.hspconsortium.scheduling.*
+org.hsqldb.*
+org.hswebframework.*
+org.hswebframework.web.*
+org.htmlparser.*
+org.htmlunit.*
+org.htrace.*
+org.http4k.*
+org.http4s.*
+org.httpfeeds.*
+org.httpmock.*
+org.httpobjects.*
+org.httpobjects.apache-httpclient-4.x.*
+org.httpobjects.client.*
+org.httpobjects.demo.*
+org.httpobjects.freemarker.*
+org.httpobjects.jackson.*
+org.httpobjects.jaxb.*
+org.httpobjects.jetty.*
+org.httpobjects.multipart.*
+org.httpobjects.netty.*
+org.httpobjects.pom.*
+org.httpobjects.proxy.*
+org.httpobjects.servlet.*
+org.httpobjects.test.*
+org.httprpc.*
+org.httpunit.*
+org.htuple.*
+org.huahinframework.*
+org.huanglei.*
+org.hudsonci.lib.*
+org.hudsonci.lib.guava.*
+org.hudsonci.libs.*
+org.hudsonci.plugin.*
+org.hudsonci.plugins.*
+org.hudsonci.plugins.findbugs.*
+org.hudsonci.stapler.*
+org.hudsonci.tools.*
+org.hudsonci.xpath.*
+org.huiche.*
+org.huihoo.*
+org.humanistika.exist.index.algolia.*
+org.humanistika.exist.module.*
+org.humanistika.oxygen.*
+org.huoc.*
+org.husl-colors.*
+org.hutrace.*
+org.hyacinthbots.*
+org.hyalinedto.*
+org.hydev.*
+org.hypercomp.*
+org.hypercomp.telco.*
+org.hyperledger.fabric-chaincode-java.*
+org.hyperledger.fabric-sdk-java.*
+org.hyperledger.fabric.*
+org.hyperledger.sawtooth.*
+org.hyperscala.*
+org.hypertrace.agent.*
+org.hypoport.*
+org.hyrts.*
+org.i2peer.tor.*
+org.i3xx.eclipse.test.*
+org.i3xx.parent.*
+org.i3xx.step.*
+org.i3xx.util.*
+org.ianitrix.*
+org.iartisan.*
+org.iata.ndc.*
+org.iban4j.*
+org.ibankapp.*
+org.ibboost.maven.plugins.*
+org.ibboost.orqa.*
+org.ibissource.*
+org.ibissource.ibis-adapterframework-akamai.7.0-RC3.org.ibissource.*
+org.ic4j.*
+org.ical4j.*
+org.icann.czds.*
+org.ice1000.jimgui.*
+org.icechamps.*
+org.icefaces.*
+org.icefaces.ace-themes.*
+org.icefaces.samples.*
+org.icefaces.tutorial.*
+org.icefaces.tutorial.ace.*
+org.icepdf.os.*
+org.icepear.echarts.*
+org.icepush.*
+org.icij.*
+org.icij.datashare.*
+org.icij.extract.*
+org.icij.kaxxa.*
+org.icroco.*
+org.icroco.cocochagen.*
+org.ict4h.*
+org.ict4h.openmrs.*
+org.id4me.*
+org.identifiers.cloud.*
+org.identityconnectors.*
+org.idevlab.*
+org.idpass.*
+org.idpf.*
+org.idris-lang.*
+org.ietf.*
+org.ifinal.auto.*
+org.ifinal.finalframework.*
+org.ifinal.finalframework.annotation.*
+org.ifinal.finalframework.auto.*
+org.ifinal.finalframework.boot.*
+org.ifinal.finalframework.frameworks.*
+org.ifinal.finalframework.parent.*
+org.ifinalframework.*
+org.ifinalframework.annotation.*
+org.ifinalframework.auto.*
+org.ifinalframework.boot.*
+org.ifinalframework.data.*
+org.ifinalframework.javadoc.*
+org.ifinalframework.project.*
+org.ifinalframework.security.*
+org.igniterealtime.*
+org.igniterealtime.jbosh.*
+org.igniterealtime.jxmpp.*
+org.igniterealtime.openfire.*
+org.igniterealtime.openfire.plugins.*
+org.igniterealtime.smack.*
+org.igniterealtime.whack.*
+org.ihansen.mbp.*
+org.iharu.*
+org.iharu.auth.*
+org.iharu.bootstrap.*
+org.iharu.crypto.*
+org.iherus.*
+org.iherus.shiro.*
+org.ijsberg.*
+org.ijsberg.iglu.*
+org.ikasan.*
+org.ikasan.demo.*
+org.illyasviel.elide.*
+org.im4java.*
+org.imaginativeworld.oopsnointernet.*
+org.imaginativeworld.whynotimagecarousel.*
+org.imajine.*
+org.imajine.image.*
+org.imca-cat.maven.*
+org.imgscalr.*
+org.imintel.*
+org.imixs.application.*
+org.imixs.bpmn.*
+org.imixs.jwt.*
+org.imixs.marty.*
+org.imixs.maven.*
+org.imixs.workflow.*
+org.immregistries.*
+org.immunogenomics.gl.voldemort.*
+org.immutables.*
+org.immutables.dependency.*
+org.immutables.javaslang.*
+org.immutables.tools.*
+org.immutables.vavr.*
+org.impalaframework.*
+org.impalaframework.extension.*
+org.improving.*
+org.imsglobal.*
+org.in-cal.*
+org.incava.*
+org.incava.ijdk.*
+org.incenp.*
+org.incode.*
+org.incode.asciidoctor.improvethisdoc.*
+org.incode.asciidoctor.monotree.*
+org.incode.estatio.*
+org.incode.example.alias.*
+org.incode.example.classification.*
+org.incode.example.commchannel.*
+org.incode.example.communications.*
+org.incode.example.country.*
+org.incode.example.docfragment.*
+org.incode.example.docrendering.*
+org.incode.example.document.*
+org.incode.example.note.*
+org.incode.example.settings.*
+org.incode.example.tags.*
+org.incode.mavendeps.*
+org.incode.mavenmixin.*
+org.incode.module.alias.*
+org.incode.module.base.*
+org.incode.module.classification.*
+org.incode.module.commchannel.*
+org.incode.module.communications.*
+org.incode.module.country.*
+org.incode.module.docfragment.*
+org.incode.module.docrendering.*
+org.incode.module.document.*
+org.incode.module.errorrptjira.*
+org.incode.module.errorrptslack.*
+org.incode.module.fixturesupport.*
+org.incode.module.integtestsupport.*
+org.incode.module.jaxrsclient.*
+org.incode.module.minio.*
+org.incode.module.note.*
+org.incode.module.settings.*
+org.incode.module.slack.*
+org.incode.module.unittestsupport.*
+org.incode.module.userimpersonate.*
+org.incode.module.zip.*
+org.incode.platform.archetype.*
+org.indunet.*
+org.inferred.*
+org.inferred.internal.*
+org.infiniquery.*
+org.infinispan.*
+org.infinispan.archetypes.*
+org.infinispan.arquillian.container.*
+org.infinispan.doclets.*
+org.infinispan.hadoop.*
+org.infinispan.images.*
+org.infinispan.kafka.*
+org.infinispan.maven-plugins.*
+org.infinispan.protostream.*
+org.infinispan.server.*
+org.infinispan.wildfly.*
+org.infinitenature.*
+org.infinitenature.mtb.*
+org.infinitenature.vaguedate.*
+org.infinitenature.vct.*
+org.infinitest.*
+org.influxdb.*
+org.info2soft.*
+org.infobip.lib.*
+org.infobip.oneapi.*
+org.infodancer.*
+org.infradoop.*
+org.infrastructurebuilder.*
+org.infrastructurebuilder.automation.*
+org.infrastructurebuilder.bootstrap.*
+org.infrastructurebuilder.data.*
+org.infrastructurebuilder.maven.*
+org.infrastructurebuilder.modello.*
+org.infrastructurebuilder.nexus.*
+org.infrastructurebuilder.templating.*
+org.infrastructurebuilder.terraform.*
+org.infrastructurebuilder.usurped.*
+org.infrastructurebuilder.util.*
+org.infrastructurebuilder.util.artifacts.*
+org.infrastructurebuilder.util.auth.*
+org.infrastructurebuilder.util.logging.*
+org.ingini.mongodb.*
+org.ini4j.*
+org.inightmare.jxmlizer.*
+org.inigma.*
+org.inigma.maven.*
+org.inigma.shared.*
+org.initialize4j.*
+org.injava.lang.*
+org.inlighting.*
+org.inria.sacha.automaticRepair.*
+org.insight-centre.*
+org.insightlab.*
+org.instancio.*
+org.instnt.*
+org.int4.dirk.*
+org.int4.dirk.extensions.*
+org.integratedmodelling.*
+org.intellifl.*
+org.intelligents-ia.*
+org.intelligents-ia.hirondelle.*
+org.intelligents-ia.winstone.*
+org.intellimate.izou.*
+org.interledger.*
+org.interledger.connector.*
+org.interledger.spsp.*
+org.intermine.*
+org.internetitem.*
+org.interstellarocean.*
+org.inthewaves.kotlin-signald.*
+org.into-cps.*
+org.into-cps.fmi.*
+org.into-cps.maestro.*
+org.into-cps.maestro.codegen.*
+org.into-cps.maestro.frameworks.*
+org.into-cps.maestro.plugins.*
+org.into-cps.orchestration.*
+org.intrigus.smartgraph.*
+org.inurl.*
+org.inurl.shardingsphere.*
+org.ioke.*
+org.iolog4s.*
+org.ioperm.*
+org.iostreams.*
+org.iot-dsa.*
+org.iota.*
+org.iplantc.*
+org.iplantc.core.*
+org.iplass.*
+org.iq80.cli.*
+org.iq80.leveldb.*
+org.iq80.snappy.*
+org.iqnect.*
+org.ireas.common.*
+org.ireas.intuition.*
+org.ireas.mediawiki.*
+org.irenical.*
+org.irenical.bit.*
+org.irenical.booty.*
+org.irenical.consul.*
+org.irenical.drowsy.*
+org.irenical.fetchy.*
+org.irenical.healthy.*
+org.irenical.jindy.*
+org.irenical.lifecycle.*
+org.irenical.loggy.*
+org.irenical.maven.*
+org.irenical.norm.*
+org.irenical.shifty.*
+org.irenical.slf4j.*
+org.irenical.thrifty.*
+org.iris-events.*
+org.irlab.*
+org.irlab.fd.maven.archetypes.*
+org.iru.common.*
+org.iru.epd.*
+org.iru.external.org.w3.schemas.*
+org.iru.maven.plugins.*
+org.iru.rts.api.*
+org.iru.rts.classic.*
+org.iru.rts.classic.egis.*
+org.iru.rts.classic.tchq.*
+org.iru.rts.classic.tirepd.*
+org.iru.rts.classic.tvqr.*
+org.iru.rts.classic.wsrq.*
+org.iru.rts.classic.wsst.*
+org.iru.rtsplus.*
+org.iru.tirplus.*
+org.isaacphysics.*
+org.isaacphysics.thirdparty.*
+org.isarnproject.*
+org.isisaddons.metamodel.paraname8.*
+org.isisaddons.module.audit.*
+org.isisaddons.module.command.*
+org.isisaddons.module.devutils.*
+org.isisaddons.module.docx.*
+org.isisaddons.module.excel.*
+org.isisaddons.module.fakedata.*
+org.isisaddons.module.flywaydb.*
+org.isisaddons.module.freemarker.*
+org.isisaddons.module.pdfbox.*
+org.isisaddons.module.poly.*
+org.isisaddons.module.publishing.*
+org.isisaddons.module.publishmq.*
+org.isisaddons.module.quartz.*
+org.isisaddons.module.security.*
+org.isisaddons.module.servletapi.*
+org.isisaddons.module.sessionlogger.*
+org.isisaddons.module.settings.*
+org.isisaddons.module.stringinterpolator.*
+org.isisaddons.module.tags.*
+org.isisaddons.module.togglz.*
+org.isisaddons.module.xdocreport.*
+org.isisaddons.module.xxx.*
+org.isisaddons.wicket.excel.*
+org.isisaddons.wicket.fullcalendar2.*
+org.isisaddons.wicket.gmap3.*
+org.isisaddons.wicket.pdfjs.*
+org.isisaddons.wicket.summernote.*
+org.isisaddons.wicket.wickedcharts.*
+org.iso_relax.verifier.jaxp.validation.*
+org.isoblue.*
+org.isomorf.*
+org.isomorphism.*
+org.isomorphism.dropwizard.*
+org.isuper.*
+org.itadaki.*
+org.italiangrid.*
+org.itechet.*
+org.iternine.*
+org.itest.*
+org.itsallcode.*
+org.itsallcode.openfasttrace.*
+org.itsallcode.whiterabbit.*
+org.itsnat.*
+org.itstack.middleware.*
+org.itxtech.*
+org.iworkz.*
+org.j-im.*
+org.j3d.*
+org.j4j.*
+org.j8ql.*
+org.j8unit.*
+org.jabsaw.*
+org.jabsorb.*
+org.jaccept.*
+org.jacex.*
+org.jackstaff.grpc.*
+org.jacoco.*
+org.jacodb.*
+org.jacop.*
+org.jacorb.*
+org.jacorb.jacorb-demo.*
+org.jacorb.jacorb-demo.bank.*
+org.jacpfx.*
+org.jacpfx.vertx.spring.*
+org.jadice.filetype.*
+org.jadice.gwt.spring.*
+org.jadice.recordmapper.*
+org.jadice.tools.*
+org.jadice.web.*
+org.jadira.bindings.*
+org.jadira.cdt.*
+org.jadira.cloning.*
+org.jadira.framework.*
+org.jadira.jms.*
+org.jadira.lang.*
+org.jadira.maven.*
+org.jadira.quant.*
+org.jadira.refdata.*
+org.jadira.reflection.cloning.*
+org.jadira.scanner.*
+org.jadira.usertype.*
+org.jahia.archetypes.*
+org.jaitools.*
+org.jakma.paul.agarnet.*
+org.jakubczyk.*
+org.jalalm.util.*
+org.jallaby.*
+org.jamel.dbf.*
+org.jamel.j7zip.*
+org.jamel.kladr.*
+org.jamel.pkg4j.*
+org.jamesframework.*
+org.jamesii.*
+org.jamgo.*
+org.jamgo.framework.plugin.*
+org.jamon.*
+org.jamon.eclipse.*
+org.jamppa.*
+org.janusgraph.*
+org.janusgraph.commit.*
+org.japprove.*
+org.japura.*
+org.jarbframework.*
+org.jarhc.*
+org.jarling.*
+org.jarmoni.*
+org.jasig.*
+org.jasig.cas.*
+org.jasig.cas.client.*
+org.jasig.cas3.extensions.*
+org.jasig.ehcache.*
+org.jasig.inspektr.*
+org.jasig.maven.*
+org.jasig.mobile.app.*
+org.jasig.mojo.jspc.*
+org.jasig.openregistry.*
+org.jasig.parent.*
+org.jasig.portal.*
+org.jasig.portal.fbms.*
+org.jasig.portal.hibernate3.*
+org.jasig.portal.maven.*
+org.jasig.portal.soffit.*
+org.jasig.portal.tools.*
+org.jasig.portlet.*
+org.jasig.portlet.archetype.*
+org.jasig.portlet.athletics.*
+org.jasig.portlet.campus.*
+org.jasig.portlet.courses.*
+org.jasig.portlet.datalist.*
+org.jasig.portlet.dining.*
+org.jasig.portlet.map.*
+org.jasig.portlet.notification.*
+org.jasig.portlet.proxy.*
+org.jasig.portlet.simplecontent.*
+org.jasig.portlet.utils.*
+org.jasig.resource-aggregator.*
+org.jasig.resourceserver.*
+org.jasig.sched-assist.*
+org.jasig.service.*
+org.jasig.service.persondir.*
+org.jasig.springframework.*
+org.jasig.ssp.*
+org.jasig.ssp.platform.*
+org.jasig.ssp.service.persondir.*
+org.jasig.ssp.util.importer.*
+org.jasig.umobile.server.*
+org.jasig.uportal.*
+org.jasonjson.*
+org.jassetmanager.*
+org.jastadd.*
+org.jasypt.*
+org.jaudiolibs.*
+org.jaudiotagger.*
+org.java-sql-generator.*
+org.java-sql-generator.api.*
+org.java-sql-generator.implementation.*
+org.java-websocket.*
+org.java.net.substance.*
+org.javabeanstack.*
+org.javabits.jgrapht.*
+org.javabits.maven.md.*
+org.javabits.pmbean.*
+org.javabits.yar.*
+org.javacc.*
+org.javacc.generator.*
+org.javacc.generator.cpp.*
+org.javacc.generator.csharp.*
+org.javacc.generator.java.*
+org.javacc.plugin.*
+org.javacord.*
+org.javadelight.*
+org.javades.*
+org.javaee-samples.*
+org.javaee.*
+org.javafn.*
+org.javafp.*
+org.javafunk.*
+org.javafunk.funk.*
+org.javafunk.matchbox.*
+org.javafxdata.*
+org.javafxports.*
+org.javahg.*
+org.javalaboratories.*
+org.javalite.*
+org.javaloong.kongmink.*
+org.javaloong.kongmink.keycloak.*
+org.javamoney.*
+org.javamoney.examples.*
+org.javamoney.lib.*
+org.javamoney.moneta.*
+org.javapos.*
+org.javaruntype.*
+org.javasimon.*
+org.javassist.*
+org.javastack.*
+org.javastro.*
+org.javastro.ivoa.*
+org.javastro.ivoa.vo-dml.*
+org.javastro.vodsl.*
+org.javaswift.*
+org.javatuples.*
+org.javaweb.*
+org.javaweb.rasp.*
+org.javawebstack.*
+org.javaz.*
+org.javers.*
+org.javersion.*
+org.javimmutable.*
+org.javolution.*
+org.jaxdb.*
+org.jaxsb.*
+org.jaxxy.*
+org.jaxygen.*
+org.jaxygen.client.*
+org.jaxygen.typeconverter.*
+org.jaylib.scala.config.*
+org.jbake.*
+org.jbakery.*
+org.jbasics.*
+org.jbasics.atomify.*
+org.jbehave.*
+org.jbehave.site.*
+org.jbehave.web.*
+org.jbehavesupport.*
+org.jberet.*
+org.jberet.samples.*
+org.jberet.test-apps.*
+org.jbibtex.*
+org.jblabs.*
+org.jblas.*
+org.jboss.*
+org.jboss.aerogear.*
+org.jboss.aerogear.archetypes.*
+org.jboss.aerogear.test.*
+org.jboss.aerogear.test.arquillian.*
+org.jboss.aerogear.unifiedpush.*
+org.jboss.aerogear.windows.*
+org.jboss.aesh.*
+org.jboss.apiviz.*
+org.jboss.archetype.eap.*
+org.jboss.archetype.forge.*
+org.jboss.archetype.wfk.*
+org.jboss.arquillian.*
+org.jboss.arquillian.ajocado.*
+org.jboss.arquillian.config.*
+org.jboss.arquillian.container.*
+org.jboss.arquillian.core.*
+org.jboss.arquillian.daemon.*
+org.jboss.arquillian.example.*
+org.jboss.arquillian.extension.*
+org.jboss.arquillian.framework.*
+org.jboss.arquillian.graphene.*
+org.jboss.arquillian.junit.*
+org.jboss.arquillian.junit5.*
+org.jboss.arquillian.maven.*
+org.jboss.arquillian.osgi.*
+org.jboss.arquillian.packager.*
+org.jboss.arquillian.protocol.*
+org.jboss.arquillian.selenium.*
+org.jboss.arquillian.spock.*
+org.jboss.arquillian.test.*
+org.jboss.arquillian.testenricher.*
+org.jboss.arquillian.testng.*
+org.jboss.as.*
+org.jboss.as.archetypes.*
+org.jboss.as.galleon.*
+org.jboss.as.legacy.*
+org.jboss.as.legacy.naming.*
+org.jboss.as.metadata.*
+org.jboss.as.plugins.*
+org.jboss.bom.*
+org.jboss.bom.brms.*
+org.jboss.bom.eap.*
+org.jboss.bom.jdg.*
+org.jboss.bom.wfk.*
+org.jboss.bridger.*
+org.jboss.byteman.*
+org.jboss.cdi.tck.*
+org.jboss.cl.*
+org.jboss.classfilewriter.*
+org.jboss.common.*
+org.jboss.da.*
+org.jboss.deployers.*
+org.jboss.developer.*
+org.jboss.eap.additional.testsuite.*
+org.jboss.ejb3.*
+org.jboss.elemento.*
+org.jboss.envers.*
+org.jboss.errai.*
+org.jboss.errai.archetypes.*
+org.jboss.errai.bom.*
+org.jboss.errai.demos.*
+org.jboss.errai.forge.*
+org.jboss.errai.io.netty.*
+org.jboss.errai.reflections.*
+org.jboss.forge.*
+org.jboss.forge.addon.*
+org.jboss.forge.descriptors.*
+org.jboss.forge.furnace.*
+org.jboss.forge.furnace.container.*
+org.jboss.forge.furnace.test.*
+org.jboss.forge.roaster.*
+org.jboss.forge.test.*
+org.jboss.fuse.forge.addon.*
+org.jboss.galleon.*
+org.jboss.galleon.universe.*
+org.jboss.gm.*
+org.jboss.gm.analyzer.*
+org.jboss.gm.manipulation.*
+org.jboss.gwt.elemento.*
+org.jboss.hal.*
+org.jboss.hawt.app.*
+org.jboss.integration-platform.*
+org.jboss.integration.*
+org.jboss.integration.fuse.*
+org.jboss.interceptor.*
+org.jboss.invocation.*
+org.jboss.ironjacamar.*
+org.jboss.ironjacamar.jdk8.*
+org.jboss.jandex.*
+org.jboss.javaee.*
+org.jboss.jbossas.*
+org.jboss.jbossas.as7-cdi-tck.*
+org.jboss.jbossas.embedded.examples.*
+org.jboss.jbossas.osgi.*
+org.jboss.jbossas.snmp.*
+org.jboss.jbossts.*
+org.jboss.jbossts.arjunacore.*
+org.jboss.jbossts.jta.*
+org.jboss.jbossts.jts.*
+org.jboss.jbossts.rts.*
+org.jboss.jbossts.xts.*
+org.jboss.jdeparser.*
+org.jboss.jdf.*
+org.jboss.jdocbook.*
+org.jboss.jsr299.tck.*
+org.jboss.logging.*
+org.jboss.logmanager.*
+org.jboss.man.*
+org.jboss.marshalling.*
+org.jboss.maven.archetypes.*
+org.jboss.maven.extension.dependency.*
+org.jboss.maven.plugins.*
+org.jboss.maven.plugins.enforcer.rules.*
+org.jboss.maven.plugins.jbossas.*
+org.jboss.maven.skins.*
+org.jboss.maven.surefire.modular.*
+org.jboss.maven.util.*
+org.jboss.metadata.*
+org.jboss.metrics.*
+org.jboss.microcontainer.*
+org.jboss.microcontainer.docs.*
+org.jboss.module-info.*
+org.jboss.modules.*
+org.jboss.msc.*
+org.jboss.narayana.*
+org.jboss.narayana.arjunacore.*
+org.jboss.narayana.blacktie.*
+org.jboss.narayana.blacktie.plugins.*
+org.jboss.narayana.compensations.*
+org.jboss.narayana.jta.*
+org.jboss.narayana.jts.*
+org.jboss.narayana.osgi.*
+org.jboss.narayana.rts.*
+org.jboss.narayana.stm.*
+org.jboss.narayana.tomcat.*
+org.jboss.narayana.txframework.*
+org.jboss.narayana.vertx.*
+org.jboss.narayana.xts.*
+org.jboss.netty.*
+org.jboss.openjdk-orb.*
+org.jboss.pnc.*
+org.jboss.pnc.bacon.*
+org.jboss.pnc.bifrost.*
+org.jboss.pnc.bpm.workitems.*
+org.jboss.pnc.build-agent.*
+org.jboss.pnc.build.finder.*
+org.jboss.pnc.causeway.*
+org.jboss.pnc.cleaner.*
+org.jboss.pnc.deliverablesanalyzer.*
+org.jboss.pnc.kafkastore.*
+org.jboss.pnc.logging.*
+org.jboss.pnc.logprocessor.*
+org.jboss.pnc.metrics.*
+org.jboss.pnc.project-manipulator.*
+org.jboss.portletbridge.*
+org.jboss.portletbridge.archetypes.*
+org.jboss.portletbridge.testing.pluto.*
+org.jboss.pressgang.*
+org.jboss.pressgang.ccms.*
+org.jboss.pressgang.ccms.contentspec.*
+org.jboss.pressgang.ccms.services.*
+org.jboss.reddeer.*
+org.jboss.remoting.*
+org.jboss.remoting3.*
+org.jboss.remotingjmx.*
+org.jboss.resteasy.*
+org.jboss.resteasy.cache.*
+org.jboss.resteasy.checkstyle.*
+org.jboss.resteasy.example.*
+org.jboss.resteasy.example.oauth.*
+org.jboss.resteasy.microprofile.*
+org.jboss.resteasy.mobile.*
+org.jboss.resteasy.spring.*
+org.jboss.resteasy.test.*
+org.jboss.sasl.*
+org.jboss.seam.*
+org.jboss.seam.conversation.*
+org.jboss.seam.faces.*
+org.jboss.seam.international.*
+org.jboss.seam.jms.*
+org.jboss.seam.remoting.*
+org.jboss.seam.xml.*
+org.jboss.seven2six.*
+org.jboss.shrinkwrap.*
+org.jboss.shrinkwrap.container.*
+org.jboss.shrinkwrap.descriptors.*
+org.jboss.shrinkwrap.osgi.*
+org.jboss.shrinkwrap.resolver.*
+org.jboss.shrinkwrap.sip.*
+org.jboss.shrinkwrap.vfs3.*
+org.jboss.slf4j.*
+org.jboss.snowdrop.*
+org.jboss.solder.*
+org.jboss.spec.*
+org.jboss.spec.archetypes.*
+org.jboss.spec.jakarta.el.*
+org.jboss.spec.jakarta.xml.soap.*
+org.jboss.spec.jakarta.xml.ws.*
+org.jboss.spec.javax.annotation.*
+org.jboss.spec.javax.batch.*
+org.jboss.spec.javax.ejb.*
+org.jboss.spec.javax.el.*
+org.jboss.spec.javax.enterprise.concurrent.*
+org.jboss.spec.javax.enterprise.deploy.*
+org.jboss.spec.javax.faces.*
+org.jboss.spec.javax.interceptor.*
+org.jboss.spec.javax.jms.*
+org.jboss.spec.javax.json.*
+org.jboss.spec.javax.management.j2ee.*
+org.jboss.spec.javax.net.ssl.*
+org.jboss.spec.javax.resource.*
+org.jboss.spec.javax.rmi.*
+org.jboss.spec.javax.security.auth.message.*
+org.jboss.spec.javax.security.jacc.*
+org.jboss.spec.javax.servlet.*
+org.jboss.spec.javax.servlet.jsp.*
+org.jboss.spec.javax.servlet.jstl.*
+org.jboss.spec.javax.sql.*
+org.jboss.spec.javax.transaction.*
+org.jboss.spec.javax.websocket.*
+org.jboss.spec.javax.ws.rs.*
+org.jboss.spec.javax.xml.bind.*
+org.jboss.spec.javax.xml.registry.*
+org.jboss.spec.javax.xml.rpc.*
+org.jboss.spec.javax.xml.soap.*
+org.jboss.spec.javax.xml.ws.*
+org.jboss.spring.archetypes.*
+org.jboss.stdio.*
+org.jboss.tattletale.*
+org.jboss.test-audit.*
+org.jboss.test.*
+org.jboss.test.richfaces-selenium.*
+org.jboss.test.richfaces-selenium.library.*
+org.jboss.threads.*
+org.jboss.universe.*
+org.jboss.universe.producer.*
+org.jboss.webbeans.*
+org.jboss.weld.*
+org.jboss.weld.archetypes.*
+org.jboss.weld.arquillian.container.*
+org.jboss.weld.environment.*
+org.jboss.weld.examples.*
+org.jboss.weld.examples.jsf.*
+org.jboss.weld.examples.jsf.pastecode.*
+org.jboss.weld.examples.jsf.translator.*
+org.jboss.weld.examples.se.*
+org.jboss.weld.module.*
+org.jboss.weld.osgi.*
+org.jboss.weld.osgi.docs.*
+org.jboss.weld.osgi.examples.*
+org.jboss.weld.osgi.examples.userdoc.*
+org.jboss.weld.osgi.tests.*
+org.jboss.weld.probe.*
+org.jboss.weld.reference-guide.*
+org.jboss.weld.se.*
+org.jboss.weld.servlet.*
+org.jboss.weld.vertx.*
+org.jboss.weld.vertx.examples.*
+org.jboss.windup.*
+org.jboss.windup.addon.*
+org.jboss.windup.ast.*
+org.jboss.windup.config.*
+org.jboss.windup.decompiler.*
+org.jboss.windup.decompiler.fernflower.*
+org.jboss.windup.decompiler.procyon.*
+org.jboss.windup.engine.*
+org.jboss.windup.exec.*
+org.jboss.windup.ext.*
+org.jboss.windup.graph.*
+org.jboss.windup.graph.frames.*
+org.jboss.windup.jdt.*
+org.jboss.windup.legacy.*
+org.jboss.windup.legacy.application.*
+org.jboss.windup.maven.*
+org.jboss.windup.org.apache.maven.indexer.*
+org.jboss.windup.plugin.*
+org.jboss.windup.reporting.*
+org.jboss.windup.rexster.*
+org.jboss.windup.rules.*
+org.jboss.windup.rules.apps.*
+org.jboss.windup.tests.*
+org.jboss.windup.ui.*
+org.jboss.windup.utils.*
+org.jboss.windup.web.*
+org.jboss.windup.web.addons.*
+org.jboss.windup.web.plugin.*
+org.jboss.windup.web.ui.*
+org.jboss.wise.*
+org.jboss.ws.*
+org.jboss.ws.cxf.*
+org.jboss.ws.metro.*
+org.jboss.ws.native.*
+org.jboss.ws.plugins.*
+org.jboss.ws.plugins.archetypes.*
+org.jboss.ws.projects.*
+org.jboss.xnio.*
+org.jboss.xnio.netty.*
+org.jbox2d.*
+org.jbpm.*
+org.jbpm.contrib.*
+org.jbpm.dashboard.*
+org.jbpm.jbpm5.*
+org.jbpm.spec.*
+org.jbpt.*
+org.jbrew.*
+org.jbrew.cbrew.*
+org.jbrew.core.*
+org.jbrew.native.*
+org.jbundle.*
+org.jbundle.app.contact.*
+org.jbundle.app.dance.*
+org.jbundle.app.office.*
+org.jbundle.app.picture.*
+org.jbundle.app.program.*
+org.jbundle.app.test.*
+org.jbundle.app.tools.*
+org.jbundle.base.*
+org.jbundle.base.db.*
+org.jbundle.base.message.*
+org.jbundle.base.screen.*
+org.jbundle.config.*
+org.jbundle.config.dep.*
+org.jbundle.config.repo.*
+org.jbundle.config.web.*
+org.jbundle.javafx.config.*
+org.jbundle.javafx.example.*
+org.jbundle.main.*
+org.jbundle.model.*
+org.jbundle.res.*
+org.jbundle.thin.*
+org.jbundle.thin.app.*
+org.jbundle.thin.base.*
+org.jbundle.thin.base.db.*
+org.jbundle.thin.base.screen.*
+org.jbundle.thin.main.*
+org.jbundle.thin.opt.*
+org.jbundle.util.*
+org.jbundle.util.backup.*
+org.jbundle.util.biorhythm.*
+org.jbundle.util.calendarpanel.*
+org.jbundle.util.jcalendarbutton.*
+org.jbundle.util.osgi.*
+org.jbundle.util.osgi.wrapped.*
+org.jbundle.util.other.*
+org.jbundle.util.webapp.*
+org.jbundle.util.wsdl.*
+org.jclarion.*
+org.jclasslib.*
+org.jclouds.*
+org.jclouds.api.*
+org.jclouds.chef.*
+org.jclouds.cli.*
+org.jclouds.common.*
+org.jclouds.driver.*
+org.jclouds.karaf.*
+org.jclouds.karaf.chef.*
+org.jclouds.labs.*
+org.jclouds.provider.*
+org.jcodec.*
+org.jcoderz.fawkez.*
+org.jcoffee.*
+org.jcommander.*
+org.jcommon.*
+org.jcommons.*
+org.jconfig.*
+org.jcors.*
+org.jcraft.*
+org.jcrom.*
+org.jctools.*
+org.jcuda.*
+org.jcvi.jillion.*
+org.jdal.*
+org.jdatepicker.*
+org.jdbcdslog.*
+org.jdbdt.*
+org.jdbi.*
+org.jdbi.internal.*
+org.jdbi.jackson-contrib.*
+org.jdbi.v2.*
+org.jddd.*
+org.jdeferred.*
+org.jdeferred.v2.*
+org.jdesktop.*
+org.jdesktop.bsaf.*
+org.jdesktop.swingx.*
+org.jdice.*
+org.jdice.calc.*
+org.jdiscript.*
+org.jdklog.*
+org.jdmp.*
+org.jdom.*
+org.jdon.*
+org.jdrupes.*
+org.jdrupes.httpcodec.*
+org.jdrupes.json.*
+org.jdrupes.mdoclet.*
+org.jdrupes.taglets.*
+org.jdtaus.*
+org.jdtaus.banking.*
+org.jdtaus.banking.dtaus.*
+org.jdtaus.common.*
+org.jdtaus.core.*
+org.jdtaus.core.container.*
+org.jdtaus.core.lang.*
+org.jdtaus.core.logging.*
+org.jdtaus.core.monitor.*
+org.jdtaus.core.sax.*
+org.jdtaus.core.text.*
+org.jdtaus.correspondents.*
+org.jdtaus.editor.*
+org.jdtaus.icons.*
+org.jdtaus.maven.skins.*
+org.jdtaus.mojo.*
+org.jdtaus.sequences.*
+org.jdto.*
+org.jeasy.*
+org.jeecf.*
+org.jeecg.*
+org.jeecgframework.*
+org.jeecgframework.archetype.*
+org.jeecgframework.boot.*
+org.jeecgframework.cloud.*
+org.jeecgframework.jimureport.*
+org.jeecgframework.nacos.*
+org.jeecqrs.*
+org.jeeplus.*
+org.jeesl.*
+org.jeesl.bom.*
+org.jeesy.*
+org.jeeventstore.*
+org.jekh.appenders.*
+org.jellyfin.exoplayer.*
+org.jellyfin.sdk.*
+org.jempbox.*
+org.jencks.*
+org.jenkins-ci.*
+org.jensoft.*
+org.jentity.*
+org.jepub.*
+org.jerkar.*
+org.jerkar.plugins.*
+org.jeromq.*
+org.jesperancinha.console.*
+org.jesperancinha.itf.*
+org.jesperancinha.parser.*
+org.jesperancinha.plugins.*
+org.jesperancinha.plugins.omni.*
+org.jessma.*
+org.jesterj.*
+org.jetbrains.*
+org.jetbrains.bio.*
+org.jetbrains.bsp.*
+org.jetbrains.compose.*
+org.jetbrains.compose.animation.*
+org.jetbrains.compose.compiler.*
+org.jetbrains.compose.components.*
+org.jetbrains.compose.desktop.*
+org.jetbrains.compose.foundation.*
+org.jetbrains.compose.html.*
+org.jetbrains.compose.material.*
+org.jetbrains.compose.material3.*
+org.jetbrains.compose.runtime.*
+org.jetbrains.compose.ui.*
+org.jetbrains.compose.web.*
+org.jetbrains.dokka.*
+org.jetbrains.exposed.*
+org.jetbrains.intellij.*
+org.jetbrains.intellij.deps.*
+org.jetbrains.intellij.plugins.*
+org.jetbrains.kotlin-wrappers.*
+org.jetbrains.kotlin.*
+org.jetbrains.kotlin.android.*
+org.jetbrains.kotlin.android.extensions.*
+org.jetbrains.kotlin.js.*
+org.jetbrains.kotlin.jvm.*
+org.jetbrains.kotlin.kapt.*
+org.jetbrains.kotlin.multiplatform.*
+org.jetbrains.kotlin.multiplatform.pm20.*
+org.jetbrains.kotlin.native.cocoapods.*
+org.jetbrains.kotlin.plugin.allopen.*
+org.jetbrains.kotlin.plugin.assignment.*
+org.jetbrains.kotlin.plugin.atomicfu.*
+org.jetbrains.kotlin.plugin.jpa.*
+org.jetbrains.kotlin.plugin.lombok.*
+org.jetbrains.kotlin.plugin.noarg.*
+org.jetbrains.kotlin.plugin.parcelize.*
+org.jetbrains.kotlin.plugin.sam.with.receiver.*
+org.jetbrains.kotlin.plugin.scripting.*
+org.jetbrains.kotlin.plugin.serialization.*
+org.jetbrains.kotlin.plugin.spring.*
+org.jetbrains.kotlinx.*
+org.jetbrains.kotlinx.binary-compatibility-validator.*
+org.jetbrains.kotlinx.dataframe.*
+org.jetbrains.kotlinx.knit.*
+org.jetbrains.kotlinx.kover.*
+org.jetbrains.kotlinx.spark.*
+org.jetbrains.lets-plot.*
+org.jetbrains.pty4j.*
+org.jetbrains.scala.*
+org.jetbrains.skiko.*
+org.jetbrains.spek.*
+org.jetbrains.trove4j.*
+org.jetbrains.xodus.*
+org.jetlang.*
+org.jetlinks.*
+org.jetrs.*
+org.jets3t.*
+org.jeuron.*
+org.jeyzer.*
+org.jeyzer.build.*
+org.jfairy.*
+org.jfarcand.*
+org.jfaster.*
+org.jfaster.derror.*
+org.jfaster.eagle.*
+org.jflac.*
+org.jfleet.*
+org.jflux.*
+org.jframework.*
+org.jfree.*
+org.jfrog.aether.*
+org.jfrog.artifactory.client.*
+org.jfrog.buildinfo.*
+org.jfrog.filespecs.*
+org.jfrog.maven.annomojo.*
+org.jfxcore.*
+org.jfxcore.gradle-plugin.*
+org.jfxtras.*
+org.jfxvnc.*
+org.jglobus.*
+org.jglue.cdi-unit.*
+org.jglue.fluent-json.*
+org.jglue.totorom.*
+org.jgotesting.*
+org.jgrapes.*
+org.jgrapht.*
+org.jgrapht.archetypes.*
+org.jgrasstools.*
+org.jgroups.*
+org.jgroups.aws.*
+org.jgroups.aws.s3.*
+org.jgroups.azure.*
+org.jgroups.google.*
+org.jgroups.kubernetes.*
+org.jgroups.quarkus.extension.*
+org.jgroups.rolling-upgrades.*
+org.jhades.*
+org.jhardware.*
+org.jharks.*
+org.jheaps.*
+org.jibx.*
+org.jibx.config.*
+org.jibx.config.3rdparty.org.eclipse.*
+org.jibx.config.osgi.wrapped.*
+org.jibx.config.repo.*
+org.jibx.ota.osgi.*
+org.jibx.schema.config.*
+org.jibx.schema.net.java.*
+org.jibx.schema.net.webservicex.*
+org.jibx.schema.org.apache.maven.*
+org.jibx.schema.org.docbook.*
+org.jibx.schema.org.hr_xml.*
+org.jibx.schema.org.hr_xml.ns.*
+org.jibx.schema.org.jibx.*
+org.jibx.schema.org.jibx.test.*
+org.jibx.schema.org.oasis_open.*
+org.jibx.schema.org.opentravel.*
+org.jibx.schema.org.opentravel._2010B.*
+org.jibx.schema.org.opentravel._2011A.*
+org.jibx.schema.org.opentravel._2011A.test.*
+org.jibx.schema.org.opentravel._2011B.*
+org.jibx.schema.org.opentravel._2011B.test.*
+org.jibx.schema.org.opentravel._2011B.ws.*
+org.jibx.schema.org.opentravel._2012A.*
+org.jibx.schema.org.opentravel._2012A.test.*
+org.jibx.schema.org.opentravel._2012A.ws.*
+org.jibx.schema.org.opentravel._2012B.*
+org.jibx.schema.org.opentravel._2012B.test.*
+org.jibx.schema.org.opentravel._2012B.ws.*
+org.jibx.schema.org.opentravel._2013A.*
+org.jibx.schema.org.opentravel._2013A.test.*
+org.jibx.schema.org.opentravel._2013A.ws.*
+org.jibx.schema.org.opentravel._2013B.*
+org.jibx.schema.org.opentravel._2013B.test.*
+org.jibx.schema.org.opentravel._2013B.ws.*
+org.jibx.schema.org.opentravel._2014A.*
+org.jibx.schema.org.opentravel._2014A.test.*
+org.jibx.schema.org.opentravel._2014A.ws.*
+org.jibx.schema.org.opentravel._2014B.*
+org.jibx.schema.org.opentravel._2014B.test.*
+org.jibx.schema.org.opentravel._2014B.ws.*
+org.jibx.schema.org.opentravel.example.jbundle.*
+org.jibx.schema.org.opentravel.ws.*
+org.jibx.schema.org.opentravel.x2014B.*
+org.jibx.schema.org.opentravel.x2014B.test.*
+org.jibx.schema.org.opentravel.x2014B.ws.*
+org.jibx.schema.org.w3.*
+org.jibx.schema.org.xmlsoap.schemas.*
+org.jibx.schema.ws.*
+org.jibx.test.examples.*
+org.jicunit.*
+org.jimmutable.*
+org.jimsey.projects.camel.components.*
+org.jini.maven-jini-plugin.*
+org.jinq.*
+org.jinterop.*
+org.jire.*
+org.jire.arrowhead.*
+org.jire.kotmem.*
+org.jire.kton.*
+org.jire.strukt.*
+org.jiris.*
+org.jisel.*
+org.jitr.*
+org.jitsi.*
+org.jiucai.*
+org.jiucheng.*
+org.jiuwo.*
+org.jkee.gtree.*
+org.jkube.*
+org.jkva.maven-plugins.*
+org.jlab.*
+org.jlab.cat.*
+org.jlato.*
+org.jledit.*
+org.jleopard.*
+org.jlib.*
+org.jlibrary.*
+org.jlibsedml.*
+org.jline.*
+org.jliszka.*
+org.jlot.*
+org.jmanikin.*
+org.jmathml.*
+org.jmdns.*
+org.jmdware.*
+org.jmeld.*
+org.jmesa.*
+org.jmetrix.*
+org.jminix.*
+org.jmisb.*
+org.jmite.*
+org.jmmo.*
+org.jmock.*
+org.jmockit.*
+org.jmockring.*
+org.jmolecules.*
+org.jmolecules.integrations.*
+org.jmonit.*
+org.jmonkeyengine.*
+org.jmotor.*
+org.jmotor.artifact.*
+org.jmotor.metral.*
+org.jmotor.tools.*
+org.jmrtd.*
+org.jmxtrans.*
+org.jmxtrans.agent.*
+org.jmxtrans.embedded.*
+org.jmxtrans.embedded.samples.*
+org.jnario.*
+org.jnosql.*
+org.jnosql.artemis.*
+org.jnosql.diana.*
+org.jnosql.query.*
+org.jobrunr.*
+org.jocl.*
+org.joda.*
+org.joda.external.*
+org.jodah.*
+org.jodconverter.*
+org.jodd.*
+org.jodreports.*
+org.jodreports.poms.*
+org.joeyb.*
+org.joeyb.retry.*
+org.joeyb.undercarriage.*
+org.jogamp.gluegen.*
+org.jogamp.joal.*
+org.jogamp.jocl.*
+org.jogamp.jogl.*
+org.jogamp.libgdx.*
+org.john-tipper.gradle.*
+org.johnnei.*
+org.johnnei.parent.*
+org.joinedworkz.*
+org.joinedworkz.cmn.*
+org.joinedworkz.core.*
+org.joinedworkz.facilities.*
+org.joinedworkz.profile.*
+org.joinedworkz.utilities.*
+org.joinfaces.*
+org.joinfaces.classpath-scan.*
+org.joinfaces.dependency-management.*
+org.jolie-lang.*
+org.jolokia.*
+org.jolokia.extra.*
+org.jomc.*
+org.jomc.build.*
+org.jomc.logging.*
+org.jomc.sdk.*
+org.jomc.sequences.*
+org.jomc.standalone.*
+org.joml.*
+org.jomni.*
+org.jongo.*
+org.jooby.*
+org.jooq.*
+org.jopendocument.*
+org.jorigin.*
+org.jorm-unit.*
+org.jostraca.*
+org.joty.*
+org.joyqueue.*
+org.joyrest.*
+org.jparsec.*
+org.jparsercombinator.*
+org.jpasecurity.*
+org.jpatterns.*
+org.jpedal.*
+org.jpeek.*
+org.jpmml.*
+org.jpos.*
+org.jppf.*
+org.jprocesses.*
+org.jproggy.*
+org.jpyconsortium.*
+org.jqassistant.contrib.common.*
+org.jqassistant.contrib.plugin.*
+org.jqassistant.contrib.sonarqube.*
+org.jqassistant.plugin.*
+org.jqassistant.tooling.asciidoctorj.*
+org.jqassistant.tooling.common.*
+org.jqassistant.tooling.sonarqube.*
+org.jquants.*
+org.jraf.*
+org.jrebirth.*
+org.jrebirth.af.*
+org.jrebirth.af.iconfont-bridge.*
+org.jrebirth.af.showcase.*
+org.jrebirth.af.tooling.*
+org.jreleaser.*
+org.jreleaser.extensions.*
+org.jreliability.*
+org.jresearch.*
+org.jresearch.commons.base.*
+org.jresearch.commons.base.manager.*
+org.jresearch.commons.base.resources.*
+org.jresearch.commons.gwt.*
+org.jresearch.commons.gwt.base.*
+org.jresearch.commons.gwt.gwt2go.*
+org.jresearch.commons.gwt.mdIcon.*
+org.jresearch.commons.gxt.admin.*
+org.jresearch.commons.gxt.calendar.*
+org.jresearch.commons.gxt.crud.*
+org.jresearch.commons.gxt.gwt.*
+org.jresearch.dominokit.*
+org.jresearch.dominokit.jackson.*
+org.jresearch.flexess.*
+org.jresearch.flexess.client.*
+org.jresearch.flexess.core.*
+org.jresearch.flexess.models.*
+org.jresearch.flexess.resources.*
+org.jresearch.flexess.test.*
+org.jresearch.flexess.umi.*
+org.jresearch.gavka.*
+org.jresearch.gwt.locale.*
+org.jresearch.gwt.momentjs.*
+org.jresearch.gwt.time.*
+org.jresearch.gwt.time.jackson.*
+org.jresearch.gwt.tool.emu.apt.*
+org.jresearch.gwt.webprnt.*
+org.jresearch.gwtproject.*
+org.jresearch.gwtproject.core.*
+org.jresearch.gwtproject.event.*
+org.jresearch.gwtproject.i18n.*
+org.jresearch.gwtproject.nio.*
+org.jresearch.gwtproject.safehtml.*
+org.jresearch.gwtproject.timer.*
+org.jresearch.gwtproject.xhr.*
+org.jresearch.hamcrest.beanMatcher.*
+org.jresearch.locale.languageTag.*
+org.jresearch.logui.*
+org.jresearch.orika.*
+org.jretrofit.*
+org.jrivard.xmlchai.*
+org.jrj-d.*
+org.jrobin.*
+org.jruby.*
+org.jruby.embed.*
+org.jruby.ext.posix.*
+org.jruby.extras.*
+org.jruby.jcodings.*
+org.jruby.joni.*
+org.jruby.mains.*
+org.jruby.maven.*
+org.jruby.plugins.*
+org.jruby.rack.*
+org.jruby.util.*
+org.jruby.warbler.*
+org.js-labs.*
+org.jscala.*
+org.jscience.*
+org.jscsi.*
+org.jsdoctoolkit.*
+org.jsecurity.*
+org.jsefa.*
+org.jsense.*
+org.jsimpledb.*
+org.jsimplelib.*
+org.jslipc.*
+org.jsmart.*
+org.jsmart.simulator.*
+org.jsmiparser.*
+org.jsmpp.*
+org.jsoftware.*
+org.jsoftware.dbpatch.*
+org.json.*
+org.json4s.*
+org.json4sbt.*
+org.jsonbuddy.*
+org.jsonddl.*
+org.jsondoc.*
+org.jsondoc.sample.*
+org.jsonex.*
+org.jsonhoist.*
+org.jsonschema2pojo.*
+org.jsonurl.*
+org.jsonx.*
+org.jsonx.sample.*
+org.jsoup.*
+org.jspare.*
+org.jspare.jpa.*
+org.jspare.vertx.*
+org.jspare.vertx.jpa.*
+org.jspare.vertx.ldap.*
+org.jspecify.*
+org.jspringbot.*
+org.jsqrl.*
+org.jsr107.ri.*
+org.jsslutils.*
+org.jstryker.*
+org.jsweet.*
+org.jszip.*
+org.jszip.gems.*
+org.jszip.jruby.*
+org.jszip.maven.*
+org.jszip.redist.*
+org.jtb.*
+org.jtemplate.*
+org.jtestr.*
+org.jtilia.commons.*
+org.jtransfo.*
+org.jtrfp.*
+org.jtrim2.*
+org.jtwig.*
+org.jugs.webdav.*
+org.juhewu.*
+org.juiser.*
+org.jukito.*
+org.julianmichael.*
+org.julienrf.*
+org.jumpmind.symmetric.*
+org.jumpmind.symmetric.jdbc.*
+org.jumpmind.symmetric.schemaspy.*
+org.junit-pioneer.*
+org.junit.*
+org.junit.contrib.*
+org.junit.jupiter.*
+org.junit.platform.*
+org.junit.support.*
+org.junit.vintage.*
+org.junithelper.*
+org.juniversal.*
+org.jupiter-rpc.*
+org.jupnp.*
+org.jupnp.pom.*
+org.jupyter-scala.*
+org.jupyter.*
+org.jurr.jsch.*
+org.jurr.liquibase.*
+org.jurr.pipetableformatter.*
+org.jusecase.*
+org.juzu.*
+org.jvault.*
+org.jvending.registry.*
+org.jvirtanen.config.*
+org.jvirtanen.juncture.*
+org.jvirtanen.lang.*
+org.jvirtanen.nassau.*
+org.jvirtanen.nio.*
+org.jvirtanen.parity.*
+org.jvirtanen.philadelphia.*
+org.jvirtanen.util.*
+org.jvirtanen.value.*
+org.jvnet.*
+org.jvnet.animal-sniffer.*
+org.jvnet.annotation-mock-builder.*
+org.jvnet.annox.*
+org.jvnet.com4j.*
+org.jvnet.com4j.typelibs.*
+org.jvnet.ec2-sshd.*
+org.jvnet.fix1600.*
+org.jvnet.hifaces.*
+org.jvnet.hudson.*
+org.jvnet.hudson.dom4j.*
+org.jvnet.hudson.dtkit.*
+org.jvnet.hudson.hadoop.*
+org.jvnet.hudson.jackson.*
+org.jvnet.hudson.main.*
+org.jvnet.hudson.plugins.*
+org.jvnet.hudson.plugins.findbugs.*
+org.jvnet.hudson.plugins.fortify360.*
+org.jvnet.hudson.plugins.hudsontrayapp.*
+org.jvnet.hudson.plugins.lavalamp.*
+org.jvnet.hudson.plugins.m2release.*
+org.jvnet.hudson.plugins.mercurial.*
+org.jvnet.hudson.plugins.vss.*
+org.jvnet.hudson.pxeboot.*
+org.jvnet.hudson.svnkit.*
+org.jvnet.hudson.tools.*
+org.jvnet.hudson.winstone.*
+org.jvnet.hypercompass.*
+org.jvnet.hyperjaxb2.*
+org.jvnet.hyperjaxb2.maven2.*
+org.jvnet.hyperjaxb3.*
+org.jvnet.its.*
+org.jvnet.jax-ws-commons.*
+org.jvnet.jax-ws-commons.spring.*
+org.jvnet.jax_ws_commons.*
+org.jvnet.jaxb.*
+org.jvnet.jaxb.reflection.*
+org.jvnet.jaxb1.maven2.*
+org.jvnet.jaxb2-commons.*
+org.jvnet.jaxb2.maven2.*
+org.jvnet.jaxb2_commons.*
+org.jvnet.jaxbcommons.*
+org.jvnet.jaxbhelp.*
+org.jvnet.jaxbhelp.maven2.*
+org.jvnet.jaxbvalidation.*
+org.jvnet.libpam4j.*
+org.jvnet.libzfs.*
+org.jvnet.localizer.*
+org.jvnet.maven-antrun-extended-plugin.*
+org.jvnet.maven-javanet-skin.*
+org.jvnet.maven-jellydoc-plugin.*
+org.jvnet.maven.incrementalbuild.*
+org.jvnet.mcvp.*
+org.jvnet.mimepull.*
+org.jvnet.mock-javamail.*
+org.jvnet.ogc.*
+org.jvnet.opendmk.*
+org.jvnet.poormans-installer.*
+org.jvnet.robust-http-client.*
+org.jvnet.sorcerer.*
+org.jvnet.staxex.*
+org.jvnet.transcoder.*
+org.jvnet.updatecenter2.*
+org.jvnet.wagon-svn.*
+org.jvnet.winp.*
+org.jvnet.ws.wadl.*
+org.jvoicexml.*
+org.jwall.*
+org.jwat.*
+org.jxls.*
+org.jxmapviewer.*
+org.jxmpp.*
+org.jxta.platform.*
+org.jyaml.*
+org.jzenith.*
+org.jzkit.*
+org.kaazing.*
+org.kaazing.mojo.signature.*
+org.kaerdan.*
+org.kafkacrypto.*
+org.kafkaless.*
+org.kairosdb.*
+org.kairosdb.metrics4jplugin.*
+org.kaleidofoundry.*
+org.kaliy.kafka.*
+org.kaloz.gatling.*
+org.kaloz.pi4j.client.*
+org.kametic.*
+org.kamranzafar.*
+org.kamranzafar.cas.client.*
+org.kamranzafar.commons.*
+org.kamranzafar.spring.wpapi.*
+org.kangspace.devhelper.*
+org.kangspace.wechat.*
+org.kangspace.wechat.helper.*
+org.kanomchan.*
+org.kanomchan.struts.*
+org.kantega.htmltopdf.*
+org.kantega.jexmec.*
+org.kantega.respiro.*
+org.kantega.reststop.*
+org.karora.*
+org.kasource.*
+org.kasource.commons.*
+org.kasource.kaevent.*
+org.kasource.kajmx.*
+org.kasource.kaplugin.*
+org.kasource.kaspring.*
+org.kasource.websocket.*
+org.kathra.*
+org.kathrynhuxtable.maven.plugins.*
+org.kathrynhuxtable.maven.skins.*
+org.kathrynhuxtable.maven.wagon.*
+org.kaveh.commons.*
+org.kde.brooklyn.*
+org.kebish.*
+org.keeber.*
+org.keedio.*
+org.keedio.azure.*
+org.keedio.commons.*
+org.keedio.flume.flume-ng-sources.*
+org.keedio.flume.interceptor.enrichment.*
+org.keedio.flume.sink.hbase.*
+org.keedio.flume.sources.*
+org.keedio.kafka.serializers.*
+org.keedio.openx.data.*
+org.keedio.storm.bolt.filter.*
+org.keedio.storm.bolt.tcp.*
+org.keedio.storm.topology.maven.*
+org.kefirsf.*
+org.keijack.*
+org.kernelab.*
+org.kevoree.*
+org.kevoree.corelibrary.*
+org.kevoree.corelibrary.android.*
+org.kevoree.corelibrary.arduino.*
+org.kevoree.corelibrary.javase.*
+org.kevoree.corelibrary.sample.*
+org.kevoree.corelibrary.sky.*
+org.kevoree.extra.*
+org.kevoree.kcl.*
+org.kevoree.kmf.*
+org.kevoree.library.*
+org.kevoree.library.cloud.*
+org.kevoree.library.java.*
+org.kevoree.log.*
+org.kevoree.maven.*
+org.kevoree.maventools.*
+org.kevoree.modeling.*
+org.kevoree.modeling.idea.*
+org.kevoree.modeling.j2ts.*
+org.kevoree.modeling.plugin.*
+org.kevoree.mwg.*
+org.kevoree.mwg.plugins.*
+org.kevoree.platform.*
+org.kevoree.root.*
+org.kevoree.tools.*
+org.kevoree.watchdog.*
+org.kew.rmf.*
+org.key-project.*
+org.keycloak.*
+org.keycloak.bom.*
+org.keycloak.example.demo.*
+org.keycloak.secretstore.*
+org.keycloak.subsystem.*
+org.keycloak.testsuite.*
+org.keymg.*
+org.kframework.kale.*
+org.kgrid.*
+org.kgusarov.*
+org.khronos.*
+org.khronos.openxr.*
+org.kie.*
+org.kie.commons.*
+org.kie.guvnor.*
+org.kie.kogito.*
+org.kie.kogito.examples.*
+org.kie.modules.*
+org.kie.remote.*
+org.kie.remote.ws.*
+org.kie.server.*
+org.kie.smoke.*
+org.kie.soup.*
+org.kie.uberfire.*
+org.kie.workbench.*
+org.kie.workbench.forms.*
+org.kie.workbench.playground.*
+org.kie.workbench.profile.*
+org.kie.workbench.screens.*
+org.kie.workbench.services.*
+org.kie.workbench.stunner.*
+org.kie.workbench.widgets.*
+org.kielo.annotationscanner.*
+org.kielo.smartcache.*
+org.kiirun.*
+org.kikini.*
+org.kill-bill.billing.*
+org.kill-bill.billing.installer.*
+org.kill-bill.billing.kaui.*
+org.kill-bill.billing.plugin.*
+org.kill-bill.billing.plugin.java.*
+org.kill-bill.billing.plugin.java.catalog.*
+org.kill-bill.billing.plugin.ruby.*
+org.kill-bill.commons.*
+org.kill-bill.testing.*
+org.kin.agora.gen.*
+org.kin.sdk.android.*
+org.kink-lang.*
+org.kinotic.*
+org.kitchen-eel.*
+org.kite9.*
+org.kitei.*
+org.kitei.internal.*
+org.kitei.testing.*
+org.kitesdk.*
+org.kitteh.*
+org.kitteh.irc.*
+org.kivio.*
+org.kiwiproject.*
+org.kiwitcms.java.*
+org.kiwix.*
+org.kiwix.kiwixlib.*
+org.kiwix.libkiwix.*
+org.kjkoster.*
+org.kloeckner.maven.plugin.*
+org.klojang.*
+org.klout4j.*
+org.knallgrau.utils.*
+org.knowhowlab.comm.*
+org.knowhowlab.maven.plugins.*
+org.knowhowlab.osgi.*
+org.knowhowlab.osgi.shell.*
+org.knowhowlab.osgi.testing.*
+org.knowhowlab.osgi.testing.it.*
+org.knowm.*
+org.knowm.datasets.*
+org.knowm.konfig.*
+org.knowm.proprioceptron.*
+org.knowm.xchange.*
+org.knowm.xchart.*
+org.kobjects.ktxml.*
+org.kobjects.kxml3.*
+org.kobjects.parserlib.*
+org.kocakosm.*
+org.kodein.compose.html.css.*
+org.kodein.db.*
+org.kodein.di.*
+org.kodein.log.*
+org.kodein.memory.*
+org.kodein.mock.*
+org.kodein.mock.mockmp.*
+org.kodein.type.*
+org.kohsuke.*
+org.kohsuke.ajaxterm4j.*
+org.kohsuke.args4j.*
+org.kohsuke.codemodel.*
+org.kohsuke.droovy.*
+org.kohsuke.gmaven.*
+org.kohsuke.httpunit.*
+org.kohsuke.jetbrains.*
+org.kohsuke.jetty.*
+org.kohsuke.jinterop.*
+org.kohsuke.loopy.*
+org.kohsuke.metainf-services.*
+org.kohsuke.no-more-tears.*
+org.kohsuke.redstone.*
+org.kohsuke.rngom.*
+org.kohsuke.scotland.*
+org.kohsuke.sfx4j.*
+org.kohsuke.soimp.*
+org.kohsuke.sorcerer.*
+org.kohsuke.stapler.*
+org.kollavarsham.converter.*
+org.komamitsu.*
+org.komapper.*
+org.kopi.*
+org.kopitubruk.util.*
+org.kordamp.bootstrapfx.*
+org.kordamp.desktoppanefx.*
+org.kordamp.ezmorph.*
+org.kordamp.gipsy.*
+org.kordamp.gradle.*
+org.kordamp.harmonicfx.*
+org.kordamp.ikonli.*
+org.kordamp.jarviz.*
+org.kordamp.jipsy.*
+org.kordamp.jsilhouette.*
+org.kordamp.json.*
+org.kordamp.maven.*
+org.kordamp.shade.*
+org.korecky.*
+org.korz.*
+org.koshinuke.*
+org.kotlincrypto.*
+org.kotlincrypto.core.*
+org.kotlincrypto.endians.*
+org.kotlincrypto.hash.*
+org.kotlincrypto.macs.*
+org.kotlincrypto.sponges.*
+org.kotlinextra.*
+org.kotlinmath.*
+org.kotools.*
+org.kquiet.*
+org.kramerlab.*
+org.kravemir.gradle.sass.*
+org.kravemir.lightvalue.*
+org.kravemir.svg.labels.*
+org.krayne.*
+org.krproject.*
+org.krproject.ocean.*
+org.krproject.ocean.archetypes.crab.*
+org.krproject.ocean.archetypes.fish.*
+org.krproject.ocean.archetypes.octopus.*
+org.krproject.ocean.skeletons.crab.*
+org.krproject.ocean.skeletons.fish.*
+org.krproject.ocean.skeletons.octopus.*
+org.krproject.ocean.vitamins.*
+org.kryptokrona.sdk.*
+org.krysalis.*
+org.ksprojects.*
+org.kt3k.*
+org.kt3k.gradle.plugin.*
+org.kt3k.straw.*
+org.ktargeter.*
+org.ktorm.*
+org.kuali.*
+org.kuali.cm.*
+org.kuali.coeus.*
+org.kuali.common.*
+org.kuali.common.cm.*
+org.kuali.common.ec2.*
+org.kuali.common.threads.*
+org.kuali.common.util.*
+org.kuali.commons.*
+org.kuali.db.impex.*
+org.kuali.db.ojb.*
+org.kuali.db.sql.*
+org.kuali.foundation.cm.*
+org.kuali.jotm.*
+org.kuali.kfs.*
+org.kuali.kpme.*
+org.kuali.maven.*
+org.kuali.maven.cloudfront.*
+org.kuali.maven.common.*
+org.kuali.maven.impex.*
+org.kuali.maven.plugins.*
+org.kuali.maven.pom.*
+org.kuali.maven.skins.*
+org.kuali.maven.wagons.*
+org.kuali.ole.*
+org.kuali.pom.*
+org.kuali.rice.*
+org.kuali.spring.*
+org.kuali.student.*
+org.kuali.student.admin.*
+org.kuali.student.api.*
+org.kuali.student.common.*
+org.kuali.student.core.*
+org.kuali.student.db.*
+org.kuali.student.deployments.*
+org.kuali.student.lum.*
+org.kuali.student.repository.*
+org.kuali.student.security.*
+org.kuali.student.web.*
+org.kualigan.kc.contrib.*
+org.kualigan.kfs.*
+org.kualigan.kfs.contrib.*
+org.kualigan.kuali.*
+org.kualigan.kuali.contrib.*
+org.kualigan.liquibase.*
+org.kualigan.maven.archetypes.*
+org.kualigan.maven.plugins.*
+org.kualigan.maven.skins.*
+org.kualigan.pom.*
+org.kubek2k.*
+org.kubek2k.mockito.spring.*
+org.kubinity.*
+org.kulabukhov.*
+org.kurento.*
+org.kurento.module.*
+org.kurento.tutorial.*
+org.kurtymckurt.*
+org.kweny.carefree.*
+org.kynosarges.*
+org.kyojo.*
+org.l2x6.cq.*
+org.l2x6.maven-utils.*
+org.l2x6.maven.srcdeps.*
+org.l2x6.pom-tuner.*
+org.l2x6.rpkgtests.*
+org.l2x6.srcdeps.*
+org.l33tlabs.twl.*
+org.l6n.*
+org.l88.*
+org.la4j.*
+org.labcrypto.*
+org.labkey.*
+org.labkey.api.*
+org.lable.codesystem.*
+org.lable.oss.*
+org.lable.oss.bitsandbytes.*
+org.lable.oss.dynamicconfig.*
+org.lable.oss.dynamicconfig.provider.*
+org.lable.oss.dynamicconfig.serialization.*
+org.lable.oss.nicerhex.*
+org.lable.oss.nicerxvi.*
+org.lable.oss.uniqueid.*
+org.lable.rfc3881.auditlogger.*
+org.lable.rfc3881.auditlogger.adapter.*
+org.lable.rfc3881.auditlogger.definitions.*
+org.labun.*
+org.labun.jooq.*
+org.ladsn.*
+org.lafros.*
+org.laganini.lagano.*
+org.lambadaframework.*
+org.lambdatarunner.*
+org.lambdify.*
+org.lambico.*
+org.lamblin.*
+org.lanatec.*
+org.langrid.*
+org.languagetool.*
+org.lanternpowered.*
+org.laoruga.*
+org.lappsgrid.*
+org.lappsgrid.gate.*
+org.lappsgrid.jupyter.*
+org.lappsgrid.maven.*
+org.lasersonlab.*
+org.lasersonlab.apache.parquet.*
+org.lasersonlab.thredds.*
+org.lasinger.tools.*
+org.lastaflute.*
+org.lastaflute.doc.*
+org.lastaflute.html.*
+org.lastaflute.job.*
+org.lastaflute.meta.*
+org.lastaflute.remoteapi.*
+org.lastnpe.eea.*
+org.latencyutils.*
+org.latestbit.*
+org.latinolib.*
+org.latinolib.latino4j.*
+org.latte-lang.*
+org.laurell.log4j2.*
+org.laxture.*
+org.lazydoc.*
+org.lazydog.mbean.*
+org.lazydog.repository.*
+org.lazyluke.*
+org.ldaptive.*
+org.ldp4j.*
+org.ldp4j.commons.*
+org.ldp4j.commons.rmf.*
+org.ldp4j.framework.*
+org.leadpony.joy.*
+org.leadpony.justify.*
+org.leadpony.regexp4j.*
+org.lealone.*
+org.lealone.plugins.*
+org.leandreck.endpoints.*
+org.leapframework.*
+org.leberrigaud.maven.plugins.*
+org.lecturestudio.avdev.*
+org.lecturestudio.stylus.*
+org.legendofdragoon.*
+org.legogroup.*
+org.leialearns.*
+org.leibnizcenter.*
+org.leiers.minecraft.*
+org.lelv.*
+org.lendingclub.mercator.*
+org.lenskit.*
+org.leplus.*
+org.lerch.*
+org.lesscss.*
+org.lestr.*
+org.lestr.astenn.*
+org.lestr.astenn.astenn-examples.*
+org.lestr.astenn.astenn-examples.embbed-xml-document.*
+org.lestr.astenn.astenn-examples.remote-implementation.*
+org.lestr.astenn.astenn-examples.standalone-cxf.*
+org.lestr.astenn.astenn-examples.webapp-cxf.*
+org.lfenergy.shapeshifter.*
+org.libelektra.*
+org.libheiffx.*
+org.libindic.*
+org.libj.*
+org.liblouis.*
+org.libra.*
+org.librarysimplified.*
+org.librarysimplified.android.theme.*
+org.librarysimplified.audiobook.*
+org.librarysimplified.audiobook.audioengine.*
+org.librarysimplified.audiobook.overdrive.*
+org.librarysimplified.drm.*
+org.librarysimplified.drm.axis.*
+org.librarysimplified.http.*
+org.librarysimplified.r2.*
+org.librawfx.*
+org.libregaming.*
+org.libreoffice.*
+org.libreoffice.ext.*
+org.libtorrent4j.*
+org.libvirt.*
+org.lifs-tools.*
+org.lifty.*
+org.ligboy.*
+org.ligboy.android.*
+org.ligboy.library.*
+org.ligboy.retrofit2.*
+org.light4j.*
+org.light4j.utils.*
+org.lightadmin.*
+org.lightcouch.*
+org.lighthousegames.*
+org.lightjason.*
+org.lightningdevkit.*
+org.lightningj.*
+org.lightningj.paywall.*
+org.lightsleep.*
+org.ligoj.*
+org.ligoj.api.*
+org.ligoj.app.*
+org.ligoj.bootstrap.*
+org.ligoj.parent.*
+org.ligoj.plugin.*
+org.lindbergframework.*
+org.lindbergframework.configuration.*
+org.lindbergframework.persistence.sqlmapping.*
+org.lindbergframework.web.*
+org.lineargs.*
+org.linguafranca.pwdb.*
+org.linkeddatafragments.*
+org.linkedin.*
+org.linkedopenactors.*
+org.linkedopenactors.ap.*
+org.linkedopenactors.code.*
+org.linkki-framework.*
+org.linkki-framework.archetypes.*
+org.linkki-framework.tooling.*
+org.linkki-framework.tutorial.*
+org.linqs.*
+org.linqs.plugins.*
+org.lintx.plugins.modules.*
+org.linuxalert.dataflow.*
+org.linuxforhealth.fhir.*
+org.linuxmce.*
+org.linuxprobe.*
+org.linuxstuff.maven.*
+org.lionsoul.*
+org.liquibase.*
+org.liquibase.ext.*
+org.liquibase.ext.vaults.*
+org.liquigraph.*
+org.liquigraph.trinity.*
+org.lisasp.*
+org.litesoft.*
+org.litote.*
+org.litote.chat.rocket.sdk.*
+org.litote.jackson.*
+org.litote.kmongo.*
+org.littlegrid.*
+org.littleshoot.*
+org.liveontologies.*
+org.livetribe.*
+org.livetribe.slp.*
+org.liyifeng.*
+org.llorllale.*
+org.llrp.*
+org.llvm4j.*
+org.lmdbjava.*
+org.loadtest4j.*
+org.loadtest4j.drivers.*
+org.loadtest4j.reporters.*
+org.loadui.*
+org.lobobrowser.*
+org.locationtech.geomesa.*
+org.locationtech.geotrellis.*
+org.locationtech.geowave.*
+org.locationtech.jts.*
+org.locationtech.jts.io.*
+org.locationtech.proj4j.*
+org.locationtech.rasterframes.*
+org.locationtech.sfcurve.*
+org.locationtech.spatial4j.*
+org.lockss.*
+org.lockss.laaws.*
+org.lodgon.openmapfx.*
+org.loesak.esque.*
+org.loesak.springframework.security.openfeign.*
+org.log4mongo.*
+org.log4s.*
+org.log5f.*
+org.logback-extensions.*
+org.logcapture.*
+org.logdoc.*
+org.logevents.*
+org.logging4s.*
+org.logicalshift.*
+org.logicblaze.lingo.*
+org.logicng.*
+org.logicovercode.*
+org.loginject.*
+org.loguno.*
+org.lokra.jpa.*
+org.lokra.seaweedfs.*
+org.longevityframework.*
+org.lorainelab.*
+org.lorislab.corn.*
+org.lorislab.docker.*
+org.lorislab.jee.*
+org.lorislab.jel.*
+org.lorislab.maven.*
+org.lorislab.p6.*
+org.lorislab.p6.quarkus.*
+org.lorislab.quarkus.*
+org.lorislab.swagger.*
+org.lorislab.treasure.*
+org.lorislab.vertx.*
+org.losty.netatmo.*
+org.lovebing.reactnative.*
+org.lovebing.spring.*
+org.lrng.binding.*
+org.lsposed.hiddenapibypass.*
+org.lsposed.lsparanoid.*
+org.lsposed.lsplant.*
+org.lsposed.lsplt.*
+org.lsposed.lsplugin.*
+org.lsposed.lsplugin.apksign.*
+org.lsposed.lsplugin.apktransform.*
+org.lsposed.lsplugin.cmaker.*
+org.lsposed.lsplugin.jgit.*
+org.lsposed.lsplugin.publish.*
+org.lsposed.lsplugin.resopt.*
+org.lsun.*
+org.luaj.*
+org.lucasr.dspec.*
+org.lucasr.probe.*
+org.lucasr.smoothie.*
+org.lucasr.twowayview.*
+org.lucee.*
+org.lucidfox.jpromises.*
+org.luckypray.*
+org.luismmribeiro.archetype.*
+org.lujian.cloud.*
+org.lujian.cloud.boot.*
+org.lujian.weixin.*
+org.lukashian.*
+org.lukaszkusnierz.*
+org.lukhnos.*
+org.lumongo.*
+org.lunarlu.commons.*
+org.lunarray.common.*
+org.lunarray.model.*
+org.lunarray.model.extensions.descriptor.*
+org.lunarray.model.extensions.generation.jsf.*
+org.lunarray.model.generation.*
+org.lunaspeed.*
+org.luwrain.*
+org.luxdb.*
+org.lvgo.*
+org.lwapp.*
+org.lwapp.psd2.*
+org.lwes.*
+org.lwjgl.*
+org.lwjgl.lwjgl.*
+org.lwjgl.osgi.*
+org.lwjglx.*
+org.lwsdo.*
+org.lyranthe.*
+org.lyranthe.fs2-grpc.*
+org.lyranthe.prometheus.*
+org.lz4.*
+org.m1theo.*
+org.macrocloud.*
+org.macroid.*
+org.madlonkay.*
+org.madlonkay.supertmxmerge.*
+org.magic4j.*
+org.magicwerk.*
+org.magicwerk.brownies.*
+org.magicwerk.magictest.*
+org.majordodo.*
+org.make.*
+org.make.constructr.*
+org.makumba.*
+org.mal-lang.*
+org.malagu.linq.*
+org.malagu.multitenant.*
+org.maltparser.*
+org.manatki.*
+org.mandas.*
+org.mandas.kafka.*
+org.mantamq.*
+org.mantoux.*
+org.maochen.nlp.*
+org.mapdb.*
+org.mapeditor.*
+org.mapfish.geo.*
+org.mapfish.print.*
+org.maplibre.gl.*
+org.maproulette.client.*
+org.mapsforge.*
+org.mapstruct.*
+org.mapstruct.extensions.spring.*
+org.mapstruct.tools.gem.*
+org.maptalks.*
+org.mapyrus.*
+org.maraist.*
+org.marc4j.*
+org.mariadb.*
+org.mariadb.jdbc.*
+org.marid.*
+org.mariuszgromada.math.*
+org.markdownj.*
+org.marketcetera.*
+org.marketcetera.fork.*
+org.marketdesignresearch.*
+org.markushauck.*
+org.markysoft.*
+org.marmelo.dropwizard.*
+org.marsik.ham.*
+org.marssa.*
+org.marvec.*
+org.marvelution.*
+org.marvelution.jji.*
+org.mashupbots.socko.*
+org.massnet.sdk.*
+org.mastodon4j.*
+org.masukomi.*
+org.mat.*
+org.materialsdatafacility.mdfconnect.*
+org.matheclipse.*
+org.matrix.android.*
+org.matrix.rustcomponents.*
+org.matthicks.*
+org.mattressframework.*
+org.mattrick.*
+org.maushake.*
+org.maxron.platform.*
+org.maxur.*
+org.maxwe.epub.*
+org.maxxq.maven.*
+org.mayanjun.*
+org.mayocat.platform.*
+org.mayocat.shop.*
+org.mazarineblue.*
+org.mbari.commons.*
+org.mbari.vcr4j.*
+org.mbtest.javabank.*
+org.mcavallo.*
+org.mcraig.*
+org.mdedetrich.*
+org.mdkt.compiler.*
+org.mdlavin.*
+org.mdsplus.*
+org.meanbean.*
+org.mechdancer.*
+org.mechio.*
+org.mediawiki.*
+org.mediawiki.api.*
+org.meekoframework.*
+org.meeuw.*
+org.meeuw.configuration.*
+org.meeuw.i18n.*
+org.meeuw.math.*
+org.meeuw.util.*
+org.mellowtech.*
+org.membrane-soa.*
+org.memeticlabs.*
+org.memgraph.*
+org.mendrugo.qollider.*
+org.mengyun.*
+org.mentaframework.*
+org.meowy.cqp.*
+org.meridor.*
+org.meridor.perspective.*
+org.meridor.stecker.*
+org.meruvian.inca.s2restplugins.*
+org.meruvian.midas.*
+org.meruvian.yama.*
+org.mesagisto.*
+org.messaginghub.*
+org.metabit.library.misc.*
+org.metabit.platform.interfacing.*
+org.metabit.platform.support.config.*
+org.metaborg.*
+org.metachart.*
+org.metacsp.*
+org.metacsp.meta-csp-framework.1.0.175.artifacts.org.metacsp.*
+org.metaeffekt.core.*
+org.metaeffekt.dcc.*
+org.metaeffekt.dita.*
+org.metaeffekt.pki.trustengine.*
+org.metafacture.*
+org.metalib.maven.*
+org.metalib.maven.extension.*
+org.metalib.maven.extention.*
+org.metalib.maven.plugins.yaml.*
+org.metalib.maven.pom.*
+org.metarchive.mex.*
+org.metastopheles.*
+org.metatype.sxc.*
+org.metawidget.*
+org.metawidget.modules.*
+org.metawidget.modules.android.*
+org.metawidget.modules.commons.*
+org.metawidget.modules.faces.*
+org.metawidget.modules.gwt.*
+org.metawidget.modules.hibernate.*
+org.metawidget.modules.js.*
+org.metawidget.modules.json.*
+org.metawidget.modules.jsp.*
+org.metawidget.modules.spring.*
+org.metawidget.modules.static.*
+org.metawidget.modules.static.faces.*
+org.metawidget.modules.static.html.*
+org.metawidget.modules.static.jsp.*
+org.metawidget.modules.static.spring.*
+org.metawidget.modules.struts.*
+org.metawidget.modules.swing.*
+org.metawidget.modules.swing.jgoodies.*
+org.metawidget.modules.swt.*
+org.metawidget.modules.vaadin.*
+org.meteogroup.*
+org.meteothink.*
+org.meteothink.io.*
+org.meyvn.*
+org.micchon.*
+org.michaelevans.*
+org.michaelevans.colorart.*
+org.michaelgorski.*
+org.micro-manager.acqengj.*
+org.micro-manager.mmcorej.*
+org.micro-manager.ndtiffstorage.*
+org.micro-manager.ndviewer.*
+org.micro-manager.pycro-manager.*
+org.microbean.*
+org.microbule.*
+org.microcrafts.*
+org.microemu.*
+org.microg.*
+org.microg.gms.*
+org.microg.nlp.*
+org.microhttp.*
+org.microjpa.*
+org.microjservice.lark.*
+org.microprofile-ext.*
+org.microprofile-ext.config-ext.*
+org.microprofile-ext.examples.*
+org.microprofile-ext.health-ext.*
+org.microprofile-ext.jaxrs-ext.*
+org.microprofile-ext.openapi-ext.*
+org.microprofile-ext.restclient-ext.*
+org.microservice-api-patterns.*
+org.microshed.*
+org.microshed.boost.*
+org.microshed.boost.boms.*
+org.microshed.boost.boosters.*
+org.microshed.boost.runtimes.*
+org.midao.*
+org.mikand.autonomous.services.*
+org.mikeneck.*
+org.mikeneck.graffiti.*
+org.mikeneck.httpspec.*
+org.mikeneck.junit.starter.*
+org.mikeneck.pixela.*
+org.mil-oss.*
+org.millarts.*
+org.millipixel.*
+org.milyn.*
+org.milyn.edi.*
+org.milyn.edi.unedifact.*
+org.milyn.thirdparty.*
+org.mimosaframework.*
+org.mimosaframework.core.*
+org.mimosaframework.mvc.*
+org.mimosaframework.orm.*
+org.mimosaframework.springstarter.*
+org.minbox.framework.*
+org.mindrot.*
+org.mindswap.*
+org.mini2Dx.*
+org.minidns.*
+org.minifx.*
+org.minijax.*
+org.minimalcode.*
+org.minimalj.*
+org.mintcode.errabbit.*
+org.mintshell.*
+org.miracl.milagro.amcl.*
+org.miracum.*
+org.mirah.*
+org.mirah.maven.*
+org.mirrentools.*
+org.mithrim.epf.*
+org.mitre.*
+org.mitre.caasd.*
+org.mitre.cpe.*
+org.mitre.dsmiley.httpproxy.*
+org.mitre.hapifhir.*
+org.mitre.jcarafe.*
+org.mitre.secretsharing.*
+org.mitre.synthea.*
+org.mitre.taxii.*
+org.mixdrinks.*
+org.mixer2.*
+org.mixql.*
+org.mizux.javanative.*
+org.mk300.*
+org.mlflow.*
+org.mmaug.mmfont.*
+org.mmbase.*
+org.mmbase.maven.*
+org.mnode.*
+org.mnode.ical4j.*
+org.mnode.juicer.*
+org.mnode.mstor.*
+org.mnode.newsagent.*
+org.mnode.ousia.*
+org.moallemi.gradle.advanced-build-version.*
+org.moara.ftp.*
+org.moara.translate.*
+org.moara.yido.*
+org.mobicents.*
+org.mobicents.applications.*
+org.mobicents.arquillian.container.*
+org.mobicents.arquillian.container.mobicents.*
+org.mobicents.cluster.*
+org.mobicents.commons.*
+org.mobicents.commtesting.*
+org.mobicents.diameter.*
+org.mobicents.eir.*
+org.mobicents.eir.docs.*
+org.mobicents.examples.*
+org.mobicents.external.freetts.*
+org.mobicents.gmlc.*
+org.mobicents.gmlc.docs.*
+org.mobicents.gmlc.docs.adminguide.*
+org.mobicents.gmlc.docs.commons.*
+org.mobicents.gmlc.docs.installguide.*
+org.mobicents.gmlc.docs.releasenotes.*
+org.mobicents.ha.javax.sip.*
+org.mobicents.javax.sip.*
+org.mobicents.jdocbook.*
+org.mobicents.jsr309.*
+org.mobicents.maven.plugins.*
+org.mobicents.media.*
+org.mobicents.media.client.*
+org.mobicents.media.codecs.*
+org.mobicents.media.controls.*
+org.mobicents.media.docs.*
+org.mobicents.media.endpoints.*
+org.mobicents.media.hardware.*
+org.mobicents.media.io.*
+org.mobicents.media.resources.*
+org.mobicents.protocols.asn.*
+org.mobicents.protocols.asn.docs.*
+org.mobicents.protocols.sctp.*
+org.mobicents.protocols.sctp.docs.*
+org.mobicents.protocols.ss7.*
+org.mobicents.protocols.ss7.cap.*
+org.mobicents.protocols.ss7.clock.*
+org.mobicents.protocols.ss7.congestion.*
+org.mobicents.protocols.ss7.docs.*
+org.mobicents.protocols.ss7.hardware.*
+org.mobicents.protocols.ss7.inap.*
+org.mobicents.protocols.ss7.isup.*
+org.mobicents.protocols.ss7.m3ua.*
+org.mobicents.protocols.ss7.management.*
+org.mobicents.protocols.ss7.map.*
+org.mobicents.protocols.ss7.mtp.*
+org.mobicents.protocols.ss7.oam.*
+org.mobicents.protocols.ss7.oam.common.*
+org.mobicents.protocols.ss7.sccp.*
+org.mobicents.protocols.ss7.scheduler.*
+org.mobicents.protocols.ss7.sgw.*
+org.mobicents.protocols.ss7.statistics.*
+org.mobicents.protocols.ss7.tcap.*
+org.mobicents.protocols.ss7.tcapAnsi.*
+org.mobicents.protocols.ss7.tools.alarmlistener.*
+org.mobicents.protocols.ss7.tools.simulator.*
+org.mobicents.protocols.ss7.tools.traceparser.*
+org.mobicents.resources.*
+org.mobicents.resources.mscontrol.*
+org.mobicents.servers.jainslee.*
+org.mobicents.servers.jainslee.api.*
+org.mobicents.servers.jainslee.core.*
+org.mobicents.servers.jainslee.diameter.*
+org.mobicents.servers.jainslee.eclipslee.*
+org.mobicents.servers.jainslee.enablers.*
+org.mobicents.servers.jainslee.http.*
+org.mobicents.servers.jainslee.javaee.*
+org.mobicents.servers.jainslee.jdbc.*
+org.mobicents.servers.jainslee.media.*
+org.mobicents.servers.jainslee.sip.*
+org.mobicents.servers.jainslee.smpp.*
+org.mobicents.servers.jainslee.ss7.*
+org.mobicents.servers.jainslee.tftp.*
+org.mobicents.servers.jainslee.tools.*
+org.mobicents.servers.jainslee.tools.twiddle.*
+org.mobicents.servers.jainslee.tools.twiddle.docs.*
+org.mobicents.servers.jainslee.xcap.*
+org.mobicents.servers.jainslee.xmpp.*
+org.mobicents.servers.media.codecs.*
+org.mobicents.servlet.sip.*
+org.mobicents.servlet.sip.archetypes.*
+org.mobicents.servlet.sip.arquillian.showcase.*
+org.mobicents.servlet.sip.containers.*
+org.mobicents.servlet.sip.docs.*
+org.mobicents.servlet.sip.example.*
+org.mobicents.servlet.sip.examples.*
+org.mobicents.servlet.sip.management.*
+org.mobicents.servlet.sip.testsuite.*
+org.mobicents.servlet.sip.testsuite.applications.*
+org.mobicents.shrinkwrap.container.*
+org.mobicents.sipunit.*
+org.mobicents.slee.examples.*
+org.mobicents.slee.media.*
+org.mobicents.slee.ra.*
+org.mobicents.slee.resource.smack.*
+org.mobicents.smsc.*
+org.mobicents.smsc.docs.*
+org.mobicents.smsc.docs.adminguide.*
+org.mobicents.smsc.docs.commons.*
+org.mobicents.smsc.docs.installguide.*
+org.mobicents.smsc.docs.releasenotes.*
+org.mobicents.tools.*
+org.mobicents.tools.snmp.*
+org.mobicents.tools.snmp.adaptor.*
+org.mobicents.tools.snmp.deployer.*
+org.mobicents.tools.snmp.mib.*
+org.mobicents.ussd.*
+org.mobicents.ussd.docs.*
+org.mobicents.ussd.docs.adminguide.*
+org.mobicents.ussd.docs.commons.*
+org.mobicents.ussd.docs.installguide.*
+org.mobicents.ussd.docs.releasenotes.*
+org.mobicents.ussd.examples.*
+org.mobicents.ussd.management.*
+org.mobicents.webrtc.*
+org.mobilenativefoundation.store.*
+org.mobilitydata.*
+org.mock-server.*
+org.mockcrumb.*
+org.mockejb.*
+org.mockftpserver.*
+org.mockito.*
+org.mockito.kotlin.*
+org.mockwire.*
+org.mod4j.*
+org.mod4j.com.google.*
+org.mod4j.com.google.inject.*
+org.mod4j.com.ibm.*
+org.mod4j.crossx.*
+org.mod4j.docs.*
+org.mod4j.org.*
+org.mod4j.org.antlr.*
+org.mod4j.org.apache.commons.*
+org.mod4j.org.eclipse.*
+org.mod4j.org.eclipse.compare.*
+org.mod4j.org.eclipse.core.*
+org.mod4j.org.eclipse.core.databinding.*
+org.mod4j.org.eclipse.emf.*
+org.mod4j.org.eclipse.emf.ecore.*
+org.mod4j.org.eclipse.emf.mwe.*
+org.mod4j.org.eclipse.equinox.*
+org.mod4j.org.eclipse.jdt.*
+org.mod4j.org.eclipse.jface.*
+org.mod4j.org.eclipse.ui.*
+org.mod4j.org.eclipse.ui.workbench.*
+org.mod4j.org.eclipse.xtend.typesystem.*
+org.mod4j.org.eclipse.xtend.util.*
+org.mod4j.org.eclipse.xtext.*
+org.mod4j.org.eclipse.xtext.ui.*
+org.mod4j.patched.*
+org.modelcc.*
+org.modeldriven.*
+org.modelfabric.*
+org.modelmapper.*
+org.modelmapper.extensions.*
+org.modeone.*
+org.modeshape.*
+org.modeshape.bom.*
+org.modeshape.demo.*
+org.modeshape.examples.*
+org.moditect.*
+org.moditect.jfrunit.*
+org.moditect.layrry.*
+org.moditect.ossquickstart.*
+org.moduliths.*
+org.moeaframework.*
+org.mojavemvc.*
+org.mojoz.*
+org.molgenis.*
+org.monarchinitiative.biodownload.*
+org.monarchinitiative.fenominal.*
+org.monarchinitiative.hpotextmining.*
+org.monarchinitiative.phenol.*
+org.monarchinitiative.phenoneer.*
+org.monarchinitiative.sgenes.*
+org.monarchinitiative.svart.*
+org.monarchinitiative.vmvt.*
+org.mondemand.*
+org.mongeez.*
+org.mongodb.*
+org.mongodb.kafka.*
+org.mongodb.kbson.*
+org.mongodb.mongo-hadoop.*
+org.mongodb.mongo-hadoop.mongo-hadoop-examples.*
+org.mongodb.morphia.*
+org.mongodb.scala.*
+org.mongodb.spark.*
+org.mongoflink.*
+org.mongojack.*
+org.mongolink.*
+org.mongopipe.*
+org.mongounit.*
+org.monifu.*
+org.monora.coolsocket.*
+org.monora.uprotocol.*
+org.monospark.*
+org.moormanity.*
+org.morfly.airin.*
+org.morphir.*
+org.mortbay.hightide.*
+org.mortbay.hightide.example.*
+org.mortbay.jasper.*
+org.mortbay.jetty.*
+org.mortbay.jetty.alpn.*
+org.mortbay.jetty.archetype.*
+org.mortbay.jetty.dist.*
+org.mortbay.jetty.example.*
+org.mortbay.jetty.loadgenerator.*
+org.mortbay.jetty.npn.*
+org.mortbay.jetty.orchestrator.*
+org.mortbay.jetty.quic.libquiche.*
+org.mortbay.jetty.quiche.*
+org.mortbay.jetty.testwars.*
+org.mortbay.jetty.toolchain.*
+org.mortbay.jetty.toolchain.unix.*
+org.mosim.refactorlizar.*
+org.moskito.*
+org.mountcloud.*
+org.mountcloud.mcplugin.*
+org.mousio.*
+org.movealong.*
+org.movealong.plugins.*
+org.moxiemocks.*
+org.mozilla.*
+org.mozilla.deepspeech.*
+org.mozilla.iot.*
+org.mozilla.taskcluster.*
+org.mp4parser.*
+org.mpierce.*
+org.mpierce.concurrent.throttle.*
+org.mpierce.gcp.logging.*
+org.mpierce.guice.warmup.*
+org.mpierce.http.client.threadlocalheader.*
+org.mpierce.jersey2.metrics.*
+org.mpierce.kotlin.coroutines.newrelic.*
+org.mpierce.ktor.*
+org.mpierce.ktor.csrf.*
+org.mpierce.ktor.newrelic.*
+org.mpierce.metrics.reservoir.*
+org.mricaud.xml.*
+org.mrlem.gnome.*
+org.mrlem.siage3d.*
+org.msbotframework4j.*
+org.msgpack.*
+org.msync.*
+org.msyu.javautil.*
+org.mudebug.*
+org.mule.*
+org.mule.common.*
+org.mule.connectors.*
+org.mule.distributions.*
+org.mule.distributions.ear.*
+org.mule.distributions.jca.*
+org.mule.examples.*
+org.mule.extensions.*
+org.mule.ibeans.*
+org.mule.maven.exchange.*
+org.mule.modules.*
+org.mule.modules.jca.*
+org.mule.mvel.*
+org.mule.patterns.*
+org.mule.runtime.*
+org.mule.runtime.plugins.*
+org.mule.services.*
+org.mule.tests.*
+org.mule.tests.archetypes.*
+org.mule.tests.plugin.*
+org.mule.tools.*
+org.mule.tools.maven.*
+org.mule.transports.*
+org.mule.wsdl.*
+org.mulgara.*
+org.multi-os-engine.*
+org.multij.*
+org.multimc.*
+org.multiverse.*
+org.munin4j.*
+org.mushikago.*
+org.mustangproject.*
+org.mustertech.rms.*
+org.mustertech.webapp.*
+org.mutabilitydetector.*
+org.mvc-spec.ozark.*
+org.mvc-spec.ozark.ext.*
+org.mvc-spec.tck.*
+org.mvel.*
+org.mvnpm.*
+org.mvnpm.at.fontsource.*
+org.mvnpm.at.kurkle.*
+org.mvnpm.at.lit-labs.*
+org.mvnpm.at.lit.*
+org.mvnpm.at.mvnpm.*
+org.mvnpm.at.open-wc.*
+org.mvnpm.at.polymer.*
+org.mvnpm.at.types.*
+org.mvnpm.at.vaadin.*
+org.mvnpm.at.vanillawc.*
+org.mvnpm.at.webcomponents.*
+org.mvnpm.locked.*
+org.mvnpm.locked.at.vaadin.*
+org.mvnsearch.*
+org.mwolff.*
+org.mxupdate.*
+org.mybatis.*
+org.mybatis.caches.*
+org.mybatis.dynamic-sql.*
+org.mybatis.generator.*
+org.mybatis.maven.*
+org.mybatis.scala.*
+org.mybatis.scripting.*
+org.mybatis.spring.boot.*
+org.mycontroller.*
+org.mycontroller.standalone.*
+org.mycore.*
+org.mycore.iview2.*
+org.mycore.libmeta.*
+org.mycore.mets.*
+org.mycore.mir.*
+org.mycore.pica2mods.*
+org.mycore.plugins.*
+org.mycore.sru.*
+org.mycore.sword.*
+org.mydotey.artemis.*
+org.mydotey.caravan.*
+org.mydotey.cascadedkeymap.*
+org.mydotey.circularbuffer.*
+org.mydotey.codec.*
+org.mydotey.kbear.*
+org.mydotey.lang.*
+org.mydotey.objectpool.*
+org.mydotey.quantile.*
+org.mydotey.rpc.*
+org.mydotey.scf.*
+org.mydotey.scf.apollo.*
+org.mydotey.scf.labeled.*
+org.mydotey.scf.yaml.*
+org.mydotey.tool.*
+org.mygeotrust.mygtlib.*
+org.myguide.*
+org.myhab.tools.*
+org.myire.*
+org.mymmsc.*
+org.mynah.*
+org.mythtv.android.*
+org.n2ex.ecmp.*
+org.n52.*
+org.n52.arctic-sea.*
+org.n52.awi.*
+org.n52.faroe.*
+org.n52.geoprocessing.*
+org.n52.iceland.*
+org.n52.jackson.*
+org.n52.janmayen.*
+org.n52.matlab.*
+org.n52.sensorweb-server.dao-impl.*
+org.n52.sensorweb-server.db-model.*
+org.n52.sensorweb-server.helgoland-adapters.*
+org.n52.sensorweb-server.helgoland.*
+org.n52.sensorweb-server.sos.*
+org.n52.sensorweb.*
+org.n52.sensorweb.sos.*
+org.n52.series-api.*
+org.n52.series-api.db.*
+org.n52.series.db.*
+org.n52.shetland.*
+org.n52.svalbard.*
+org.n52.wps.*
+org.n52.youngs.*
+org.nachc.cad.tools.*
+org.naike.*
+org.nakedobjects.*
+org.nakedobjects.archetypes.*
+org.nakedobjects.core.*
+org.nakedobjects.developers.*
+org.nakedobjects.examples.*
+org.nakedobjects.maven.*
+org.nakedobjects.plugins.*
+org.nakedobjects.prototyping.*
+org.nakedobjects.skins.*
+org.nakedosgi.*
+org.nakeduml.*
+org.nalloc.*
+org.nameapi.client.*
+org.nameapi.ontology.*
+org.nameapi.ontology.core.*
+org.nameapi.ontology.json.*
+org.nanocontainer.*
+org.nanocontainer.nanowar.*
+org.nanocontainer.persistence.*
+org.nanoframework.*
+org.nanohttpd.*
+org.nanoj.*
+org.nanoko.*
+org.nanoko.coffee-mill.*
+org.nanoko.libs.*
+org.nanoko.playframework.*
+org.nanopub.*
+org.narsereg.*
+org.nasdanika.*
+org.nasdanika.architecture.*
+org.nasdanika.architecture.cloud.*
+org.nasdanika.architecture.cloud.azure.*
+org.nasdanika.architecture.containers.*
+org.nasdanika.architecture.service-mesh.*
+org.nasdanika.core.*
+org.nasdanika.engineering.*
+org.nasdanika.html.*
+org.nasdanika.models.echarts.*
+org.nasdanika.models.ecore.*
+org.nasdanika.models.gitlab.*
+org.native4j.*
+org.nativescript.*
+org.natspal.*
+org.nature4j.*
+org.nbn-resolving.*
+org.nbone.*
+org.nbone.modules.sys.*
+org.nbsoft.*
+org.nd4j.*
+org.ndviet.*
+org.nebula-contrib.*
+org.necula.bond.*
+org.needle4j.*
+org.nefilim.*
+org.nekosoft.pdffer.*
+org.nekosoft.utils.*
+org.nentangso.*
+org.neo.*
+org.neo4j.*
+org.neo4j.3rdparty.javax.ws.rs.*
+org.neo4j.app.*
+org.neo4j.assembly.*
+org.neo4j.build.*
+org.neo4j.build.plugins.*
+org.neo4j.client.*
+org.neo4j.community.*
+org.neo4j.doc.*
+org.neo4j.driver.*
+org.neo4j.drivers.*
+org.neo4j.examples.*
+org.neo4j.gds.*
+org.neo4j.graphql.examples.*
+org.neo4j.licensing-proxy.*
+org.neo4j.maven.*
+org.neo4j.maven.skins.*
+org.neo4j.procedure.*
+org.neo4j.server.plugin.*
+org.neo4j.springframework.data.*
+org.neo4j.test.*
+org.neociclo.accord.*
+org.neociclo.accord.odetteftp.*
+org.neociclo.accord.odetteftp.assemblies.*
+org.neociclo.tools.*
+org.neodatis.*
+org.neodatis.odb.*
+org.neolumin.simpleorm.*
+org.neolumin.vertexium.*
+org.neolumin.webster.*
+org.neosearch.stringsearcher.*
+org.neovera.jdiablo.*
+org.nerd4j.*
+org.nervos.*
+org.nervos.ckb.*
+org.nervousync.*
+org.nervousync.cache.*
+org.netarchivesuite.*
+org.netbeans.*
+org.netbeans.api.*
+org.netbeans.cluster.*
+org.netbeans.contrib.yenta.*
+org.netbeans.external.*
+org.netbeans.html.*
+org.netbeans.html.nb.*
+org.netbeans.lib.*
+org.netbeans.microedition.lcdui.*
+org.netbeans.modules.*
+org.netbeans.nbbuild.*
+org.netbeans.plugin.support.embedded.*
+org.netbeans.tools.*
+org.netfleet.api.*
+org.netfleet.sdk.*
+org.netherald.*
+org.netirc.library.*
+org.netmelody.menodora.*
+org.netmelody.tatin.*
+org.netpreserve.*
+org.netpreserve.commons.*
+org.netpreserve.openwayback.*
+org.netpreserve.openwayback.access-control.*
+org.networkcalculus.model.*
+org.networkcalculus.num.*
+org.netxms.*
+org.neuro4j.*
+org.newhart.*
+org.nextrtc.signalingserver.*
+org.nfclabs.*
+org.nfctools.*
+org.ngrinder.*
+org.nhind.*
+org.niaouli.*
+org.nibblesec.*
+org.nibor.autolink.*
+org.nickelproject.*
+org.nicktate.*
+org.nicosoft.config.*
+org.nield.*
+org.nightcode.*
+org.nightcode.yaranga.*
+org.nineml.*
+org.ninjaframework.*
+org.nishat.util.*
+org.nisshiee.*
+org.niuchangqing.*
+org.nixos.mvn2nix.*
+org.njgzr.*
+org.nkjmlab.*
+org.nlp2rdf.*
+org.nlp4j.*
+org.nlp4l.*
+org.nlpcn.*
+org.nlpcraft.*
+org.nlpub.*
+org.nmdp.gl.*
+org.nmdp.ngs.*
+org.nmdp.service.*
+org.nmrbox.connjur.*
+org.no-hope.*
+org.no-hope.aspectj.*
+org.nocrala.tools.*
+org.nocrala.tools.aversion.*
+org.nocrala.tools.database.*
+org.nocrala.tools.database.aversion.*
+org.nocrala.tools.database.builder.*
+org.nocrala.tools.database.debbie.*
+org.nocrala.tools.database.sentinel.*
+org.nocrala.tools.lang.collector.*
+org.nocrala.tools.sourcecode.maven.*
+org.nocrala.tools.texttablefmt.*
+org.nocrala.tools.texttreeformatter.*
+org.nocrala.tools.web.*
+org.noear.*
+org.noear.bundle.*
+org.noear.hatch.*
+org.noear.solon.*
+org.nofdev.*
+org.noggit.*
+org.nokatag.*
+org.nokogiri.*
+org.nongnu.multigraph.*
+org.noorm.*
+org.nordapp.web.*
+org.noregress.*
+org.normalsql.*
+org.nosceon.connellite.*
+org.nosceon.datolite.*
+org.nosceon.natrolite.*
+org.nosceon.titanite.*
+org.notima.*
+org.notima.api.*
+org.notima.api.webpay.*
+org.notima.bg.*
+org.notima.camel-adapters.*
+org.notima.generic.*
+org.notima.generic.businessobjects.adapter.*
+org.notlocalhost.gradle.*
+org.notlocalhost.superlistview.*
+org.notninja.*
+org.novelfs.*
+org.nqcx.*
+org.nryotaro.*
+org.nucleus8583.*
+org.nudge.apm.*
+org.nuisto.*
+org.nuiton.*
+org.nuiton.eugene.*
+org.nuiton.i18n.*
+org.nuiton.jaxx.*
+org.nuiton.jpa.*
+org.nuiton.jredmine.*
+org.nuiton.jrst.*
+org.nuiton.js.*
+org.nuiton.matrix.*
+org.nuiton.processor.*
+org.nuiton.thirdparty.*
+org.nuiton.topia.*
+org.nuiton.web.*
+org.nuiton.wikitty.*
+org.numenta.*
+org.nutz.*
+org.nutz.boot.*
+org.nutz.cloud.*
+org.nuunframework.*
+org.nwolfhub.*
+org.nwolfhub.easycli.*
+org.nwolfhub.vk.*
+org.oakgp.*
+org.objectfabric.*
+org.objectledge.ckpackager.*
+org.objectledge.maven.*
+org.objectledge.maven.connectors.*
+org.objectledge.maven.connectors.ckpackager.*
+org.objectledge.maven.connectors.coral.*
+org.objectledge.maven.connectors.javacc.*
+org.objectledge.maven.connectors.jflex.*
+org.objectledge.maven.connectors.jsc.*
+org.objectledge.maven.connectors.scm.*
+org.objectledge.maven.plugins.*
+org.objectpocket.*
+org.objectquery.*
+org.objectstyle.*
+org.objectstyle.ashwood.*
+org.objectstyle.cayenne.*
+org.objectstyle.graphql.*
+org.objectstyle.graphql.bootique.*
+org.objectstyle.graphql.cayenne.*
+org.objectstyle.graphql.rest.*
+org.objectstyle.graphql.test.*
+org.objectstyle.graphql.webconsole.*
+org.objectstyle.japp.*
+org.objecttrouve.*
+org.objectweb.apollon.*
+org.objectweb.bonita.*
+org.objectweb.carol.*
+org.objectweb.celtix.*
+org.objectweb.clif.*
+org.objectweb.deployment.*
+org.objectweb.dream.*
+org.objectweb.dream.dreamadl.*
+org.objectweb.dream.dreamannotation.*
+org.objectweb.dream.dreamcore.*
+org.objectweb.dream.dreamlib.*
+org.objectweb.fractal.*
+org.objectweb.fractal.bf.*
+org.objectweb.fractal.bf.binjiu.*
+org.objectweb.fractal.bf.binjiu.description.*
+org.objectweb.fractal.bf.binjiu.runtime.*
+org.objectweb.fractal.bf.connectors.*
+org.objectweb.fractal.bf.examples.*
+org.objectweb.fractal.bf.examples.amazon.*
+org.objectweb.fractal.bf.examples.meteo.*
+org.objectweb.fractal.bf.hdl.*
+org.objectweb.fractal.bf.itests.*
+org.objectweb.fractal.bf.testing.*
+org.objectweb.fractal.cecilia.*
+org.objectweb.fractal.cecilia.build-modules.*
+org.objectweb.fractal.cecilia.examples.*
+org.objectweb.fractal.cecilia.maven.*
+org.objectweb.fractal.cecilia.toolchain.*
+org.objectweb.fractal.fraclet.*
+org.objectweb.fractal.fraclet.annotation.*
+org.objectweb.fractal.fraclet.java.*
+org.objectweb.fractal.fraclet.java.examples.*
+org.objectweb.fractal.fraclet.java.examples.advanced.*
+org.objectweb.fractal.fractaladl.*
+org.objectweb.fractal.fractaladl.dumper.*
+org.objectweb.fractal.fractaladl.examples.*
+org.objectweb.fractal.fractaladl.juliac.*
+org.objectweb.fractal.fractaladl.juliac.examples.*
+org.objectweb.fractal.fractaladl.juliac.julia-mixed.*
+org.objectweb.fractal.fractaladl.juliac.plugin.*
+org.objectweb.fractal.fractaladl.juliac.tests-conf.*
+org.objectweb.fractal.fractalexplorer.*
+org.objectweb.fractal.fractalexplorer.examples.*
+org.objectweb.fractal.fractalexplorer.jgraph.*
+org.objectweb.fractal.fractalgui.*
+org.objectweb.fractal.fractaljar.*
+org.objectweb.fractal.fractaljmx.*
+org.objectweb.fractal.fractaljmx.examples.*
+org.objectweb.fractal.fractalrmi.*
+org.objectweb.fractal.fractalswing.*
+org.objectweb.fractal.fscript.*
+org.objectweb.fractal.julia.*
+org.objectweb.fractal.julia.tests.*
+org.objectweb.fractal.juliac.*
+org.objectweb.fractal.juliac.dream.*
+org.objectweb.fractal.juliac.examples.*
+org.objectweb.fractal.juliac.examples.ultra-merge.*
+org.objectweb.fractal.juliac.juliet.*
+org.objectweb.fractal.juliac.osgi.*
+org.objectweb.fractal.juliac.osgi.examples.*
+org.objectweb.fractal.juliac.petals.*
+org.objectweb.fractal.mind.compiler.*
+org.objectweb.howl.*
+org.objectweb.jonas.*
+org.objectweb.jonas.tools.*
+org.objectweb.jonathan.*
+org.objectweb.joram.*
+org.objectweb.jorm.*
+org.objectweb.lewys.*
+org.objectweb.medor.*
+org.objectweb.mind.*
+org.objectweb.monolog.*
+org.objectweb.perseus.*
+org.objectweb.petals.*
+org.objectweb.petals.tools.*
+org.objectweb.petals.tools.rmi.*
+org.objectweb.proactive.*
+org.objectweb.proactive.extensions.p2p.structured.*
+org.objectweb.telosys.*
+org.objectweb.think.helloworld-targets.*
+org.objectweb.think.helloworld.*
+org.objectweb.think.minus-gpl.*
+org.objectweb.think.minus.*
+org.objectweb.think.minus.applications.*
+org.objectweb.think.minus.applications.L4.*
+org.objectweb.think.minus.applications.L4PseudoGrub.*
+org.objectweb.think.minus.applications.L4Userland.*
+org.objectweb.think.minus.applications.comete.*
+org.objectweb.think.minus.applications.libL4.*
+org.objectweb.think.minus.applications.loader.*
+org.objectweb.think.minus.applications.pseudoGrub.*
+org.objectweb.think.minus.applications.xstreamUnix.*
+org.objectweb.think.minus.examples.*
+org.objectweb.think.minus.examples.cbst.*
+org.objectweb.think.minus.examples.clientServer.*
+org.objectweb.think.minus.examples.helloworld.*
+org.objectweb.think.minus.examples.yuv-player.*
+org.objectweb.think.minus.libc.*
+org.objectweb.think.minus.test.*
+org.objectweb.think.minus.tools.*
+org.objectweb.think.minus.utils.*
+org.objectweb.think.yuv-player-targets.*
+org.objectweb.think.yuv-player.*
+org.objectweb.tribe.*
+org.objectweb.util.*
+org.objectweb.util.explorer.*
+org.objectweb.util.explorer.plugins.*
+org.objectweb.util.misc.*
+org.objectweb.zeus.*
+org.objenesis.*
+org.oblivion-cache.*
+org.obolibrary.robot.*
+org.obrel.*
+org.obsidiantoaster.*
+org.obsidiantoaster.forge.*
+org.obsidiantoaster.quickstart.*
+org.ocbkc.swift.*
+org.occurrent.*
+org.occurrent.inmemory.*
+org.ocelotds.*
+org.ocpsoft.*
+org.ocpsoft.common.*
+org.ocpsoft.logging.*
+org.ocpsoft.prettytime.*
+org.ocpsoft.redoculous.*
+org.ocpsoft.rewrite.*
+org.ocpsoft.rewrite.showcase.*
+org.octopusden.*
+org.octopusden.cloud.api-gateway.*
+org.octopusden.cloud.config-server.*
+org.octopusden.gradle-staging-plugin.*
+org.octopusden.gradle.plugin.*
+org.octopusden.infrastructure.*
+org.octopusden.octopus-cloud-commons.*
+org.octopusden.octopus-employee.*
+org.octopusden.octopus-parent.*
+org.octopusden.octopus-release-management.*
+org.octopusden.octopus-versions-api.*
+org.octopusden.octopus.*
+org.octopusden.octopus.employee.*
+org.octopusden.octopus.infrastructure.*
+org.octopusden.octopus.multichannelserver.*
+org.octopusden.octopus.octopus-external-systems-clients.*
+org.octopusden.octopus.releng.*
+org.octopusden.octopus.vcsfacade.*
+org.octopusden.release-management.*
+org.odata4j.*
+org.oddgen.*
+org.ode4j.*
+org.odftoolkit.*
+org.odlabs.wiquery.*
+org.odpi.egeria.*
+org.oedura.*
+org.ofdrw.*
+org.officelaf.*
+org.ogc-schemas.*
+org.ogce.*
+org.ogema.*
+org.ogema.apps.*
+org.ogema.core.*
+org.ogema.drivers.*
+org.ogema.eval.*
+org.ogema.examples.*
+org.ogema.external.*
+org.ogema.messaging.*
+org.ogema.model.*
+org.ogema.ref-impl.*
+org.ogema.sim.*
+org.ogema.tests.*
+org.ogema.tools.*
+org.ogema.widgets.*
+org.oiue.*
+org.oiue.services.*
+org.oiue.services.actions.*
+org.oiue.services.bytes.*
+org.oiue.services.drivers.*
+org.oiue.services.odps.*
+org.oiue.services.odps.events.*
+org.oiue.services.templates.*
+org.ojai.*
+org.ojalgo.*
+org.ojbc.*
+org.ojbc.archetypes.*
+org.ojbc.build.*
+org.ojbc.bundles.adapters.*
+org.ojbc.bundles.connectors.*
+org.ojbc.bundles.intermediaries.*
+org.ojbc.bundles.prototypes.*
+org.ojbc.bundles.prototypes.shared.*
+org.ojbc.bundles.shared.*
+org.ojbc.bundles.utilities.*
+org.ojbc.web.*
+org.okasaki.*
+org.okkam.*
+org.okkam.owl.*
+org.okkam.utils.*
+org.olap4j.*
+org.olat.jamwiki.*
+org.olengski.*
+org.olights.jqueryable.*
+org.omegat.*
+org.omegat.lucene.*
+org.omg.dds.*
+org.omg.dds.security.*
+org.omg.profiles.uml14.*
+org.omnaest.i18nbinder.*
+org.omnaest.maven.plugin.*
+org.omnaest.utils.*
+org.omnidial.*
+org.omnifaces.*
+org.omnifaces.arquillian.*
+org.omnifaces.oyena.*
+org.oncoblocks.centromere.*
+org.oneboot.core.*
+org.onebusaway.*
+org.onebusaway.plugins.*
+org.onehippo.forge.webservices.*
+org.onepf.*
+org.onestonesoup.*
+org.onetwo4j.*
+org.onevroad.*
+org.onflow.*
+org.onflow.flow.*
+org.onnx4j.*
+org.onosproject.*
+org.oolong-kt.*
+org.ooni.*
+org.ooverkommelig.*
+org.op4j.*
+org.open-dolphin.*
+org.open-eid.cdoc4j.*
+org.open-metadata.*
+org.openamf.*
+org.openapi4j.*
+org.openapitools.*
+org.openapitools.empoa.*
+org.openapitools.openapidiff.*
+org.openapitools.openapistylevalidator.*
+org.openapitools.swagger.parser.*
+org.openatom.ubml.*
+org.openbakery.coverage.*
+org.openbase.*
+org.openbase.bco.*
+org.openbase.bco.registry.*
+org.openbaton.*
+org.openbel.*
+org.openbites.*
+org.openbp.*
+org.opencadc.*
+org.opencampaignlink.*
+org.opencastproject.*
+org.opencastproject.assemblies.*
+org.opencb.biodata.*
+org.opencb.bionetdb.*
+org.opencb.cellbase.*
+org.opencb.commons.*
+org.opencb.datastore.*
+org.opencb.ga4gh.*
+org.opencb.hpg-bigdata.*
+org.opencb.hpg.*
+org.opencb.opencga.*
+org.opencb.oskar.*
+org.opencds.cqf.*
+org.opencds.cqf.cql.*
+org.opencds.cqf.cql.debug.*
+org.opencds.cqf.cql.ls.*
+org.opencds.cqf.fhir.*
+org.opencds.cqf.ruler.*
+org.openclover.*
+org.opencms.*
+org.opencms.modules.*
+org.opencode4workspace.watson-work-services.*
+org.opencompare.*
+org.opencompare.dataset.*
+org.opencompare.io.*
+org.opencord.*
+org.opencord.ce.*
+org.opencoweb.*
+org.opencoweb.cowebx.*
+org.opencredo.*
+org.opencredo.cloud.storage.*
+org.opencredo.couchdb.*
+org.opencredo.esper.*
+org.opencrx.*
+org.opencypher.*
+org.opencypher.gremlin.*
+org.opendatadiscovery.*
+org.opendatakit.*
+org.opendaylight.aaa.*
+org.opendaylight.aaa.web.*
+org.opendaylight.affinity.*
+org.opendaylight.aggregators.*
+org.opendaylight.alto.*
+org.opendaylight.alto.alto-hosttracker.*
+org.opendaylight.alto.basic.*
+org.opendaylight.alto.core.*
+org.opendaylight.alto.ext.*
+org.opendaylight.alto.spce.network.*
+org.opendaylight.archetypes.*
+org.opendaylight.atrium.*
+org.opendaylight.bgpcep.*
+org.opendaylight.bier.*
+org.opendaylight.capwap.*
+org.opendaylight.cardinal.*
+org.opendaylight.centinel.*
+org.opendaylight.centinel.plugin.*
+org.opendaylight.coe.*
+org.opendaylight.controller.*
+org.opendaylight.controller.archetypes.*
+org.opendaylight.controller.md.*
+org.opendaylight.controller.model.*
+org.opendaylight.controller.samples.*
+org.opendaylight.controller.samples.l2switch.*
+org.opendaylight.controller.samples.l2switch.md.*
+org.opendaylight.controller.thirdparty.*
+org.opendaylight.coretutorials.*
+org.opendaylight.coretutorials.clustering.*
+org.opendaylight.daexim.*
+org.opendaylight.defense4all.*
+org.opendaylight.detnet.*
+org.opendaylight.didm.*
+org.opendaylight.didm.hp.*
+org.opendaylight.didm.hp3800.*
+org.opendaylight.didm.mininet.*
+org.opendaylight.dlux.*
+org.opendaylight.dluxapps.*
+org.opendaylight.docs.*
+org.opendaylight.eman.*
+org.opendaylight.faas.*
+org.opendaylight.federation.*
+org.opendaylight.genius.*
+org.opendaylight.groupbasedpolicy.*
+org.opendaylight.honeycomb.vbd.*
+org.opendaylight.infrautils.*
+org.opendaylight.integration.*
+org.opendaylight.iotdm.*
+org.opendaylight.jsonrpc.*
+org.opendaylight.jsonrpc.bus.*
+org.opendaylight.jsonrpc.security.*
+org.opendaylight.l2switch.*
+org.opendaylight.l2switch.addresstracker.*
+org.opendaylight.l2switch.arphandler.*
+org.opendaylight.l2switch.hosttracker.*
+org.opendaylight.l2switch.loopremover.*
+org.opendaylight.l2switch.main.*
+org.opendaylight.l2switch.packethandler.*
+org.opendaylight.lacp.*
+org.opendaylight.lacp.main.*
+org.opendaylight.lispflowmapping.*
+org.opendaylight.mdsal.*
+org.opendaylight.mdsal.binding.model.iana.*
+org.opendaylight.mdsal.binding.model.ietf.*
+org.opendaylight.mdsal.model.*
+org.opendaylight.mdsal.model.binding2.*
+org.opendaylight.messaging4transport.*
+org.opendaylight.natapp.*
+org.opendaylight.nemo.*
+org.opendaylight.netconf.*
+org.opendaylight.netconf.model.*
+org.opendaylight.netide.*
+org.opendaylight.netvirt.*
+org.opendaylight.neutron.*
+org.opendaylight.next.*
+org.opendaylight.nic.*
+org.opendaylight.ocpplugin.*
+org.opendaylight.ocpplugin.applications.*
+org.opendaylight.ocpplugin.model.*
+org.opendaylight.ocpplugin.ocpjava.*
+org.opendaylight.odlguice.*
+org.opendaylight.odlmicro.*
+org.opendaylight.odlparent.*
+org.opendaylight.of-config.*
+org.opendaylight.opendove.*
+org.opendaylight.openflowjava.*
+org.opendaylight.openflowplugin.*
+org.opendaylight.openflowplugin.applications.*
+org.opendaylight.openflowplugin.legacy.*
+org.opendaylight.openflowplugin.libraries.*
+org.opendaylight.openflowplugin.model.*
+org.opendaylight.openflowplugin.openflowjava.*
+org.opendaylight.opflex.*
+org.opendaylight.ovsdb.*
+org.opendaylight.p4plugin.*
+org.opendaylight.packetcable.*
+org.opendaylight.persistence.*
+org.opendaylight.plastic.*
+org.opendaylight.plugin2oc.*
+org.opendaylight.reservation.*
+org.opendaylight.sdninterfaceapp.*
+org.opendaylight.serviceutils.*
+org.opendaylight.sfc.*
+org.opendaylight.snbi.*
+org.opendaylight.snmp.*
+org.opendaylight.snmp4sdn.*
+org.opendaylight.sxp.*
+org.opendaylight.tcpmd5.*
+org.opendaylight.telemetry.*
+org.opendaylight.topoprocessing.*
+org.opendaylight.transportpce.*
+org.opendaylight.transportpce.models.*
+org.opendaylight.transportpce.ordmodels.*
+org.opendaylight.tsdr.*
+org.opendaylight.ttp.*
+org.opendaylight.unimgr.*
+org.opendaylight.usc.*
+org.opendaylight.usecplugin.*
+org.opendaylight.vpnservice.*
+org.opendaylight.vtn.*
+org.opendaylight.vtn.application.*
+org.opendaylight.yang-push.*
+org.opendaylight.yangide.*
+org.opendaylight.yangtools.*
+org.opendaylight.yangtools.model.*
+org.opendaylight.yangtools.thirdparty.*
+org.opendc.*
+org.opendcs.*
+org.opendof.core-java-internal.*
+org.opendof.core-java.*
+org.opendof.datatransfer-java.*
+org.opends.*
+org.openecard.tools.*
+org.openehealth.ipf.*
+org.openehealth.ipf.archetypes.*
+org.openehealth.ipf.assembly.*
+org.openehealth.ipf.boot.*
+org.openehealth.ipf.commons.*
+org.openehealth.ipf.eclipse.ocl.*
+org.openehealth.ipf.gazelle.*
+org.openehealth.ipf.labs.maven.*
+org.openehealth.ipf.modules.*
+org.openehealth.ipf.oht.atna.*
+org.openehealth.ipf.oht.mdht.*
+org.openehealth.ipf.osgi.*
+org.openehealth.ipf.platform-camel.*
+org.openehealth.ipf.tutorials.*
+org.openehr.adl2-core.*
+org.openehr.java-libs.*
+org.openengsb.*
+org.openengsb.branding.*
+org.openengsb.build.*
+org.openengsb.config.*
+org.openengsb.connector.*
+org.openengsb.core.*
+org.openengsb.core.deployer.*
+org.openengsb.core.ports.*
+org.openengsb.core.proxy.*
+org.openengsb.docs.*
+org.openengsb.domain.*
+org.openengsb.domains.*
+org.openengsb.domains.example.*
+org.openengsb.domains.issue.*
+org.openengsb.domains.notification.*
+org.openengsb.domains.report.*
+org.openengsb.domains.scm.*
+org.openengsb.examples.*
+org.openengsb.forks.*
+org.openengsb.framework.*
+org.openengsb.framework.edb.*
+org.openengsb.framework.edbi.*
+org.openengsb.framework.ekb.*
+org.openengsb.framework.workflow.*
+org.openengsb.infrastructure.*
+org.openengsb.integrationtest.*
+org.openengsb.integrationtest.wrapped.*
+org.openengsb.itests.*
+org.openengsb.labs.delegation.*
+org.openengsb.labs.endtoend.*
+org.openengsb.labs.jpatest.*
+org.openengsb.labs.liquibase.*
+org.openengsb.labs.paxexam.karaf.*
+org.openengsb.loom.*
+org.openengsb.loom.java.*
+org.openengsb.persistence.*
+org.openengsb.ports.*
+org.openengsb.tooling.*
+org.openengsb.tooling.archetypes.*
+org.openengsb.tooling.archetypes.clientproject.*
+org.openengsb.tooling.pluginsuite.*
+org.openengsb.tooling.wsdl2dll.*
+org.openengsb.ui.*
+org.openengsb.ui.common.*
+org.openengsb.wrapped.*
+org.openengsb.wrapped.csharp.*
+org.openestate.io.*
+org.openestate.is24.*
+org.openeuler.*
+org.openfast.*
+org.openfeed.*
+org.openfeed.base.*
+org.openfeed.proto.*
+org.openfolder.*
+org.openforis.calc.*
+org.openforis.collect.*
+org.openforis.collect.earth.*
+org.openforis.commons.*
+org.openforis.groovy.mvc.*
+org.openforis.rmb.*
+org.openftc.*
+org.openfuxml.*
+org.opengauss.*
+org.opengis.*
+org.opengis.cite.*
+org.opengis.cite.eclipse.webtools.sse.*
+org.opengis.cite.saxon.*
+org.opengis.cite.teamengine.*
+org.opengis.cite.xerces.*
+org.opengroup.*
+org.openhab.*
+org.openhab.distro.*
+org.openhab.tools.*
+org.openhab.tools.sat.*
+org.openhab.tools.sat.custom-checks.*
+org.openhab.util.*
+org.openhim.*
+org.openhubframework.*
+org.openid4java.*
+org.openidentityplatform.commons.*
+org.openidentityplatform.commons.audit.*
+org.openidentityplatform.commons.auth-filters.*
+org.openidentityplatform.commons.auth-filters.authz-filter.*
+org.openidentityplatform.commons.auth-filters.authz-filter.modules.*
+org.openidentityplatform.commons.authn-filter.*
+org.openidentityplatform.commons.authn-filter.jaspi-modules.*
+org.openidentityplatform.commons.bloomfilter.*
+org.openidentityplatform.commons.guice.*
+org.openidentityplatform.commons.http-framework.*
+org.openidentityplatform.commons.http-framework.examples.*
+org.openidentityplatform.commons.i18n-framework.*
+org.openidentityplatform.commons.json-crypto.*
+org.openidentityplatform.commons.json-ref.*
+org.openidentityplatform.commons.json-schema.*
+org.openidentityplatform.commons.launcher.*
+org.openidentityplatform.commons.persistit.*
+org.openidentityplatform.commons.script.*
+org.openidentityplatform.commons.selfservice.*
+org.openidentityplatform.commons.ui.*
+org.openidentityplatform.maven.plugins.*
+org.openidentityplatform.openam.*
+org.openidentityplatform.openam.auth.modules.*
+org.openidentityplatform.openam.shaded.*
+org.openidentityplatform.opendj.*
+org.openidentityplatform.openig.*
+org.openimaj.*
+org.openimaj.content.*
+org.openimaj.demos.*
+org.openimaj.hadoop.tools.*
+org.openimaj.hardware.*
+org.openimaj.storm.*
+org.openimaj.storm.tools.*
+org.openimaj.tools.*
+org.openingo.*
+org.openingo.boot.*
+org.openingo.kits.*
+org.openingo.spring.*
+org.openingo.starter.*
+org.openinstaller.*
+org.openjax.*
+org.openjax.codegen.*
+org.openjax.jaxb.*
+org.openjax.maven.*
+org.openjax.security.*
+org.openjax.xml.*
+org.openjdk.asmtools.*
+org.openjdk.jcstress.*
+org.openjdk.jmc.*
+org.openjdk.jmh.*
+org.openjdk.jol.*
+org.openjdk.nashorn.*
+org.openjfx.*
+org.openjsse.*
+org.openjsse.legacy8ujsse.*
+org.openjsse.openeddsa.*
+org.openkoreantext.*
+org.openksavi.sponge.*
+org.openl.*
+org.openl.jgit.*
+org.openl.rules.*
+org.openl.rules.demo.*
+org.openl.rules.ext.*
+org.openlabtesting.leveldbjni.*
+org.openlabtesting.netty.*
+org.openlabtesting.protobuf.*
+org.openlca.*
+org.openlcb.*
+org.openldap.*
+org.openlmis.*
+org.openlmis.mobile.*
+org.openlr.*
+org.openmama.*
+org.openmbee.mdk.magic.*
+org.openmbee.mms.*
+org.openmdx.*
+org.openmicroscopy.*
+org.openmined.kotlinsyft.*
+org.openml.*
+org.openmole.*
+org.openmole.endpoints4s.*
+org.openmole.gridscale.*
+org.openmole.library.*
+org.openmole.scaladget.*
+org.openmrs.maven.*
+org.openmrs.maven.archetypes.*
+org.openmrs.maven.plugins.*
+org.openmuc.*
+org.openmuc.framework.*
+org.opennms.*
+org.opennms.alec.*
+org.opennms.alec.assembly.*
+org.opennms.alec.datasource.*
+org.opennms.alec.driver.*
+org.opennms.alec.engine.*
+org.opennms.alec.features.*
+org.opennms.alec.features.graph.*
+org.opennms.alec.integrations.*
+org.opennms.alec.integrations.opennms.*
+org.opennms.alec.integrations.opennms.sink.*
+org.opennms.alec.wrap.*
+org.opennms.bundles.*
+org.opennms.catheter.*
+org.opennms.core.*
+org.opennms.core.health.*
+org.opennms.core.ipc.rpc.*
+org.opennms.core.ipc.sink.*
+org.opennms.core.ipc.twin.*
+org.opennms.core.jmx.*
+org.opennms.core.mate.*
+org.opennms.core.snmp.*
+org.opennms.core.test-api.*
+org.opennms.core.test-api.schema.*
+org.opennms.core.tracing.*
+org.opennms.core.wsman.*
+org.opennms.elasticsearch.*
+org.opennms.extremecomponents.*
+org.opennms.features.activemq.*
+org.opennms.features.alarms.history.*
+org.opennms.features.alarms.history.rest.*
+org.opennms.features.bsm.*
+org.opennms.features.collection.*
+org.opennms.features.config.dao.*
+org.opennms.features.config.rest.*
+org.opennms.features.config.service.*
+org.opennms.features.device-config.*
+org.opennms.features.device-config.persistence.*
+org.opennms.features.distributed.*
+org.opennms.features.dnsresolver.*
+org.opennms.features.endpoints.grafana.*
+org.opennms.features.endpoints.grafana.persistence.*
+org.opennms.features.enlinkd.*
+org.opennms.features.events.*
+org.opennms.features.flows.*
+org.opennms.features.flows.classification.engine.*
+org.opennms.features.flows.classification.persistence.*
+org.opennms.features.flows.rest.*
+org.opennms.features.geocoder.*
+org.opennms.features.geolocation.*
+org.opennms.features.graph.*
+org.opennms.features.graph.dao.*
+org.opennms.features.graph.rest.*
+org.opennms.features.graphml.*
+org.opennms.features.measurements.*
+org.opennms.features.notifications.*
+org.opennms.features.nrtg.*
+org.opennms.features.openconfig.*
+org.opennms.features.poller.*
+org.opennms.features.provisioning.*
+org.opennms.features.reporting.*
+org.opennms.features.scv.*
+org.opennms.features.search.*
+org.opennms.features.situation-feedback.*
+org.opennms.features.situation-feedback.rest.*
+org.opennms.features.status.*
+org.opennms.features.telemetry.*
+org.opennms.features.telemetry.config.*
+org.opennms.features.telemetry.protocols.bmp.persistence.*
+org.opennms.features.ticketing.*
+org.opennms.features.timeformat.*
+org.opennms.features.topologies.*
+org.opennms.features.topology.*
+org.opennms.features.usageanalytics.*
+org.opennms.gizmo.*
+org.opennms.integration.api.*
+org.opennms.integration.api.sample.*
+org.opennms.nephron.*
+org.opennms.newts.*
+org.opennms.plugin.timeseries.cortex.wrap.*
+org.opennms.plugins.cloud.*
+org.opennms.plugins.cloud.assembly.*
+org.opennms.plugins.cloud.wrap.*
+org.opennms.plugins.opa.ticketing.*
+org.opennms.plugins.opa.ticketing.remedy.*
+org.opennms.plugins.opa.ticketing.remedy.assembly.*
+org.opennms.plugins.timeseries.*
+org.openntf.maven.*
+org.openntf.sbt.*
+org.openoffice.*
+org.openon.aannodoc.*
+org.openpcf.*
+org.openpnp.*
+org.openpolicyagent.kafka.*
+org.openpreservation.jhove.*
+org.openpreservation.jhove.modules.*
+org.openprovenance.prov.*
+org.openqa.selenium.*
+org.openqa.selenium.core.*
+org.openqa.selenium.grid.*
+org.openqa.selenium.server.*
+org.openrdf.*
+org.openrdf.sesame.*
+org.openrefine.*
+org.openrefine.dependencies.*
+org.openrewrite.*
+org.openrewrite.gradle.tooling.*
+org.openrewrite.maven.*
+org.openrewrite.meta.*
+org.openrewrite.plan.*
+org.openrewrite.recipe.*
+org.openrewrite.tools.*
+org.openrndr.*
+org.openrndr.extra.*
+org.openrndr.extra.gitarchiver.tomarkdown.*
+org.openrtb.*
+org.opensaml.*
+org.openscada.atlantis.*
+org.openscada.external.*
+org.openscada.ide.*
+org.openscada.jinterop.*
+org.openscada.utgard.*
+org.openscience.cdk.*
+org.openscm.kundo.*
+org.openscm.kundo.common.*
+org.openscm.kundo.kernel.*
+org.openscm.kundo.plugins.*
+org.openscoring.*
+org.opensearch.*
+org.opensearch.client.*
+org.opensearch.client.test.*
+org.opensearch.dataprepper.*
+org.opensearch.distribution.integ-test-zip.*
+org.opensearch.driver.*
+org.opensearch.gradle.*
+org.opensearch.plugin.*
+org.opensearch.sandbox.*
+org.opensearch.sdk.*
+org.opensearch.test.*
+org.opensextant.*
+org.opensimulationsystems.cabsf.*
+org.opensingular.*
+org.opensky-network.*
+org.opensmarthouse.*
+org.opensmarthouse.core.*
+org.opensmarthouse.core.bom.*
+org.opensmarthouse.core.bundles.*
+org.opensmarthouse.core.features.*
+org.opensmarthouse.core.features.karaf.*
+org.opensmarthouse.ui.*
+org.opensmarthouse.ui.bom.*
+org.opensmarthouse.ui.bundles.*
+org.opensmarthouse.ui.features.*
+org.opensmpp.*
+org.opensocial.explorer.*
+org.opensourcebim.*
+org.openspml.*
+org.openstates.*
+org.openstrategies.*
+org.openstreetmap.atlas.*
+org.openstreetmap.josm.*
+org.openstreetmap.josm.gradle-josm-plugin.*
+org.openstreetmap.osmosis.*
+org.openstreetmap.pbf.*
+org.opensymphony.quartz.*
+org.opentcs.*
+org.opentcs.commadapter.vehicle.vda5050.*
+org.opentcs.thirdparty.dockingframes.*
+org.opentcs.thirdparty.jhotdraw.*
+org.opentdk.*
+org.opentelecoms.client.launch.*
+org.opentelecoms.ddds.*
+org.opentelecoms.gsm0348.*
+org.opentelecoms.ice.*
+org.opentelecoms.sdp.*
+org.opentelecoms.sip.*
+org.opentelecoms.util.*
+org.opentelecoms.zrtp.*
+org.opentest4j.*
+org.opentest4j.reporting.*
+org.opentorah.*
+org.opentrafficsim.*
+org.opentripplanner.*
+org.openucx.*
+org.openurp.*
+org.openurp.app.*
+org.openurp.base.*
+org.openurp.boot.*
+org.openurp.code.*
+org.openurp.degree.*
+org.openurp.edu.*
+org.openurp.edu.award.*
+org.openurp.edu.base.*
+org.openurp.edu.clazz.*
+org.openurp.edu.course.*
+org.openurp.edu.curricula.*
+org.openurp.edu.evaluation.*
+org.openurp.edu.exam.*
+org.openurp.edu.extern.*
+org.openurp.edu.fee.*
+org.openurp.edu.finalmakeup.*
+org.openurp.edu.grade.*
+org.openurp.edu.graduation.*
+org.openurp.edu.innovation.*
+org.openurp.edu.learning.*
+org.openurp.edu.lesson.*
+org.openurp.edu.otherexam.*
+org.openurp.edu.portal.*
+org.openurp.edu.program.*
+org.openurp.edu.quality.*
+org.openurp.edu.room.*
+org.openurp.edu.spa.*
+org.openurp.edu.std.*
+org.openurp.edu.student.*
+org.openurp.edu.teach.*
+org.openurp.edu.textbook.*
+org.openurp.edu.warning.*
+org.openurp.edu.workload.*
+org.openurp.hr.*
+org.openurp.hr.base.*
+org.openurp.hr.contact.*
+org.openurp.hr.info.*
+org.openurp.lg.*
+org.openurp.lg.room.*
+org.openurp.people.*
+org.openurp.people.base.*
+org.openurp.people.contact.*
+org.openurp.people.info.*
+org.openurp.platform.*
+org.openurp.platform.api.*
+org.openurp.platform.core.*
+org.openurp.platform.kernel.*
+org.openurp.platform.portal.*
+org.openurp.platform.security.*
+org.openurp.portal.*
+org.openurp.prac.*
+org.openurp.prac.innovation.*
+org.openurp.prac.la.*
+org.openurp.qos.*
+org.openurp.qos.evaluation.*
+org.openurp.qos.std.*
+org.openurp.rd.*
+org.openurp.sin.*
+org.openurp.sin.base.*
+org.openurp.sin.harvest.*
+org.openurp.spa.*
+org.openurp.spa.doc.*
+org.openurp.starter.*
+org.openurp.std.*
+org.openurp.std.alter.*
+org.openurp.std.base.*
+org.openurp.std.creditbank.*
+org.openurp.std.exchange.*
+org.openurp.std.fee.*
+org.openurp.std.graduation.*
+org.openurp.std.info.*
+org.openurp.std.job.*
+org.openurp.std.register.*
+org.openurp.std.registration.*
+org.openurp.std.signup.*
+org.openurp.std.transfer.*
+org.openurp.stu.*
+org.openurp.stu.award.*
+org.openurp.stu.job.*
+org.openurp.theme.*
+org.openurp.trd.*
+org.openurp.ws.services.teach.*
+org.openwebtop.maven.plugins.*
+org.openwfe.*
+org.openwms.*
+org.openwms.plugins.*
+org.openxava.*
+org.openxdm.xcap.*
+org.openxri.*
+org.openziti.*
+org.opf-labs.planets.*
+org.opfab.*
+org.opoo.maven.*
+org.opoo.ootp.*
+org.opoo.press.*
+org.opoo.press.maven.archetypes.*
+org.opoo.press.maven.plugins.*
+org.opoo.press.maven.wagon.*
+org.opoo.press.themes.*
+org.ops4j.*
+org.ops4j.base.*
+org.ops4j.dadl.*
+org.ops4j.gaderian.*
+org.ops4j.gaderian.tools.*
+org.ops4j.orient.*
+org.ops4j.orient.itest.*
+org.ops4j.orient.samples.*
+org.ops4j.pax.*
+org.ops4j.pax.carrot.*
+org.ops4j.pax.carrot.samples.*
+org.ops4j.pax.cdi.*
+org.ops4j.pax.cdi.fragment.*
+org.ops4j.pax.cdi.samples.*
+org.ops4j.pax.confman.*
+org.ops4j.pax.construct.*
+org.ops4j.pax.exam.*
+org.ops4j.pax.exam.archetypes.*
+org.ops4j.pax.exam.samples.*
+org.ops4j.pax.jdbc.*
+org.ops4j.pax.jms.*
+org.ops4j.pax.jpa.*
+org.ops4j.pax.jpa.samples.*
+org.ops4j.pax.keycloak.*
+org.ops4j.pax.logging.*
+org.ops4j.pax.logging.karaf.*
+org.ops4j.pax.runner.*
+org.ops4j.pax.scanner.*
+org.ops4j.pax.shiro.*
+org.ops4j.pax.shiro.itest.*
+org.ops4j.pax.shiro.samples.*
+org.ops4j.pax.swissbox.*
+org.ops4j.pax.swissbox.samples.*
+org.ops4j.pax.tinybundles.*
+org.ops4j.pax.tipi.*
+org.ops4j.pax.transx.*
+org.ops4j.pax.url.*
+org.ops4j.pax.url.itest.*
+org.ops4j.pax.warp.*
+org.ops4j.pax.warp.itest.*
+org.ops4j.pax.warp.maven.*
+org.ops4j.pax.web.*
+org.ops4j.pax.web.archetypes.*
+org.ops4j.pax.web.itest.*
+org.ops4j.pax.web.itest.container.*
+org.ops4j.pax.web.samples.*
+org.ops4j.pax.web.samples.web-fragment.*
+org.ops4j.pax.wicket.*
+org.ops4j.pax.wicket.samples.*
+org.ops4j.pax.wicket.samples.blueprint.*
+org.ops4j.pax.wicket.samples.blueprint.injection.*
+org.ops4j.pax.wicket.samples.ds.*
+org.ops4j.pax.wicket.samples.edge.*
+org.ops4j.pax.wicket.samples.edge.inheritinjection.*
+org.ops4j.pax.wicket.samples.mixed.*
+org.ops4j.pax.wicket.samples.model.*
+org.ops4j.pax.wicket.samples.plain.*
+org.ops4j.pax.wicket.samples.service.*
+org.ops4j.pax.wicket.samples.springdm.*
+org.ops4j.pax.wicket.samples.springdm.injection.*
+org.ops4j.pax.wicket.samples.view.*
+org.ops4j.pax.wicket.spi.*
+org.ops4j.peaberry.*
+org.ops4j.peaberry.build.*
+org.ops4j.peaberry.extensions.*
+org.ops4j.ramler.*
+org.ops4j.ramler.samples.*
+org.ops4j.resources.*
+org.ops4j.tools.*
+org.ops4j.tools.maven.*
+org.ops4j.xvisitor.*
+org.opt4j.*
+org.optaplanner.*
+org.optaplanner.openshift.*
+org.orangepalantir.*
+org.orbisgis.*
+org.orbisgis.data.*
+org.orbit-mvi.*
+org.orbroker.*
+org.orcateam.*
+org.orcid.*
+org.orderofthebee.support-tools.*
+org.orekit.*
+org.org-libs.*
+org.organicdesign.*
+org.organicdesign.indented.*
+org.organicdesign.testUtils.*
+org.orienteer.*
+org.orienteer.camel.component.*
+org.orienteer.jnpm.*
+org.orienteer.transponder.*
+org.orienteer.wicket-bpmn-io.*
+org.orienteer.wicket-jersey.*
+org.oris-tool.*
+org.oscy.*
+org.oser.tools.jdbc.*
+org.osframework.testng.*
+org.osframework.util.*
+org.osgeo.*
+org.osgi.*
+org.osgi.enroute.*
+org.osgi.enroute.archetype.*
+org.osgi.enroute.examples.*
+org.osgi.enroute.examples.microservice.*
+org.osgi.enroute.examples.quickstart.*
+org.osgilab.bundles.*
+org.osgilab.bundles.shell.*
+org.osgilab.testing.*
+org.osgl.*
+org.osiam.*
+org.osmdroid.*
+org.oss4ita.maven.superpom.*
+org.oss4j.maven.master.*
+org.ossgang.*
+org.ostermiller.*
+org.otcframework.*
+org.otcl2.*
+org.otclfoundation.*
+org.otheruse.*
+org.outerj.daisy.*
+org.outerj.xreporter.*
+org.outsideMyBox.*
+org.overbeck.*
+org.overturetool.*
+org.overturetool.astcreator.*
+org.overturetool.build.*
+org.overturetool.core.*
+org.overturetool.core.annotations.*
+org.overturetool.core.codegen.*
+org.overturetool.core.combinatorialtesting.*
+org.overturetool.core.modelcheckers.*
+org.overturetool.core.prettyprinting.*
+org.overturetool.documentation.*
+org.overturetool.ide.*
+org.overturetool.ide.builders.*
+org.overturetool.ide.features.*
+org.overturetool.ide.parsers.*
+org.overturetool.ide.plugins.*
+org.overturetool.ide.plugins.features.*
+org.overturetool.ide.vdmpp.*
+org.overturetool.ide.vdmrt.*
+org.overturetool.ide.vdmsl.*
+org.overturetool.tools.*
+org.overviewproject.*
+org.ovirt.engine.api.*
+org.ovirt.engine.sdk.*
+org.ovirt.java-client-kubevirt.*
+org.ovirt.maven.plugins.*
+org.ovirt.otopi.*
+org.ovirt.ovirt-host-deploy.*
+org.ovirt.vdsm-jsonrpc-java.*
+org.ovirt.vdsm-jsonrpc-java.root.1.1.6.org.ovirt.vdsm-jsonrpc-java.*
+org.ovirt.vdsm-jsonrpc-java.root.1.1.6.root.org.ovirt.vdsm-jsonrpc-java.*
+org.ovirt.vdsm-jsonrpc-java.vdsm-jsonrpc-java-client.1.1.6.client.org.ovirt.vdsm-jsonrpc-java.*
+org.ovirt.vdsm-jsonrpc-java.vdsm-jsonrpc-java-client.1.1.6.org.ovirt.vdsm-jsonrpc-java.*
+org.ow2.*
+org.ow2.asm.*
+org.ow2.authzforce.*
+org.ow2.bonita.*
+org.ow2.bonita.engine.*
+org.ow2.bundles.*
+org.ow2.carol.*
+org.ow2.carol.cmi.*
+org.ow2.carol.irmi.*
+org.ow2.chameleon.*
+org.ow2.chameleon.chat.*
+org.ow2.chameleon.commons.bluecove.*
+org.ow2.chameleon.commons.hamcrest.*
+org.ow2.chameleon.commons.junit.*
+org.ow2.chameleon.commons.miglayout.*
+org.ow2.chameleon.database.*
+org.ow2.chameleon.fuchsia.*
+org.ow2.chameleon.fuchsia.base.*
+org.ow2.chameleon.fuchsia.base.json-rpc.*
+org.ow2.chameleon.fuchsia.base.knx.*
+org.ow2.chameleon.fuchsia.base.philips-hue.*
+org.ow2.chameleon.fuchsia.base.protobuffer.*
+org.ow2.chameleon.fuchsia.base.push.*
+org.ow2.chameleon.fuchsia.discovery.*
+org.ow2.chameleon.fuchsia.examples.*
+org.ow2.chameleon.fuchsia.exporter.*
+org.ow2.chameleon.fuchsia.importer.*
+org.ow2.chameleon.fuchsia.importer.jaxrpc.*
+org.ow2.chameleon.fuchsia.importer.jaxws.*
+org.ow2.chameleon.fuchsia.importer.push.*
+org.ow2.chameleon.fuchsia.push.*
+org.ow2.chameleon.fuchsia.testing.*
+org.ow2.chameleon.fuchsia.tools.*
+org.ow2.chameleon.i18n.*
+org.ow2.chameleon.json.*
+org.ow2.chameleon.mail.*
+org.ow2.chameleon.management.*
+org.ow2.chameleon.naming.*
+org.ow2.chameleon.org.junit.paxexam.*
+org.ow2.chameleon.rose.*
+org.ow2.chameleon.rose.atmosphere.*
+org.ow2.chameleon.rose.jms.*
+org.ow2.chameleon.rose.jsonrpc.*
+org.ow2.chameleon.rose.jsonrpc.endpoint.*
+org.ow2.chameleon.rose.rest.*
+org.ow2.chameleon.rose.ws.*
+org.ow2.chameleon.sharedprefs.*
+org.ow2.chameleon.syndication.*
+org.ow2.chameleon.testing.*
+org.ow2.chameleon.twitter.*
+org.ow2.chameleon.urlshortener.*
+org.ow2.clif.*
+org.ow2.clif.isac.*
+org.ow2.cmi.*
+org.ow2.cmi.doc.*
+org.ow2.cmi.osgi.*
+org.ow2.contrail.*
+org.ow2.contrail.federation.*
+org.ow2.docdoku.*
+org.ow2.dragon.*
+org.ow2.easybeans.*
+org.ow2.easybeans.classloader.*
+org.ow2.easybeans.console.*
+org.ow2.easybeans.doc.*
+org.ow2.easybeans.examples.maven.*
+org.ow2.easybeans.examples.maven.ear.*
+org.ow2.easybeans.examples.maven.jpa2.*
+org.ow2.easybeans.extensions.*
+org.ow2.easybeans.itests.*
+org.ow2.easybeans.osgi.*
+org.ow2.easybeans.persistence.*
+org.ow2.easybeans.tests.*
+org.ow2.easybeans.utils.*
+org.ow2.easycommons.*
+org.ow2.easywsdl.*
+org.ow2.easywsdl.extensions.*
+org.ow2.fastrmic.*
+org.ow2.fractal.*
+org.ow2.fractal.bf.*
+org.ow2.fractal.bf.binjiu.*
+org.ow2.fractal.bf.binjiu.description.*
+org.ow2.fractal.bf.binjiu.runtime.*
+org.ow2.fractal.bf.connectors.*
+org.ow2.fractal.bf.examples.*
+org.ow2.fractal.bf.examples.amazon.*
+org.ow2.fractal.bf.examples.meteo.*
+org.ow2.fractal.bf.itests.*
+org.ow2.fractal.bf.testing.*
+org.ow2.fractal.distribution.*
+org.ow2.fractal.distribution.doc.*
+org.ow2.fractal.distribution.parent.*
+org.ow2.fractal.julia.*
+org.ow2.fractal.julia.osgi.*
+org.ow2.fractal.juliac.*
+org.ow2.fractal.juliac.adlet.*
+org.ow2.fractal.juliac.dream.*
+org.ow2.fractal.juliac.fraclet.*
+org.ow2.fractal.juliac.osa.*
+org.ow2.fractal.juliac.osgi.*
+org.ow2.fractal.juliac.scala.*
+org.ow2.fractal.juliac.tinfi.*
+org.ow2.frascati.*
+org.ow2.frascati.examples.*
+org.ow2.frascati.examples.native.*
+org.ow2.frascati.examples.scala.*
+org.ow2.frascati.examples.test.*
+org.ow2.frascati.factory.*
+org.ow2.frascati.intent.*
+org.ow2.frascati.model.*
+org.ow2.frascati.mojo.*
+org.ow2.frascati.native.*
+org.ow2.frascati.tinfi.*
+org.ow2.frascati.tinfi.examples.*
+org.ow2.frascati.tinfi.juliet.*
+org.ow2.frascati.tinfi.osgi.*
+org.ow2.frascati.tinfi.tinfi-mixed.*
+org.ow2.frascati.transaction.*
+org.ow2.frascati.upnp.*
+org.ow2.fusiondirectory.*
+org.ow2.infra.*
+org.ow2.ipojo.*
+org.ow2.ishmael.*
+org.ow2.jasmine.*
+org.ow2.jasmine.deployme.*
+org.ow2.jasmine.design.*
+org.ow2.jasmine.documentation.*
+org.ow2.jasmine.drools.*
+org.ow2.jasmine.drools.manager.*
+org.ow2.jasmine.jade.*
+org.ow2.jasmine.jade.assemblies.*
+org.ow2.jasmine.jade.control.*
+org.ow2.jasmine.jade.fractal.deployment.local.*
+org.ow2.jasmine.jade.fractal.fractalrmi.*
+org.ow2.jasmine.jade.wrapper.*
+org.ow2.jasmine.jadort-samples.*
+org.ow2.jasmine.kerneos.*
+org.ow2.jasmine.monitoring.*
+org.ow2.jasmine.monitoring.jasmine-monitoring-integration-tests-modules.*
+org.ow2.jasmine.probe.*
+org.ow2.jasmine.probe.itests-modules.*
+org.ow2.jasmine.rules.*
+org.ow2.jonas.*
+org.ow2.jonas.admin.*
+org.ow2.jonas.agent.*
+org.ow2.jonas.asm.*
+org.ow2.jonas.assemblies.*
+org.ow2.jonas.assemblies.profiles.*
+org.ow2.jonas.assemblies.profiles.addons.*
+org.ow2.jonas.assemblies.profiles.legacy.*
+org.ow2.jonas.autostart.*
+org.ow2.jonas.autostart.plugin.*
+org.ow2.jonas.camel.*
+org.ow2.jonas.cxf.transport.mdb.*
+org.ow2.jonas.cxf.transport.reliablejms.*
+org.ow2.jonas.documentation.*
+org.ow2.jonas.installer.rpm.*
+org.ow2.jonas.jonas-itests-applications-jaxb2.*
+org.ow2.jonas.jonas-itests-applications-jaxws-add.*
+org.ow2.jonas.jonas-itests-applications-jaxws-add.assemblies.*
+org.ow2.jonas.jpaas.*
+org.ow2.jonas.jpaas.agent.*
+org.ow2.jonas.jpaas.apache-manager.*
+org.ow2.jonas.jpaas.catalog.*
+org.ow2.jonas.jpaas.iaas-manager.*
+org.ow2.jonas.jpaas.iaas-manager.providers.*
+org.ow2.jonas.jpaas.jpaas-api.*
+org.ow2.jonas.jpaas.jpaas-application-manager.*
+org.ow2.jonas.jpaas.jpaas-controller.*
+org.ow2.jonas.jpaas.jpaas-environment-manager.*
+org.ow2.jonas.jpaas.jpaas-manager-api.*
+org.ow2.jonas.jpaas.naming-manager.*
+org.ow2.jonas.jpaas.resource-pool.*
+org.ow2.jonas.jpaas.system-representation.*
+org.ow2.jonas.jpaas.util.*
+org.ow2.jonas.jpaas.util.cloud-desc.*
+org.ow2.jonas.jpaas.vm-configurator.*
+org.ow2.jonas.jpaas.vm-configurator.providers.*
+org.ow2.jonas.launchers.*
+org.ow2.jonas.osgi.*
+org.ow2.jonas.tools.*
+org.ow2.jonas.tools.configurator.*
+org.ow2.jonas.tools.maven.*
+org.ow2.jonas.wrapper.*
+org.ow2.joram.*
+org.ow2.jotm.*
+org.ow2.jotm.assemblies.*
+org.ow2.kerneos.*
+org.ow2.kerneos.graniteds-osgi.*
+org.ow2.kerneos.graniteds.*
+org.ow2.legal.*
+org.ow2.lewys.*
+org.ow2.maven.skin.*
+org.ow2.maven.skins.*
+org.ow2.mind.*
+org.ow2.monolog.*
+org.ow2.novabpm.*
+org.ow2.novabpm.admin.*
+org.ow2.odis.*
+org.ow2.opensuit.*
+org.ow2.orchestra.*
+org.ow2.orchestra.common.*
+org.ow2.orchestra.console.*
+org.ow2.orchestra.designer.*
+org.ow2.orchestra.distrib.*
+org.ow2.orchestra.eclipse.*
+org.ow2.orchestra.eclipse.birt.*
+org.ow2.orchestra.eclipse.core.*
+org.ow2.orchestra.eclipse.datatools.*
+org.ow2.orchestra.eclipse.emf.*
+org.ow2.orchestra.eclipse.equinox.*
+org.ow2.orchestra.eclipse.osgi.*
+org.ow2.orchestra.installer.izpack.*
+org.ow2.orchestra.reporting.*
+org.ow2.petals.*
+org.ow2.petals.activiti.*
+org.ow2.petals.cloud.*
+org.ow2.petals.distribution.*
+org.ow2.petals.dsb.*
+org.ow2.petals.dsb.distribution.*
+org.ow2.petals.flowable.*
+org.ow2.petals.jsr181.*
+org.ow2.petals.registry.*
+org.ow2.petals.samples.*
+org.ow2.petals.samples.activiti.*
+org.ow2.petals.samples.camel.*
+org.ow2.petals.samples.eip.*
+org.ow2.petals.samples.filetransfer.*
+org.ow2.petals.samples.flowable.*
+org.ow2.petals.samples.ftp.*
+org.ow2.petals.samples.gateway.*
+org.ow2.petals.samples.helloworld.*
+org.ow2.petals.samples.jms.*
+org.ow2.petals.samples.jsr181.*
+org.ow2.petals.samples.mail.*
+org.ow2.petals.samples.mail.gmail.*
+org.ow2.petals.samples.mail.laposte.*
+org.ow2.petals.samples.mapping.*
+org.ow2.petals.samples.orchestra.*
+org.ow2.petals.samples.pojo.*
+org.ow2.petals.samples.quartz.*
+org.ow2.petals.samples.rest.*
+org.ow2.petals.samples.rest.edm.*
+org.ow2.petals.samples.rest.woa-soa.*
+org.ow2.petals.samples.sftp.*
+org.ow2.petals.samples.sql.*
+org.ow2.petals.samples.talend.*
+org.ow2.petals.samples.validation.*
+org.ow2.petals.samples.xslt.*
+org.ow2.petals.sandbox.*
+org.ow2.petals.se.talend.*
+org.ow2.petals.sl.ejb.*
+org.ow2.petals.sl.ejb.easybeans.*
+org.ow2.petals.sl.ejb.jboss.*
+org.ow2.petals.sl.ejb.oc4j.*
+org.ow2.petals.sl.jdbc.*
+org.ow2.petals.sl.jdbc.hsql.*
+org.ow2.petals.sl.jdbc.mysql.*
+org.ow2.petals.sl.jms.*
+org.ow2.petals.tools.*
+org.ow2.petals.tools.rmi.*
+org.ow2.petals.wsstar.*
+org.ow2.petals.wsstar.oasis-ws-basefaults.*
+org.ow2.petals.wsstar.oasis-ws-basenotification.*
+org.ow2.petals.wsstar.oasis-ws-resource.*
+org.ow2.petals.wsstar.oasis-ws-resourcelifetime.*
+org.ow2.petals.wsstar.oasis-ws-resourceproperties.*
+org.ow2.petals.wsstar.oasis-ws-topics.*
+org.ow2.play.*
+org.ow2.proactive.*
+org.ow2.sat4j.*
+org.ow2.scarbo.*
+org.ow2.scarbo.runtime.*
+org.ow2.scarbo.service.*
+org.ow2.shelbie.*
+org.ow2.shelbie.commands.*
+org.ow2.sirocco.*
+org.ow2.sirocco.apis.*
+org.ow2.sirocco.cimi.*
+org.ow2.sirocco.cloudmanager.*
+org.ow2.sirocco.vmm.*
+org.ow2.sirocco.vmware.vcloud.*
+org.ow2.spec.*
+org.ow2.spec.ee.*
+org.ow2.spec.harness.*
+org.ow2.spec.osgi.*
+org.ow2.util.*
+org.ow2.util.annotation-processor.*
+org.ow2.util.ant.*
+org.ow2.util.archive.*
+org.ow2.util.asm.*
+org.ow2.util.audit.*
+org.ow2.util.base64.*
+org.ow2.util.bundles.*
+org.ow2.util.cluster.*
+org.ow2.util.component.*
+org.ow2.util.deploy.*
+org.ow2.util.ee.builders.*
+org.ow2.util.event.*
+org.ow2.util.execution.*
+org.ow2.util.file.*
+org.ow2.util.geo.*
+org.ow2.util.i18n.*
+org.ow2.util.jmx.*
+org.ow2.util.log.*
+org.ow2.util.marshalling.*
+org.ow2.util.maven.*
+org.ow2.util.maven.osgi.*
+org.ow2.util.merge.*
+org.ow2.util.metadata.*
+org.ow2.util.osgi-toolkit.*
+org.ow2.util.plan.*
+org.ow2.util.pool.*
+org.ow2.util.protocol.*
+org.ow2.util.scan.*
+org.ow2.util.security.*
+org.ow2.util.stream.*
+org.ow2.util.substitution.*
+org.ow2.util.url.*
+org.ow2.util.xml.*
+org.ow2.util.xmlconfig.*
+org.ow2.weblab.*
+org.ow2.weblab.components.*
+org.ow2.weblab.components.content.webdav.*
+org.ow2.weblab.core.*
+org.ow2.weblab.core.helpers.*
+org.ow2.weblab.helper.*
+org.ow2.weblab.iterator.*
+org.ow2.weblab.petals.*
+org.ow2.weblab.portlets.*
+org.ow2.weblab.service.*
+org.ow2.weblab.services.*
+org.ow2.weblab.tools.*
+org.ow2.weblab.tools.maven.*
+org.ow2.weblab.webservices.*
+org.ow2.wildcat.*
+org.ow2.xlcloud.*
+org.ow2.xlcloud.xms.*
+org.ow2.xlcloud.xms.console.*
+org.ow2.xlcloud.xms.console.themes.*
+org.ow2.xlcloud.xsa.*
+org.ow2.xlcloud.xsa.ext.*
+org.ow2.xlcloud.xsa.ext.hpc.*
+org.ow2.xlcloud.xsa.ext.rr.*
+org.owasp.*
+org.owasp.antisamy.*
+org.owasp.appsensor.*
+org.owasp.encoder.*
+org.owasp.esapi.*
+org.owasp.esapi.contrib.*
+org.owasp.jbrofuzz.*
+org.owasp.maven-tools.*
+org.owasp.maven.enforcer.*
+org.owasp.passfault.*
+org.owasp.safetypes.*
+org.owasp.webgoat.*
+org.owfs.*
+org.oxbow.*
+org.oxerr.*
+org.oxerr.commons.*
+org.oxerr.de.onyxbits.giftedmotion.*
+org.oxerr.httpcomponents.*
+org.oxerr.ipyy.*
+org.oxerr.jackson.module.*
+org.oxerr.rescu.*
+org.oxerr.rescu.ext.*
+org.oxerr.seatgeek.*
+org.oxerr.seatgeek.client.*
+org.oxerr.seatgeek.client.cached.*
+org.oxerr.spring.boot.*
+org.oxerr.spring.cache.redis.scored.*
+org.oxerr.spring.security.*
+org.oxerr.spring.security.guest.*
+org.oxerr.spring.security.guest.samples.*
+org.oxerr.spring.security.otp.*
+org.oxerr.spring.security.otp.samples.*
+org.oxerr.spring.security.phone.*
+org.oxerr.spring.security.phone.samples.*
+org.oxerr.spring.security.wechat.*
+org.oxerr.spring.security.wechat.samples.*
+org.oxerr.taobao.*
+org.oxerr.ticket.inventory.support.*
+org.oxerr.ticket.inventory.support.cached.*
+org.oxerr.viagogo.*
+org.oxerr.viagogo.cached.*
+org.oxerr.webmagic.proxy.*
+org.ozoneplatform.*
+org.ozwillo.datacore.*
+org.pac4j.*
+org.pac4j.jax-rs.*
+org.pacesys.*
+org.pacesys.openstack4j.connectors.*
+org.pacesys.openstack4j.plugins.*
+org.padler.*
+org.pagemodel.*
+org.pageobject.*
+org.pageobject.patch.org.scalatest.*
+org.pageseeder.*
+org.pageseeder.bastille.*
+org.pageseeder.berlioz.*
+org.pageseeder.bridge.*
+org.pageseeder.cobble.*
+org.pageseeder.diffx.*
+org.pageseeder.docx.*
+org.pageseeder.epub.*
+org.pageseeder.flint.*
+org.pageseeder.furi.*
+org.pageseeder.oauth.*
+org.pageseeder.ox.*
+org.pageseeder.pdf.*
+org.pageseeder.schematron.*
+org.pageseeder.smith.*
+org.pageseeder.webhook.client.*
+org.pageseeder.xlsx.*
+org.pageseeder.xmldoclet.*
+org.pageseeder.xmlwriter.*
+org.paleozogt.*
+org.palladiosimulator.*
+org.palscash.*
+org.paltest.*
+org.panda-lang.*
+org.panda-lang.utilities.*
+org.paninij.*
+org.panteleyev.*
+org.pantsbuild.*
+org.pantsbuild.jarjar.*
+org.pantsbuild.tools.compiler.*
+org.papaja.*
+org.papoose.*
+org.papoose.bootstrap.*
+org.papoose.cmpn.*
+org.papoose.osgi.*
+org.papoose.plugins.*
+org.papoose.test.bundles.*
+org.paradisehell.convex.*
+org.paradox.*
+org.parallelj.*
+org.parancoe.*
+org.parboiled.*
+org.parceler.*
+org.parsky.*
+org.partiql.*
+org.parttio.*
+org.passay.*
+org.passwordmaker.*
+org.pathvisio.*
+org.patrodyne.*
+org.patrodyne.jvnet.*
+org.patternfly.*
+org.patterntesting.*
+org.patterntesting.samples.*
+org.paumard.*
+org.paxml.*
+org.paylogic.*
+org.pbit.*
+org.pcap4j.*
+org.pcollections.*
+org.pdfsam.*
+org.pdfsam.rxjava3.*
+org.pdgen.*
+org.pdown.*
+org.pdxfinder.*
+org.peakframework.dt.*
+org.peekmoon.*
+org.peelframework.*
+org.pegdown.*
+org.pelotom.*
+org.pentaho.*
+org.pentaho.pentaho-commons.*
+org.pepsoft.jnbt.*
+org.pepsoft.utils.*
+org.pepsoft.worldpainter.*
+org.pepstock.*
+org.perf4j.*
+org.perfcake.*
+org.perfcake.weaver.*
+org.perfectable.*
+org.perfidix.*
+org.perfkit.sjk.parsers.*
+org.perfmon4j.*
+org.perfrepo.*
+org.permians.*
+org.perro-creek.*
+org.petuum.*
+org.pf4j.*
+org.pfsw.*
+org.pgdoc.*
+org.pgpainless.*
+org.pgscala.*
+org.pgscala.embedded.*
+org.pharmgkb.*
+org.pharosnet.*
+org.phenopackets.*
+org.phenopackets.phenopackettools.*
+org.phenoscape.*
+org.phoebus.*
+org.phoenixframe.*
+org.phyloref.*
+org.piangles.backbone.services.*
+org.piangles.core.*
+org.piangles.gateway.*
+org.piangles.test.*
+org.piaohao.*
+org.piax.*
+org.piccolo2d.*
+org.picketbox.*
+org.picketlink.*
+org.picketlink.distribution.*
+org.picketlink.docs.*
+org.picketlink.extensions.*
+org.picketlink.idm.*
+org.picketlink.idm.integration.*
+org.picketlink.idm.testsuite.*
+org.picketlink.product.*
+org.picketlink.social.*
+org.picketlink.social.as7.*
+org.picketlink.tools.forge.*
+org.picocontainer.*
+org.picocontainer.jetty.*
+org.picocontainer.persistence.*
+org.picocontainer.script.*
+org.picocontainer.web.*
+org.picoworks.*
+org.pidster.*
+org.pietschy.*
+org.pih.*
+org.pih.openmrs.*
+org.pinae.*
+org.pingel.*
+org.pinus4j.*
+org.pipecraft.pipes.*
+org.pipservices.*
+org.pircbotx.*
+org.pireco.*
+org.pistoiaalliance.helm.*
+org.pitest.*
+org.pitest.copy.*
+org.pitest.quickbuilder.*
+org.pivot4j.*
+org.piwik.*
+org.piwik.java.tracking.*
+org.pkaq.*
+org.pksprojects.mongodb.*
+org.planet42.*
+org.plannerstack.*
+org.platanios.*
+org.platfish.*
+org.playframework.anorm.*
+org.playorm.*
+org.ploin.pmf.*
+org.ploin.web.*
+org.plotly-scala.*
+org.plugface.*
+org.plukh.*
+org.plumelib.*
+org.plutext.*
+org.plutext.graph-convert.*
+org.ply-ct.*
+org.pmml4s.*
+org.pocketserver.*
+org.podval.tools.*
+org.pojava.*
+org.pojomatic.*
+org.polago.deployconf.*
+org.polago.maven.plugins.*
+org.polago.maven.shared.filtering.*
+org.poly-gamma.*
+org.polyfillservice.*
+org.polyforms.*
+org.polyglotted.*
+org.polyglotted.attributerepo.*
+org.polyjdbc.*
+org.polynote.*
+org.polypheny.*
+org.polystat.*
+org.polystat.odin.*
+org.polystat.org.polystat.*
+org.polystat.py2eo.*
+org.polyvariant.*
+org.polyvariant.scodec-java-classfile.*
+org.polyvariant.treesitter4s.*
+org.pongasoft.*
+org.popperfw.*
+org.poreid.*
+org.portable-scala.*
+org.portonvictor.*
+org.postgis.*
+org.postgresql.*
+org.pousse-cafe-framework.*
+org.powerapi.*
+org.powerflows.*
+org.powermock.*
+org.powermock.examples.*
+org.powermock.tests.*
+org.powernukkit.*
+org.powernukkit.bedrock.leveldb.*
+org.powernukkit.bedrock.network.*
+org.powernukkit.bedrock.protocol.*
+org.powernukkit.fastutil.*
+org.powerscala.*
+org.powertac.*
+org.pragmaticminds.crunch.*
+org.praxislive.*
+org.praxislive.libp5x.*
+org.prebid.*
+org.preesm.maven.*
+org.prefixcommons.*
+org.prefuse.*
+org.prelle.*
+org.prevayler.*
+org.prevayler.demos.*
+org.prevayler.extras.*
+org.prevayler.spikes.*
+org.primefaces.*
+org.primefaces.extensions.*
+org.privelt.*
+org.processing.*
+org.programmiersportgruppe.*
+org.programmiersportgruppe.akre.*
+org.programmiersportgruppe.jgoodies.*
+org.programmiersportgruppe.scala.commons.*
+org.progressify.*
+org.projectbarbel.*
+org.projectfloodlight.*
+org.projecthusky.*
+org.projecthusky.common.*
+org.projecthusky.communication.*
+org.projecthusky.fhir.*
+org.projecthusky.fhir.emed.ch.*
+org.projecthusky.fhir.structures.*
+org.projecthusky.validation.*
+org.projecthusky.validation.service.*
+org.projectlombok.*
+org.projectlombok.test.*
+org.projectnessie.*
+org.projectnessie.annotation-stripper.*
+org.projectnessie.buildsupport.*
+org.projectnessie.buildsupport.attach-test-jar.*
+org.projectnessie.buildsupport.checkstyle.*
+org.projectnessie.buildsupport.errorprone.*
+org.projectnessie.buildsupport.ide-integration.*
+org.projectnessie.buildsupport.jacoco-aggregator.*
+org.projectnessie.buildsupport.jacoco.*
+org.projectnessie.buildsupport.jandex.*
+org.projectnessie.buildsupport.protobuf.*
+org.projectnessie.buildsupport.publishing.*
+org.projectnessie.buildsupport.reflectionconfig.*
+org.projectnessie.buildsupport.spotless.*
+org.projectnessie.cel.*
+org.projectnessie.iceberg-catalog-migrator.*
+org.projectnessie.nessie-integrations.*
+org.projectnessie.nessie-runner.*
+org.projectnessie.nessie.*
+org.projectnessie.nessie.ui.*
+org.projectnessie.smallrye-open-api.*
+org.projectodd.*
+org.projectodd.jrapidoc.*
+org.projectodd.openshift.ping.*
+org.projectodd.openwhisk.*
+org.projectodd.rephract.*
+org.projectodd.shimdandy.*
+org.projectodd.shrinkwrap.descriptors.*
+org.projectodd.sockjs.*
+org.projectodd.stilts.*
+org.projectodd.vdx.*
+org.projectodd.wunderboss.*
+org.projectreactor.*
+org.projectreactor.spring.*
+org.projog.*
+org.prompto.*
+org.proshin.*
+org.protege.*
+org.protelis.*
+org.protobee.guice.*
+org.protokruft.*
+org.proton-di.*
+org.provarules.*
+org.provatesting.*
+org.proyecto-adalid.*
+org.proyecto-adalid.meta.*
+org.prx.*
+org.psjava.*
+org.psliwa.*
+org.psloboda.code.*
+org.psnively.*
+org.psywerx.hairyfotr.*
+org.pubcoi.fos.*
+org.pubcoi.schemas.*
+org.puimula.voikko.*
+org.pulloid.*
+org.purang.net.*
+org.purang.search.*
+org.purang.templates.*
+org.pure4j.*
+org.pure4s.*
+org.purejava.*
+org.puremvc.*
+org.puretemplate.*
+org.purplejrank.*
+org.pushing-pixels.*
+org.pushing-pixels.aurora.tools.svgtranscoder.gradle.*
+org.pushing-pixels.ignite.*
+org.pushing-pixels.radiance.tools.svgtranscoder.gradle.*
+org.pushingpixels.*
+org.pustefixframework.*
+org.pustefixframework.editor.*
+org.pustefixframework.logging.*
+org.pustefixframework.maven.archetypes.*
+org.pustefixframework.maven.plugins.*
+org.pustefixframework.samples.*
+org.pustefixframework.samples.modules.*
+org.pustefixframework.tutorial.*
+org.pustefixframework.webservices.*
+org.pyant.tasks.*
+org.pygments.*
+org.python.*
+org.pytorch.*
+org.pzdcdoc.*
+org.qamatic.*
+org.qatools.*
+org.qbicc.*
+org.qbicc.rt.*
+org.qcri.rheem.*
+org.qedeq.kernel.*
+org.qenherkhopeshef.*
+org.qi4j.*
+org.qi4j.core.*
+org.qi4j.extension.*
+org.qi4j.library.*
+org.qi4j.tool.*
+org.qianalyze.*
+org.qianalyze.sample.*
+org.qirx.*
+org.qjson.*
+org.qlrm.*
+org.qnixyz.*
+org.qooxdoo.*
+org.qsardb.*
+org.qsardb.cargo.*
+org.qsardb.conversion.*
+org.qsardb.resolution.*
+org.qsardb.storage.*
+org.quanqi.*
+org.quartz-scheduler.*
+org.quartz-scheduler.internal.*
+org.quasar-analytics.*
+org.quattor.maven.*
+org.quattor.pan.*
+org.quelea.*
+org.quelea.jpptviewlib.*
+org.querki.*
+org.querqy.*
+org.queryman.*
+org.questdb.*
+org.quickfixj.*
+org.quickfixj.orchestra.*
+org.quickgeo.*
+org.quickjava.core.*
+org.quickperf.*
+org.quickserver.*
+org.quicktheories.*
+org.quifft.*
+org.quilt.*
+org.quiltmc.*
+org.qunix.*
+org.quranalyze.*
+org.quteshell.*
+org.r10r.*
+org.r7c.maven.tools.*
+org.rabbit-converter.rabbit.*
+org.radarbase.*
+org.raidenjpa.*
+org.rainboyan.plugins.*
+org.rainboyan.profiles.*
+org.raistlic.lib.*
+org.rajawali3d.*
+org.ramani-maps.*
+org.raml.*
+org.raml.jaxrs.*
+org.raml.plugins.*
+org.randombits.confluence.*
+org.randombits.facade.*
+org.randombits.filtering.*
+org.randombits.math.*
+org.randombits.storage.*
+org.randombits.supplier.*
+org.randombits.support.*
+org.randombits.utils.*
+org.randomcat.*
+org.ranksys.*
+org.rapidoid.*
+org.rapidpm.*
+org.rapidpm.binarycache.*
+org.rapidpm.dynamic-cdi.*
+org.rapidpm.microservice.*
+org.rapidpm.modul.*
+org.rapidpm.proxybuilder.*
+org.rapidpm.vaadin.*
+org.rapla.*
+org.rarefiedredis.*
+org.rarefiedredis.redis.*
+org.rasdaman.*
+org.raspinloop.openmodelica.*
+org.raspinloop.server.*
+org.rassee.*
+org.rationalityfrontline.*
+org.rationalityfrontline.ktrader.*
+org.rationalityfrontline.workaround.*
+org.rauschig.*
+org.rawdarkroom.*
+org.raystack.*
+org.rcfaces.*
+org.rcsb.*
+org.rdfhdt.*
+org.rdlinux.*
+org.rdlinux.grp.*
+org.reactfx.*
+org.reactivebird.*
+org.reactivecommons.*
+org.reactivecommons.utils.*
+org.reactivemongo.*
+org.reactivestreams.*
+org.reactome.*
+org.reactome.base.*
+org.reactome.release.*
+org.reactormonk.*
+org.readium.kotlin-toolkit.*
+org.reaktivity.*
+org.realityforge.akasha.*
+org.realityforge.anodoc.*
+org.realityforge.arez.*
+org.realityforge.arez.browserlocation.*
+org.realityforge.arez.dom.*
+org.realityforge.arez.idlestatus.*
+org.realityforge.arez.mediaquery.*
+org.realityforge.arez.networkstatus.*
+org.realityforge.arez.persist.*
+org.realityforge.arez.promise.*
+org.realityforge.arez.spytools.*
+org.realityforge.arez.testng.*
+org.realityforge.arez.ticker.*
+org.realityforge.arez.timeddisposer.*
+org.realityforge.arez.when.*
+org.realityforge.bazel.depgen.*
+org.realityforge.braincheck.*
+org.realityforge.com.google.elemental2.*
+org.realityforge.com.google.gwt.*
+org.realityforge.com.google.jsinterop.*
+org.realityforge.com.google.web.bindery.*
+org.realityforge.dagger.*
+org.realityforge.galdr.*
+org.realityforge.gelf4j.*
+org.realityforge.geolatte.jpa.*
+org.realityforge.getopt4j.*
+org.realityforge.giggle.*
+org.realityforge.gir.*
+org.realityforge.glassfish.patcher.*
+org.realityforge.glassfish.timers.*
+org.realityforge.graphql.scalars.*
+org.realityforge.grim.*
+org.realityforge.guiceyloops.*
+org.realityforge.gwt.appcache.*
+org.realityforge.gwt.cache-filter.*
+org.realityforge.gwt.datatypes.*
+org.realityforge.gwt.eventsource.*
+org.realityforge.gwt.ga.*
+org.realityforge.gwt.gin.*
+org.realityforge.gwt.keycloak.*
+org.realityforge.gwt.lognice.*
+org.realityforge.gwt.mmvp.*
+org.realityforge.gwt.online.*
+org.realityforge.gwt.property-source.*
+org.realityforge.gwt.qr_code.*
+org.realityforge.gwt.serviceworker.*
+org.realityforge.gwt.symbolmap.*
+org.realityforge.gwt.webpoller.*
+org.realityforge.gwt.websockets.*
+org.realityforge.javaemul.internal.annotations.*
+org.realityforge.javax.annotation.*
+org.realityforge.jeo.*
+org.realityforge.jeo.geolatte.jpa.eclipselink.*
+org.realityforge.jml.*
+org.realityforge.jndikit.*
+org.realityforge.jsyslog-message.*
+org.realityforge.keycloak.client.authfilter.*
+org.realityforge.keycloak.converger.*
+org.realityforge.keycloak.domgen.*
+org.realityforge.keycloak.sks.*
+org.realityforge.org.jetbrains.annotations.*
+org.realityforge.proton.*
+org.realityforge.proxy-servlet.*
+org.realityforge.react.*
+org.realityforge.react4j.*
+org.realityforge.react4j.widget.*
+org.realityforge.react4j.windowportal.*
+org.realityforge.replicant.*
+org.realityforge.rest.criteria.*
+org.realityforge.rest.field_filter.*
+org.realityforge.revapi.diff.*
+org.realityforge.router.fu.*
+org.realityforge.shade.*
+org.realityforge.spritz.*
+org.realityforge.sqlserver.ssrs.*
+org.realityforge.sqlshell.*
+org.realityforge.ssf.*
+org.realityforge.sting.*
+org.realityforge.streak.*
+org.realityforge.swung-weave.*
+org.realityforge.timeservice.*
+org.realityforge.vecmath.*
+org.realityforge.webtack.*
+org.realityforge.zam.*
+org.realityforge.zemeckis.*
+org.realityforge.zifnab.*
+org.rebaze.*
+org.rebaze.integrity.*
+org.recast4j.*
+org.reco4j.*
+org.red5.*
+org.red5.demos.*
+org.reddwarfserver.*
+org.reddwarfserver.client.*
+org.reddwarfserver.ext.berkeleydb.*
+org.reddwarfserver.maven.plugin.*
+org.reddwarfserver.server.*
+org.reddwarfserver.tools.build.*
+org.reddwarfserver.tools.test.*
+org.redfx.*
+org.redis.*
+org.redisson.*
+org.redkale.*
+org.redkale.maven.plugins.*
+org.redkalex.*
+org.redkangaroo.maven.plugins.*
+org.redline-rpm.*
+org.rednoise.*
+org.redradishes.*
+org.redundent.*
+org.reduxkotlin.*
+org.reduxkotlin.redux-kotlin.*
+org.reekwest.*
+org.refact4j.*
+org.refcodes.*
+org.refeed.*
+org.reficio.*
+org.reflections.*
+org.reflexiveframework.*
+org.reflext.*
+org.regrest.*
+org.rekex.*
+org.reladev.quickdto.*
+org.relaxng.*
+org.reldb.*
+org.relxd.*
+org.remdev.android.*
+org.renci.*
+org.renci.ahab.*
+org.renci.io.swagger.*
+org.renci.node-agent2.*
+org.rendersnake.*
+org.reploop.*
+org.repodriller.*
+org.reprogle.*
+org.requirementsascode.*
+org.requirementsascode.act.*
+org.requirementsascode.being.*
+org.requs.*
+org.research-software.citation.*
+org.restcomm.*
+org.restcomm.camelgw.*
+org.restcomm.camelgw.docs.*
+org.restcomm.camelgw.docs.adminguide.*
+org.restcomm.camelgw.docs.installguide.*
+org.restcomm.camelgw.examples.*
+org.restcomm.cluster.*
+org.restcomm.commons.*
+org.restcomm.fsm.*
+org.restcomm.imscf.*
+org.restcomm.media.*
+org.restcomm.media.asr.*
+org.restcomm.media.client.*
+org.restcomm.media.client.jsr309.*
+org.restcomm.media.client.mgcp.*
+org.restcomm.media.codecs.*
+org.restcomm.media.controls.*
+org.restcomm.media.core.*
+org.restcomm.media.core.asr.*
+org.restcomm.media.core.codec.*
+org.restcomm.media.core.codec.opus.*
+org.restcomm.media.core.control.*
+org.restcomm.media.core.driver.*
+org.restcomm.media.core.driver.asr.*
+org.restcomm.media.core.resource.*
+org.restcomm.media.docs.*
+org.restcomm.media.drivers.*
+org.restcomm.media.drivers.asr.*
+org.restcomm.media.plugin.dtmf.*
+org.restcomm.media.plugin.vad.*
+org.restcomm.media.resources.*
+org.restcomm.media.server.*
+org.restcomm.media.server.docs.*
+org.restcomm.media.server.standalone.*
+org.restcomm.protocols.ss7.*
+org.restcomm.protocols.ss7.cap.*
+org.restcomm.protocols.ss7.congestion.*
+org.restcomm.protocols.ss7.hardware.*
+org.restcomm.protocols.ss7.inap.*
+org.restcomm.protocols.ss7.isup.*
+org.restcomm.protocols.ss7.m3ua.*
+org.restcomm.protocols.ss7.management.*
+org.restcomm.protocols.ss7.map.*
+org.restcomm.protocols.ss7.mtp.*
+org.restcomm.protocols.ss7.oam.*
+org.restcomm.protocols.ss7.oam.common.*
+org.restcomm.protocols.ss7.sccp.*
+org.restcomm.protocols.ss7.scheduler.*
+org.restcomm.protocols.ss7.sgw.*
+org.restcomm.protocols.ss7.ss7ext.*
+org.restcomm.protocols.ss7.statistics.*
+org.restcomm.protocols.ss7.tcap.*
+org.restcomm.protocols.ss7.tcapAnsi.*
+org.restcomm.protocols.ss7.tools.alarmlistener.*
+org.restcomm.protocols.ss7.tools.simulator.*
+org.restcomm.protocols.ss7.tools.traceparser.*
+org.restcomm.resources.*
+org.restcomm.servers.jainslee.jdbc.*
+org.restcomm.servers.jainslee.ss7.*
+org.restcomm.slee.resource.smpp.*
+org.restcomm.smpp.*
+org.restcomm.statistics.service.*
+org.restdoc.*
+org.resteasy.*
+org.restfeeds.*
+org.restheart.*
+org.resthub.*
+org.restler.*
+org.restnext.*
+org.revapi.*
+org.revapi.classif.*
+org.revapi.testjars.*
+org.revenj.*
+org.reveno.*
+org.rewedigital.katana.*
+org.rewedigital.voice.*
+org.rewedigital.voice.dialog.*
+org.rex-soft.*
+org.rfc8452.aead.*
+org.rfc8452.authenticator.*
+org.rgbtools.*
+org.rhq.*
+org.rhq.checkstyle.*
+org.rhq.etc.*
+org.rhq.helpers.*
+org.rhq.maven.*
+org.rhq.maven.plugins.*
+org.rhq.metrics.*
+org.rhq.metrics.netty.*
+org.rhq.misc.*
+org.rhq.server.*
+org.rhttpc.*
+org.richardinnocent.polysight.*
+org.richardinnocent.polysight.core.*
+org.richardinnocent.propertiestoolkit.*
+org.richfaces.*
+org.richfaces.archetypes.*
+org.richfaces.cdk.*
+org.richfaces.core.*
+org.richfaces.ui.*
+org.riedelcastro.*
+org.rifers.*
+org.ringojs.*
+org.riodb.*
+org.riot-framework.*
+org.riverframework.*
+org.riversun.*
+org.rjung.util.*
+org.rlbot.commons.*
+org.rm3l.*
+org.rnorth.*
+org.rnorth.circuitbreakers.*
+org.rnorth.dropwizard.*
+org.rnorth.duct-tape.*
+org.rnorth.test-containers.*
+org.rnorth.visible-assertions.*
+org.roaringbitmap.*
+org.robobinding.*
+org.robobinding.plugins.*
+org.roboguice.*
+org.robokind.*
+org.robolectric.*
+org.robolectric.gradle.*
+org.roboquant.*
+org.robospock.*
+org.robotframework.*
+org.robotninjas.*
+org.robotninjas.barge.*
+org.robovm.*
+org.roc-streaming.roctoolkit.*
+org.roc-streaming.roctoolkit.testing.*
+org.rocketmq.*
+org.rocketmq.spring.boot.*
+org.rocksdb.*
+org.rockyang.*
+org.rococoa.*
+org.rodnansol.*
+org.rogach.*
+org.roghib.*
+org.rogmann.jsmud.*
+org.rogueware.*
+org.rogueware.mojo.*
+org.roisoleil.*
+org.roklib.*
+org.romaframework.*
+org.rometools.*
+org.ronsmits.*
+org.rootservices.*
+org.rosaenlg.*
+org.rosenvold.spring.*
+org.rosuda.REngine.*
+org.rotstan.jts.*
+org.rouplex.*
+org.rpsl4j.*
+org.rrd4j.*
+org.rribbit.*
+org.rsmod.*
+org.rsmod.game.*
+org.rsmod.plugins.*
+org.ruaux.*
+org.rudogma.*
+org.ruleml.psoa.*
+org.rundeck-plugins.*
+org.rundeck.*
+org.rundeck.api.*
+org.rundeck.cli-toolbelt.*
+org.rundeck.cli.*
+org.rundeck.gradle.*
+org.rundeck.gradle.rundeck-plugin.*
+org.rundeck.hibernate.*
+org.rundeck.rd.*
+org.rwshop.*
+org.rwtodd.*
+org.rxjava.*
+org.rxjava.apikit.*
+org.rxtx.*
+org.ryoframework.core.*
+org.ryoframework.feat.*
+org.ryoframework.gradle.*
+org.ryoframework.next.*
+org.ryoframework.persistence.*
+org.ryoframework.support.*
+org.rypt.*
+org.rythmengine.*
+org.rzo.yajsw.*
+org.s1-platform.*
+org.saatsch.framework.*
+org.sackfix.*
+org.sadiframework.*
+org.sadtech.autoresponder.*
+org.sadtech.bot.bitbucketbot.*
+org.sadtech.bot.godfather.*
+org.sadtech.bot.vcs.*
+org.sadtech.haiti.*
+org.sadtech.haiti.data.*
+org.sadtech.haiti.filter.*
+org.sadtech.social.*
+org.sadtech.utils.*
+org.sadtech.vk.bot.*
+org.saegesser.*
+org.safehaus.archaius.*
+org.safehaus.chop.*
+org.safehaus.guicyfig.*
+org.safehaus.jettyjam.*
+org.safehaus.jug.*
+org.safris.maven.*
+org.safris.xml.*
+org.sahagin.*
+org.saharsh.*
+org.sahli.asciidoc.confluence.publisher.*
+org.sainfy.*
+org.saintandreas.*
+org.sakaiproject.*
+org.sakaiproject.acadtermmanage.*
+org.sakaiproject.accountvalidator.*
+org.sakaiproject.announcement.*
+org.sakaiproject.assignment.*
+org.sakaiproject.basiclti.*
+org.sakaiproject.calendar.*
+org.sakaiproject.calendaring.*
+org.sakaiproject.cloudstorage.*
+org.sakaiproject.common.*
+org.sakaiproject.commons.*
+org.sakaiproject.content.*
+org.sakaiproject.contentreview.*
+org.sakaiproject.contentreview.compilatio.*
+org.sakaiproject.contentreview.dao.*
+org.sakaiproject.contentreview.service.*
+org.sakaiproject.contentreview.turnitin.*
+org.sakaiproject.contentreview.turnitin.oc.*
+org.sakaiproject.contentreview.urkund.*
+org.sakaiproject.contentreview.vericite.*
+org.sakaiproject.conversations.*
+org.sakaiproject.courier.*
+org.sakaiproject.dashboard.*
+org.sakaiproject.datemanager.api.*
+org.sakaiproject.delegatedaccess.*
+org.sakaiproject.deploy.*
+org.sakaiproject.edu-services.*
+org.sakaiproject.edu-services.course-management.*
+org.sakaiproject.edu-services.gradebook.*
+org.sakaiproject.edu-services.scoringservice.*
+org.sakaiproject.edu-services.sections.*
+org.sakaiproject.emailtemplateservice.*
+org.sakaiproject.endorsed.*
+org.sakaiproject.entitybroker.*
+org.sakaiproject.genericdao.*
+org.sakaiproject.googledrive.*
+org.sakaiproject.gradebookng.*
+org.sakaiproject.grading.*
+org.sakaiproject.hierarchy.*
+org.sakaiproject.hybrid.*
+org.sakaiproject.jsf.*
+org.sakaiproject.jsf2.*
+org.sakaiproject.kernel.*
+org.sakaiproject.kernel.deploy.*
+org.sakaiproject.lessonbuilder.*
+org.sakaiproject.license.*
+org.sakaiproject.login.*
+org.sakaiproject.mailarchive.*
+org.sakaiproject.mailsender.*
+org.sakaiproject.maven-archetype.*
+org.sakaiproject.maven.*
+org.sakaiproject.maven.plugins.*
+org.sakaiproject.message.*
+org.sakaiproject.metaobj.*
+org.sakaiproject.mock.*
+org.sakaiproject.msgcntr.*
+org.sakaiproject.nakamura.*
+org.sakaiproject.oauth.*
+org.sakaiproject.onedrive.*
+org.sakaiproject.pasystem.*
+org.sakaiproject.pcservice.*
+org.sakaiproject.plus.*
+org.sakaiproject.polls.*
+org.sakaiproject.portal.*
+org.sakaiproject.presence.*
+org.sakaiproject.profile.*
+org.sakaiproject.profile2.*
+org.sakaiproject.reset-pass.*
+org.sakaiproject.roster2.*
+org.sakaiproject.rsf.*
+org.sakaiproject.rubrics.*
+org.sakaiproject.samigo.*
+org.sakaiproject.scheduler.*
+org.sakaiproject.search.*
+org.sakaiproject.search.elasticsearch.*
+org.sakaiproject.sentry.*
+org.sakaiproject.shortenedurl.*
+org.sakaiproject.signup.*
+org.sakaiproject.site.*
+org.sakaiproject.sitemanage.*
+org.sakaiproject.sitestats.*
+org.sakaiproject.taggable.*
+org.sakaiproject.tags.*
+org.sakaiproject.user.*
+org.sakaiproject.user.util.*
+org.sakaiproject.userauditservice.*
+org.sakaiproject.velocity.*
+org.sakaiproject.warehouse.*
+org.sakaiproject.webjars.*
+org.sakaiproject.webservices.*
+org.sakaiproject.wicket.*
+org.sakuli.*
+org.salesforce.*
+org.salex.hmip.*
+org.saltyrtc.*
+org.samba.jcifs.*
+org.sameas.*
+org.sameersingh.freebasedb.*
+org.sameersingh.htmlgen.*
+org.sameersingh.nlp_serde.*
+org.sameersingh.scalaplot.*
+org.sandcast.*
+org.sangria-graphql.*
+org.sanoitus.*
+org.sapia.*
+org.sat4j.*
+org.saynotobugs.*
+org.sazabi.*
+org.sbml.jsbml.*
+org.sbml.jsbml.ext.*
+org.sbml.jsbml.modules.*
+org.sbolstandard.*
+org.sbuild.*
+org.scala-debugger.*
+org.scala-exercises.*
+org.scala-graph.*
+org.scala-ide.*
+org.scala-js.*
+org.scala-lang-osgi.*
+org.scala-lang.*
+org.scala-lang.lms.*
+org.scala-lang.modules.*
+org.scala-lang.platform.*
+org.scala-lang.plugins.*
+org.scala-lang.virtualized.*
+org.scala-lang.virtualized.plugins.*
+org.scala-libs.*
+org.scala-miniboxing.plugins.*
+org.scala-native.*
+org.scala-refactoring.*
+org.scala-rules.*
+org.scala-saddle.*
+org.scala-sbt.*
+org.scala-sbt.ipcsocket.*
+org.scala-sbt.ivy.*
+org.scala-sbt.jline.*
+org.scala-sbt.jline3.*
+org.scala-sbt.rt.*
+org.scala-sbt.sbt-giter8-resolver.*
+org.scala-sbt.sxr.*
+org.scala-search.*
+org.scala-steward.*
+org.scala-stm.*
+org.scala-tools.*
+org.scala-tools.archetypes.*
+org.scala-tools.javautils.*
+org.scala-tools.sbinary.*
+org.scala-tools.sbt.*
+org.scala-tools.sindi.*
+org.scala-tools.skins.*
+org.scala-tools.subcut.*
+org.scala-tools.sxr.*
+org.scala-tools.testing.*
+org.scala-tools.time.*
+org.scalablytyped.circe013.*
+org.scalablytyped.converter.*
+org.scalacheck.*
+org.scalacloud.*
+org.scalactic.*
+org.scaladci.*
+org.scalaequals.*
+org.scalaforge.*
+org.scalafx.*
+org.scalafy.*
+org.scalaj.*
+org.scalala.*
+org.scalalint.*
+org.scalamacros.*
+org.scalamari.*
+org.scalameta.*
+org.scalamock.*
+org.scalamodules.*
+org.scalamolecule.*
+org.scalanlp.*
+org.scalaperf.*
+org.scalaquery.*
+org.scalar-project.*
+org.scalarelational.*
+org.scalariform.*
+org.scalastic.*
+org.scalastuff.*
+org.scalastyle.*
+org.scalatest.*
+org.scalatestplus.*
+org.scalatestplus.play.*
+org.scalatra.*
+org.scalatra.rl.*
+org.scalatra.scalate.*
+org.scalatra.scalate.samples.*
+org.scalatra.scalate.tooling.*
+org.scalatra.socketio-java.*
+org.scalautils.*
+org.scalawag.bateman.*
+org.scalawag.druthers.*
+org.scalawag.pickaxe.*
+org.scalawag.sarong.*
+org.scalawag.sbt.*
+org.scalawag.sbt.gitflow.*
+org.scalawag.sdom.*
+org.scalawag.timber.*
+org.scalawebtest.*
+org.scalaxb.*
+org.scalaz.*
+org.scalaz.stream.*
+org.scaldi.*
+org.scalesxml.*
+org.scalikejdbc.*
+org.scaloid.*
+org.scalqa.*
+org.scalus.*
+org.scanamo.*
+org.scannotation.*
+org.scassandra.*
+org.scenarioo.*
+org.scf4j.*
+org.schedulesdirect.*
+org.schemarepo.*
+org.schemaspy.*
+org.schicwp.dinky.*
+org.schmant.hudson.*
+org.schmidrules.*
+org.schoellerfamily.gedbrowser.*
+org.schwa.*
+org.schwering.*
+org.scify.*
+org.scijava.*
+org.scilab.forge.*
+org.scitokens.*
+org.scode.*
+org.scodec.*
+org.scommon.*
+org.scommons.api.*
+org.scommons.client.*
+org.scommons.nodejs.*
+org.scommons.react-native.*
+org.scommons.react.*
+org.scommons.service.*
+org.scommons.shogowada.*
+org.scommons.websql.*
+org.scorexfoundation.*
+org.scoverage.*
+org.scray.*
+org.scream3r.*
+org.scribble.*
+org.scribe.*
+org.scriptella.*
+org.scriptkitty.*
+org.scrupal.*
+org.sction.*
+org.sction.core.*
+org.sction.phprpc.*
+org.sction.proxool.*
+org.sculptorgenerator.*
+org.scurator.*
+org.sd-jwt.*
+org.sdase.commons.*
+org.sdase.commons.spring.boot.*
+org.sdmlib.*
+org.seaborne.*
+org.seaborne.mantis.*
+org.seaborne.rdf-delta.*
+org.seasar.doma.*
+org.seasar.doma.boot.*
+org.secnod.dropwizard.*
+org.secnod.jsrlib.*
+org.secnod.shiro.*
+org.securegraph.*
+org.securegraph.examples.*
+org.sedis.*
+org.sedlakovi.celery.*
+org.sedris.*
+org.seedme.*
+org.seedstack.*
+org.seedstack.addons.audit.*
+org.seedstack.addons.aws.*
+org.seedstack.addons.camel.*
+org.seedstack.addons.cci.*
+org.seedstack.addons.consul.*
+org.seedstack.addons.crud.*
+org.seedstack.addons.datasecurity.*
+org.seedstack.addons.elasticsearch.*
+org.seedstack.addons.feign.*
+org.seedstack.addons.flyway.*
+org.seedstack.addons.i18n.*
+org.seedstack.addons.io.*
+org.seedstack.addons.javamail.*
+org.seedstack.addons.jcache.*
+org.seedstack.addons.jcr.*
+org.seedstack.addons.jdbc.*
+org.seedstack.addons.jmh.*
+org.seedstack.addons.jms.*
+org.seedstack.addons.jpa.*
+org.seedstack.addons.kafka.*
+org.seedstack.addons.ldap.*
+org.seedstack.addons.metrics.*
+org.seedstack.addons.modelmapper.*
+org.seedstack.addons.mongodb.*
+org.seedstack.addons.monitoring.*
+org.seedstack.addons.mqtt.*
+org.seedstack.addons.neo4j.*
+org.seedstack.addons.netflix.*
+org.seedstack.addons.oauth.*
+org.seedstack.addons.redis.*
+org.seedstack.addons.scheduling.*
+org.seedstack.addons.shell.*
+org.seedstack.addons.solr.*
+org.seedstack.addons.spring.*
+org.seedstack.addons.swagger.*
+org.seedstack.addons.validation.*
+org.seedstack.addons.w20.*
+org.seedstack.addons.web.*
+org.seedstack.addons.ws.*
+org.seedstack.business.*
+org.seedstack.coffig.*
+org.seedstack.functions.audit.*
+org.seedstack.functions.batch-monitoring.*
+org.seedstack.functions.i18n.*
+org.seedstack.functions.io.*
+org.seedstack.functions.w20.*
+org.seedstack.poms.*
+org.seedstack.seed.*
+org.seedstack.shed.*
+org.seekay.*
+org.seekloud.*
+org.seerc.paasword.*
+org.sejda.*
+org.sejda.imageio.*
+org.sejda.webp-imageio.*
+org.selenide.*
+org.seleniumhq.selenium.*
+org.seleniumhq.selenium.client-drivers.*
+org.seleniumhq.selenium.core.*
+org.seleniumhq.selenium.fluent.*
+org.seleniumhq.selenium.grid.*
+org.seleniumhq.selenium.ide.*
+org.seleniumhq.selenium.server.*
+org.seleniumhq.selenium.tests.*
+org.seleniumhq.webdriver.*
+org.seleniumx.*
+org.sellcom.*
+org.sellmerfud.*
+org.selunit.*
+org.semanticrecord.*
+org.semantictools.*
+org.semanticwb.*
+org.semanticweb.elk.*
+org.semanticweb.rulewerk.*
+org.semanticweb.vlog4j.*
+org.semanticweb.yars.*
+org.semarglproject.*
+org.semispace.*
+org.semispace.comet.*
+org.semoss.*
+org.semver.*
+org.semver4j.*
+org.semweb4j.*
+org.senkbeil.*
+org.sentilo.*
+org.sentilo.agent.*
+org.sentilo.platform.*
+org.sentilo.web.*
+org.sentrysoftware.*
+org.seppiko.*
+org.seppiko.commons.*
+org.seppiko.glf.*
+org.seppiko.logging.*
+org.seppiko.plugins.*
+org.seqdoop.*
+org.sessl.*
+org.settings4j.*
+org.sevensource.*
+org.sevensource.commons.*
+org.sevensource.magnolia.*
+org.sevensource.mail.*
+org.sevensource.parents.*
+org.sevensource.support.jpa-rest-stack.*
+org.sevensource.wro4spring.*
+org.sf.teachingbox.*
+org.sgine.*
+org.sglahn.*
+org.shacli.*
+org.shakespeareframework.*
+org.shamdata.*
+org.shaneking.*
+org.shaneking.aspectj.*
+org.shaneking.leon.*
+org.shaneking.ling.*
+org.shaneking.roc.*
+org.shaneking.spring.*
+org.shaneking.sunny.*
+org.shapelogicscala.*
+org.sharegov.*
+org.shayvank.*
+org.sheinbergon.*
+org.shenjia.*
+org.shept.*
+org.shipkit.shipkit-demo.*
+org.shipstone.*
+org.shipstone.swagger.*
+org.shirolang.*
+org.shoal.*
+org.shoushitsu.service-directory.*
+org.showcontrol4j.*
+org.shredzone.acme4j.*
+org.shredzone.commons.*
+org.shredzone.flattr4j.*
+org.shredzone.jshred.*
+org.shredzone.maven.*
+org.shredzone.shariff.*
+org.siani.*
+org.siani.itrules.*
+org.siani.javafmi.*
+org.siani.lasso.*
+org.siani.magritte.*
+org.siani.tafat.*
+org.sidao.*
+org.siddhi.*
+org.sidoh.*
+org.siggi-ci.*
+org.signal.*
+org.signal.forks.*
+org.signserver.apksig.*
+org.signserver.deploytools.*
+org.signserver.jacknji11.*
+org.signserver.jsign.*
+org.signserver.xades4j.*
+org.sikongsphere.*
+org.sikongsphere.chunkruns.*
+org.sikuli.*
+org.sila-standard.*
+org.sila-standard.sila_java.*
+org.sila-standard.sila_java.examples.*
+org.sila-standard.sila_java.interoperability.*
+org.sila-standard.sila_java.library.*
+org.sila-standard.sila_java.servers.*
+org.sila-standard.sila_java.tools.*
+org.silentsoft.*
+org.silentsoft.maven.plugins.*
+org.silentsoft.oss.*
+org.siliconeconomy.*
+org.silpa.*
+org.silvertunnel-ng.*
+org.sim0mq.*
+org.simart.*
+org.simondean.partial-response.*
+org.simondean.vertx.*
+org.simonscode.*
+org.simple4j.*
+org.simpledbm.*
+org.simpleflatmapper.*
+org.simpleframework.*
+org.simplejavamail.*
+org.simplericity.*
+org.simplericity.datadirlocator.*
+org.simplericity.jettyconsole.*
+org.simplericity.macify.*
+org.simplex3d.*
+org.simplify4u.*
+org.simplify4u.plugins.*
+org.simplity.*
+org.simtp.*
+org.sincron.*
+org.sindaryn.*
+org.sindice.siren.*
+org.singledog.*
+org.singledog.spring.boot.*
+org.singlefilejava.*
+org.singlespaced.*
+org.sinnlabs.*
+org.sinnlabs.dbvim.ui.*
+org.sinnlabs.ui.*
+org.sinnlabs.ui.zk.*
+org.siqisource.*
+org.siqisource.agave.*
+org.sireum.*
+org.sisioh.*
+org.sistcoop.*
+org.sitemesh.*
+org.sitoolkit.*
+org.sitoolkit.ad.*
+org.sitoolkit.ad.archetype.*
+org.sitoolkit.archetype.*
+org.sitoolkit.tester.*
+org.sitoolkit.util.*
+org.sitoolkit.wt.*
+org.sjmvc.*
+org.skelligframework.*
+org.skfiy.*
+org.skfiy.maven.plugin.fastconfig.*
+org.skife.*
+org.skife.cli.*
+org.skife.com.typesafe.config.*
+org.skife.config.*
+org.skife.gressil.*
+org.skife.jetty.v9.*
+org.skife.maven.*
+org.skife.memcake.*
+org.skife.ssh.*
+org.skife.tar.*
+org.skife.terminal.*
+org.skife.url.*
+org.skife.vmware.*
+org.skinny-framework.*
+org.skinny-framework.com.fasterxml.jackson.module.*
+org.skinny-framework.org.scaldi.*
+org.sklsft.*
+org.sklsft.commons.*
+org.sklsft.generator.*
+org.skyscreamer.*
+org.skywaysoftware.*
+org.slf4gwt.*
+org.slf4j.*
+org.slf4j13.*
+org.slf4s.*
+org.slick2d.*
+org.slieb.*
+org.slieb.closure.*
+org.slieb.soy.plugins.*
+org.slingerxv.*
+org.slinkyframework.*
+org.slinkyframework.environment.*
+org.slinkyframework.examples.*
+org.slog4j.*
+org.smali.*
+org.smallibs.*
+org.smallmind.*
+org.smart4j.*
+org.smartboot.*
+org.smartboot.aio.*
+org.smartboot.compare.*
+org.smartboot.flow.*
+org.smartboot.http.*
+org.smartboot.ioc.*
+org.smartboot.license.*
+org.smartboot.maven.archetype.*
+org.smartboot.maven.plugin.*
+org.smartboot.mqtt.*
+org.smartboot.servlet.*
+org.smartboot.socket.*
+org.smartboot.sosa.*
+org.smartdeveloperhub.*
+org.smartdeveloperhub.curator.*
+org.smartdeveloperhub.harvester.*
+org.smartdeveloperhub.harvester.org.*
+org.smartdeveloperhub.harvesters.ci.*
+org.smartdeveloperhub.harvesters.ci.backend.*
+org.smartdeveloperhub.harvesters.ci.frontend.*
+org.smartdeveloperhub.harvesters.ci.jenkins.*
+org.smartdeveloperhub.harvesters.ci.util.*
+org.smartdeveloperhub.harvesters.it.*
+org.smartdeveloperhub.harvesters.it.backend.*
+org.smartdeveloperhub.harvesters.it.frontend.*
+org.smartdeveloperhub.harvesters.scm.*
+org.smartdeveloperhub.harvesters.scm.jersey.*
+org.smartdeveloperhub.harvesters.scm.ldp4j.*
+org.smartdeveloperhub.testing.*
+org.smartdeveloperhub.vocabulary.*
+org.smarthomej.addons.*
+org.smarthomej.addons.bom.*
+org.smarthomej.addons.bundles.*
+org.smarthomej.addons.features.karaf.*
+org.smarti18n.*
+org.smartloli.*
+org.smartparam.*
+org.smartparam.manager.*
+org.smartregister.*
+org.smartrplace.analysis.*
+org.smartrplace.api.*
+org.smartrplace.apps.*
+org.smartrplace.drivers.*
+org.smartrplace.eval.*
+org.smartrplace.external.*
+org.smartrplace.logging.*
+org.smartrplace.sim.*
+org.smartrplace.tools.*
+org.smerty.*
+org.smooks.*
+org.smooks.cartridges.*
+org.smooks.cartridges.edi.*
+org.smooks.cartridges.persistence.*
+org.smurn.*
+org.smyld.*
+org.smyld.app.*
+org.smyld.app.ep.*
+org.smyld.app.ep.EntityPlot.*
+org.smyld.app.pe.*
+org.smyld.app.pe.boot.*
+org.smyld.app.pe.model.*
+org.smyld.main.*
+org.snakeyaml.*
+org.snapscript.*
+org.snf4j.*
+org.snikket.*
+org.snmp4j.*
+org.snmp4s.*
+org.sobotics.*
+org.socraticgrid.*
+org.sodatest.*
+org.sodeac.*
+org.softcake.*
+org.softcake.cherry.*
+org.softcake.lemon.*
+org.softcatala.*
+org.softee.*
+org.softgorilla.*
+org.softsmithy.*
+org.softsmithy.devlib.*
+org.softsmithy.lib.*
+org.softus.*
+org.softus.cdi.transaction.*
+org.soitoolkit.*
+org.soitoolkit.commons.*
+org.soitoolkit.commons.components.*
+org.soitoolkit.commons.poms.*
+org.soitoolkit.commons.poms.mule-dependencies.*
+org.soitoolkit.refapps.*
+org.soitoolkit.refapps.dealernetwork.*
+org.soitoolkit.refapps.sd.*
+org.soitoolkit.tools.*
+org.soitoolkit.tools.encryption.web.*
+org.soitoolkit.tools.generator.*
+org.sol4k.*
+org.solidcoding.*
+org.solovyev.*
+org.solovyev.android.*
+org.solovyev.android.aspecta.*
+org.solovyev.android.threadguard.*
+org.solovyev.android.views.*
+org.solovyev.external.com.electriccloud.*
+org.somda.sdc.*
+org.sonarsource.*
+org.sonarsource.analyzer-commons.*
+org.sonarsource.api.plugin.*
+org.sonarsource.auth.bitbucket.*
+org.sonarsource.auth.github.*
+org.sonarsource.clirr.*
+org.sonarsource.clover.*
+org.sonarsource.config.*
+org.sonarsource.css.*
+org.sonarsource.dotnet.*
+org.sonarsource.dummy.*
+org.sonarsource.flex.*
+org.sonarsource.fxcop.*
+org.sonarsource.generic-coverage.*
+org.sonarsource.git.blame.*
+org.sonarsource.github.*
+org.sonarsource.go.*
+org.sonarsource.groovy.*
+org.sonarsource.html.*
+org.sonarsource.iac.*
+org.sonarsource.jacoco.*
+org.sonarsource.java.*
+org.sonarsource.javascript.*
+org.sonarsource.kotlin.*
+org.sonarsource.ldap.*
+org.sonarsource.license-headers.*
+org.sonarsource.orchestrator.*
+org.sonarsource.owasp.*
+org.sonarsource.parent.*
+org.sonarsource.php.*
+org.sonarsource.plugins.cayc.*
+org.sonarsource.pmd.*
+org.sonarsource.python.*
+org.sonarsource.roslynsdk.*
+org.sonarsource.scanner.ant.*
+org.sonarsource.scanner.api.*
+org.sonarsource.scanner.cli.*
+org.sonarsource.scanner.gradle.*
+org.sonarsource.scanner.maven.*
+org.sonarsource.scm.clearcase.*
+org.sonarsource.scm.cvs.*
+org.sonarsource.scm.git.*
+org.sonarsource.scm.mercurial.*
+org.sonarsource.scm.perforce.*
+org.sonarsource.scm.svn.*
+org.sonarsource.slang.*
+org.sonarsource.sonar-findbugs-plugin.*
+org.sonarsource.sonar-groovy-plugin.*
+org.sonarsource.sonar-lits-plugin.*
+org.sonarsource.sonar-packaging-maven-plugin.*
+org.sonarsource.sonar-plugins.*
+org.sonarsource.sonar-plugins.dotnet.csharp.*
+org.sonarsource.sonar-plugins.dotnet.tests.*
+org.sonarsource.sonar-plugins.github.*
+org.sonarsource.sonar-plugins.javascript.*
+org.sonarsource.sonar-plugins.resharper.*
+org.sonarsource.sonar-runner.*
+org.sonarsource.sonar-web-plugin.*
+org.sonarsource.sonar-xml-plugin.*
+org.sonarsource.sonarlint.*
+org.sonarsource.sonarlint.core.*
+org.sonarsource.sonarlint.ls.*
+org.sonarsource.sonarlint.omnisharp.*
+org.sonarsource.sonarqube.*
+org.sonarsource.sqdbmigrator.*
+org.sonarsource.sslr-squid-bridge.*
+org.sonarsource.sslr.*
+org.sonarsource.text.*
+org.sonarsource.typescript.*
+org.sonarsource.ucfg.*
+org.sonarsource.update-center.*
+org.sonarsource.web.*
+org.sonarsource.widget-lab.*
+org.sonarsource.xml.*
+org.sonatype.*
+org.sonatype.aether.*
+org.sonatype.appbooter.*
+org.sonatype.appbooter.plexus-booters.*
+org.sonatype.appbooter.plexus-platforms.*
+org.sonatype.appcontext.*
+org.sonatype.book.*
+org.sonatype.buildsupport.*
+org.sonatype.buup.*
+org.sonatype.central.*
+org.sonatype.cert-support.*
+org.sonatype.clm.*
+org.sonatype.community.*
+org.sonatype.configuration.*
+org.sonatype.directjngine.*
+org.sonatype.equinox.*
+org.sonatype.flexmojos.*
+org.sonatype.forge.*
+org.sonatype.goodies.*
+org.sonatype.goodies.dionysus.*
+org.sonatype.goodies.dropwizard.*
+org.sonatype.gossip.*
+org.sonatype.gradle.plugins.*
+org.sonatype.gradle.plugins.scan.*
+org.sonatype.grrrowl.*
+org.sonatype.gshell.*
+org.sonatype.gshell.commands.*
+org.sonatype.gshell.dist.*
+org.sonatype.gshell.ext.*
+org.sonatype.hazelcast.*
+org.sonatype.http-testing-harness.*
+org.sonatype.hudson.*
+org.sonatype.install4j.*
+org.sonatype.jline.*
+org.sonatype.jsecurity.*
+org.sonatype.jsw-binaries.*
+org.sonatype.m2e.egit.*
+org.sonatype.m2e.extras.*
+org.sonatype.m2e.hudson.*
+org.sonatype.maven.*
+org.sonatype.maven.archetype.*
+org.sonatype.maven.plugin.*
+org.sonatype.maven.plugins.*
+org.sonatype.maven.shell.*
+org.sonatype.maven.shell.dist.*
+org.sonatype.mercury.*
+org.sonatype.micromailer.*
+org.sonatype.nexus.*
+org.sonatype.nexus.ant.*
+org.sonatype.nexus.archetypes.*
+org.sonatype.nexus.assemblies.*
+org.sonatype.nexus.buildsupport.*
+org.sonatype.nexus.bundles.*
+org.sonatype.nexus.capabilities.*
+org.sonatype.nexus.ci.*
+org.sonatype.nexus.ci.jenkins.*
+org.sonatype.nexus.client.*
+org.sonatype.nexus.indexer-lucene.*
+org.sonatype.nexus.maven.*
+org.sonatype.nexus.obr.*
+org.sonatype.nexus.platform.circleci.*
+org.sonatype.nexus.plugins.*
+org.sonatype.nexus.plugins.capabilities.*
+org.sonatype.nexus.plugins.kenai.*
+org.sonatype.nexus.plugins.ldap.*
+org.sonatype.nexus.repository.site.*
+org.sonatype.nexus.restlight.*
+org.sonatype.nexus.ruby.*
+org.sonatype.nexus.testsuite.*
+org.sonatype.nexus.tools.*
+org.sonatype.nexus.unpack.*
+org.sonatype.nexus.xstream.*
+org.sonatype.nexus.yum.*
+org.sonatype.oss.*
+org.sonatype.ossindex.*
+org.sonatype.ossindex.maven.*
+org.sonatype.p2.bridge.*
+org.sonatype.p2.touchpoints.*
+org.sonatype.plexus.*
+org.sonatype.plexus.appevents.*
+org.sonatype.plexus.archiver.*
+org.sonatype.plexus.template.*
+org.sonatype.plugin.*
+org.sonatype.plugins.*
+org.sonatype.plugins.it.applifecycle.*
+org.sonatype.pmaven.*
+org.sonatype.reflect.*
+org.sonatype.restsimple.*
+org.sonatype.runtime.*
+org.sonatype.runtime.bars.*
+org.sonatype.runtime.g2.recipes.*
+org.sonatype.runtime.itars.*
+org.sonatype.runtime.recipes.*
+org.sonatype.runtime.recipes.advices.*
+org.sonatype.runtime.recipes.bars.*
+org.sonatype.runtime.recipes.itars.*
+org.sonatype.security.*
+org.sonatype.security.realms.*
+org.sonatype.security.realms.ldap.*
+org.sonatype.siesta.*
+org.sonatype.sisu.*
+org.sonatype.sisu.assembler.*
+org.sonatype.sisu.goodies.*
+org.sonatype.sisu.inject.*
+org.sonatype.sisu.jacksbee.*
+org.sonatype.sisu.jira.mediator.*
+org.sonatype.sisu.litmus.*
+org.sonatype.sisu.pr.*
+org.sonatype.sisu.recipes.*
+org.sonatype.sisu.siesta.*
+org.sonatype.spice.*
+org.sonatype.spice.inject.*
+org.sonatype.spice.zapper.*
+org.sonatype.tycho.*
+org.sonatype.tycho.extras.*
+org.sonatype.tycho.m2e.*
+org.sonatype.tycho.p2.*
+org.soot-oss.*
+org.sophize.*
+org.sorm-framework.*
+org.sormula.*
+org.sosy-lab.*
+org.sotrip.*
+org.soulwing.*
+org.soulwing.cas.*
+org.soulwing.jdbc.*
+org.soulwing.jwt.*
+org.soulwing.prospecto.*
+org.soulwing.s2ks.*
+org.soulwing.snmp.*
+org.soulwing.ssl.*
+org.soundtouch4j.*
+org.sourceforge.jlibeps.*
+org.sourceforge.xradar.*
+org.sourceforge.xsparql.*
+org.sourcegrade.*
+org.sourcelab.*
+org.sourcelab.http.*
+org.sourceprojects.lycia.*
+org.sourceprojects.oss.*
+org.sourceprojects.xmlparser.*
+org.spamjs.*
+org.spark-project.*
+org.spark-project.akka.*
+org.spark-project.hive.*
+org.spark-project.hive.hcatalog.*
+org.spark-project.hive.shims.*
+org.spark-project.protobuf.*
+org.spark-project.spark.*
+org.spark-project.zeromq.*
+org.spartanz.*
+org.spdx.*
+org.spearal.*
+org.spearce.*
+org.specnaz.*
+org.specrunner.*
+org.specs.*
+org.specs2.*
+org.specsy.*
+org.spectrumauctions.*
+org.spekframework.spek2.*
+org.spf4j.*
+org.spf4j.avro.*
+org.spf4j.demo.*
+org.spiderwiz.*
+org.spiffyui.*
+org.spiffyui.maven.plugins.*
+org.spilth.*
+org.spincast.*
+org.spire-math.*
+org.splink.*
+org.spockframework.*
+org.spokbjorn.*
+org.spongepowered.*
+org.spongepowered.plugin-meta.*
+org.spreadme.*
+org.springblade.*
+org.springdoc.*
+org.springframework.*
+org.springframework.amqp.*
+org.springframework.analytics.*
+org.springframework.android.*
+org.springframework.aws.*
+org.springframework.batch.*
+org.springframework.batch.extensions.*
+org.springframework.boot.*
+org.springframework.boot.aot.*
+org.springframework.boot.experimental.*
+org.springframework.build.*
+org.springframework.build.aws.*
+org.springframework.build.test.*
+org.springframework.cloud.*
+org.springframework.cloud.contract.*
+org.springframework.cloud.dist.*
+org.springframework.cloud.fn.*
+org.springframework.cloud.launcher.*
+org.springframework.cloud.stream.app.*
+org.springframework.cloud.stream.app.plugin.*
+org.springframework.cloud.task.app.*
+org.springframework.commons.*
+org.springframework.credhub.*
+org.springframework.data.*
+org.springframework.data.build.*
+org.springframework.data.gemfire.*
+org.springframework.experimental.*
+org.springframework.flex.*
+org.springframework.geode.*
+org.springframework.graphql.*
+org.springframework.guice.*
+org.springframework.hateoas.*
+org.springframework.integration.*
+org.springframework.javaconfig.*
+org.springframework.kafka.*
+org.springframework.ldap.*
+org.springframework.ldap.ldif.*
+org.springframework.maven.skins.*
+org.springframework.metrics.*
+org.springframework.mobile.*
+org.springframework.modulith.*
+org.springframework.osgi.*
+org.springframework.plugin.*
+org.springframework.pulsar.*
+org.springframework.restdocs.*
+org.springframework.retry.*
+org.springframework.roo.*
+org.springframework.security.*
+org.springframework.security.experimental.*
+org.springframework.security.extensions.*
+org.springframework.security.kerberos.*
+org.springframework.security.oauth.*
+org.springframework.security.oauth.boot.*
+org.springframework.session.*
+org.springframework.shell.*
+org.springframework.social.*
+org.springframework.statemachine.*
+org.springframework.vault.*
+org.springframework.webflow.*
+org.springframework.ws.*
+org.springframework.xd.*
+org.springjutsu.*
+org.springmad.*
+org.springmodules.*
+org.springunit.*
+org.spurint.maven.plugins.*
+org.sputnikdev.*
+org.spxp.*
+org.sqids.*
+org.sql2o.*
+org.sql2o.extensions.*
+org.sqldroid.*
+org.sqlflow.*
+org.sqlproc.*
+org.sqlrodeo.*
+org.squarebrackets.*
+org.squbs.*
+org.squeryl.*
+org.squirrelframework.*
+org.srcdeps.core.*
+org.srcdeps.gradle.plugin.*
+org.srcdeps.mvn.*
+org.srplib.*
+org.ssf4j.*
+org.ssldev.*
+org.ssohub.*
+org.ssoup.denv.*
+org.ssssssss.*
+org.st-js.*
+org.st-js.bridge.*
+org.stackbox.archetypes.*
+org.stagemonitor.*
+org.standardout.*
+org.standardout.org.editorconfig.*
+org.starchartlabs.alloy.*
+org.starchartlabs.calamari.*
+org.starchartlabs.flare.*
+org.starchartlabs.lockdown.*
+org.starchartlabs.machete.*
+org.starchartlabs.majortom.*
+org.starcoin.*
+org.starrier.*
+org.startupframework.*
+org.statefulj.*
+org.statefulj.framework.*
+org.statefulj.persistence.*
+org.stategen.framework.*
+org.staxnav.*
+org.steambuff.*
+org.stefaniuk.json.service.*
+org.stefanutti.metrics.aspectj.*
+org.stellar.*
+org.stellar.anchor-sdk.*
+org.sterl.*
+org.sterl.hash.*
+org.sterl.identitystore.jdbc.*
+org.sterl.pmw.*
+org.sterl.svg2png.*
+org.sterl.test.log4j.*
+org.sterlingcode.*
+org.stokesdrift.*
+org.storychat.*
+org.streamingpool.*
+org.streampipes.*
+org.streum.*
+org.stripesframework.*
+org.stripesstuff.*
+org.struckture.*
+org.structr.*
+org.stuartgunter.*
+org.stubit.*
+org.sturrock.*
+org.subethamail.*
+org.subquark.*
+org.subscript-lang.*
+org.substeps.*
+org.subtlelib.*
+org.suecarter.*
+org.summerboot.*
+org.summerclouds.*
+org.summerclouds.common.*
+org.sunbird.*
+org.support-project.*
+org.swarmic.*
+org.swblocks.*
+org.swblocks.decisiontree.*
+org.swcdb.*
+org.sweatshop.*
+org.sweble.*
+org.sweble.engine.*
+org.sweble.wikitext.*
+org.sweble.wom3.*
+org.sweet-delights.*
+org.swframework.*
+org.swiftsms.*
+org.swimos.*
+org.swingexplorer.*
+org.swinglabs.*
+org.swinglabs.swingx.*
+org.swisspush.*
+org.swisspush.apikana.*
+org.swisspush.gateleen.*
+org.swisspush.jsonschema2pojo.*
+org.swisspush.maven.plugins.*
+org.swisspush.mirror.*
+org.switchyard.*
+org.switchyard.archetypes.*
+org.switchyard.components.*
+org.switchyard.console.*
+org.switchyard.console.wildfly.*
+org.switchyard.karaf.*
+org.swixml.*
+org.swordapp.*
+org.syftkog.*
+org.symphonyoss.*
+org.symphonyoss.s2.*
+org.symphonyoss.s2.canon.*
+org.symphonyoss.s2.canon.example.*
+org.symphonyoss.s2.common.*
+org.symphonyoss.s2.fugue.*
+org.symphonyoss.symphony.*
+org.symphonyoss.symphony.apps.*
+org.symphonyoss.symphony.tools.rest.*
+org.symqle.*
+org.symqle.modeler.*
+org.symqle.tools.*
+org.synchronoss.*
+org.synchronoss.cloud.*
+org.synchronoss.cpo.*
+org.syncloud.*
+org.syncope.*
+org.syncope.identityconnectors.*
+org.syncope.identityconnectors.bundles.*
+org.syncope.identityconnectors.bundles.staticws.*
+org.synyx.*
+org.synyx.hades.*
+org.synyx.hera.*
+org.synyx.synrp-api.*
+org.syphr.*
+org.sysfoundry.*
+org.sysfoundry.kiln.*
+org.sysjava.*
+org.syslog4j.*
+org.systemfw.*
+org.szegedi.*
+org.t-io.*
+org.t3as.*
+org.ta4j.*
+org.taack.*
+org.tachiyomi.*
+org.tachyonproject.*
+org.tahomarobotics.*
+org.takes.*
+org.talangsoft.*
+org.talares.*
+org.talend.camel.*
+org.talend.cxf.*
+org.talend.esb.*
+org.talend.esb.auxiliary.storage.*
+org.talend.esb.hyperic.*
+org.talend.esb.job.*
+org.talend.esb.locator.service.*
+org.talend.esb.locator.service.rest.*
+org.talend.esb.mep.*
+org.talend.esb.policies.*
+org.talend.esb.sam.service.*
+org.talend.esb.sap.*
+org.talend.esb.sts.*
+org.talend.sdk.component.*
+org.talend.tools.*
+org.tallison.*
+org.tallison.lucene.*
+org.tallison.quaerite.*
+org.tallison.solr.*
+org.tallison.tika.*
+org.tallison.xmp.*
+org.tango-controls.*
+org.tango-controls.atk.*
+org.tango-controls.ds.*
+org.tango-controls.gui.*
+org.tango-controls.hdb.*
+org.tango-controls.pogo.*
+org.tango-project.*
+org.tap4j.*
+org.tarantool.*
+org.targetagency.*
+org.taruts.*
+org.taruts.djig.*
+org.taruts.djig.example.*
+org.tashlin.*
+org.tatools.*
+org.tautua.*
+org.tautua.jwkhtmltox.*
+org.tautua.markdownpapers.*
+org.tautua.maven.plugins.*
+org.tautua.maven.skins.*
+org.taxilang.*
+org.taymyr.*
+org.taymyr.lagom.*
+org.taymyr.play.*
+org.tbag.*
+org.tbee.*
+org.tbee.giwth.*
+org.tbee.regexpbuilder.*
+org.tbee.sway.*
+org.tbee.tecl.*
+org.tbee.tesla.*
+org.tbee.thymeleafer.*
+org.tbee.xml2xxx.*
+org.tbwork.anole.*
+org.tcrawley.*
+org.teachingkidsprogramming.*
+org.teamapps.*
+org.teamcontrolium.*
+org.teasoft.*
+org.teatrove.*
+org.teatrove.examples.*
+org.teavm.*
+org.teavm.flavour.*
+org.teavm.library.*
+org.technbolts.*
+org.technbolts.tzatziki.*
+org.technologybrewery.*
+org.technologybrewery.fermenter.*
+org.technologybrewery.fermenter.ale.*
+org.technologybrewery.fermenter.brett.*
+org.technologybrewery.fermenter.stout.*
+org.technologybrewery.habushu.*
+org.technologybrewery.krausening.*
+org.technologybrewery.mash.*
+org.technologybrewery.mojohaus.*
+org.technologybrewery.orphedomos.*
+org.technologybrewery.prime.*
+org.technologybrewery.reinheitsgebot.*
+org.teiid.*
+org.teiid.arche-types.*
+org.teiid.connectors.*
+org.teiid.connectors.sandbox.*
+org.teiid.hal.*
+org.teiid.modeshape.*
+org.teiid.teiid-test-integration.*
+org.teiid.web-console.*
+org.teiid.wildfly.*
+org.teiid.wildfly.connectors.*
+org.teiid.wildfly.teiid-test-integration.*
+org.teknux.*
+org.telegram-s.*
+org.telegram.*
+org.telosys.starterkits.*
+org.templateit.*
+org.tendiwa.*
+org.tendiwa.inflectible.*
+org.tenkiv.coral.*
+org.tenkiv.coral.jdk.*
+org.tenkiv.kuantify.*
+org.tenkiv.physikal.*
+org.tensorflow.*
+org.tensorics.*
+org.tentackle.*
+org.terasoluna.batch.*
+org.terasoluna.gfw.*
+org.terasoluna.gfw.blank.*
+org.terasoluna.gfw.codepoints.*
+org.terasoluna.integration.*
+org.ternlang.*
+org.terracotta.*
+org.terracotta.management.*
+org.terracotta.management.samples.*
+org.terrakube.client.*
+org.terrakube.terraform.*
+org.terrameta.*
+org.terrier.*
+org.teslasoft.core.auth.*
+org.teslatoolkit.*
+org.test4j.*
+org.testaco.*
+org.testatoo.*
+org.testatoo.cartridge.*
+org.testatoo.container.*
+org.testatoo.core.*
+org.testatoo.openqa.*
+org.testcontainers.*
+org.testfun.*
+org.testfx.*
+org.testifyproject.*
+org.testifyproject.archetypes.*
+org.testifyproject.buildtools.*
+org.testifyproject.client.*
+org.testifyproject.container.*
+org.testifyproject.di.*
+org.testifyproject.examples.*
+org.testifyproject.external.*
+org.testifyproject.junit4.*
+org.testifyproject.junit5.*
+org.testifyproject.level.*
+org.testifyproject.local-resources.*
+org.testifyproject.maven.*
+org.testifyproject.mock.*
+org.testifyproject.resources.*
+org.testifyproject.server.*
+org.testifyproject.tools.*
+org.testifyproject.virtual-resources.*
+org.testinfected.*
+org.testinfected.hamcrest-matchers.*
+org.testinfected.time.*
+org.testingisdocumenting.webtau.*
+org.testingisdocumenting.znai.*
+org.testingisdocumenting.znaiblog.*
+org.testium-base.*
+org.testmonkeys.*
+org.testmp.*
+org.testmy.core.*
+org.testng.*
+org.testng.testng-remote.*
+org.testobject.*
+org.testobjects.*
+org.testpackage.*
+org.testtoolinterfaces.*
+org.textexploration.mtas.*
+org.textmapper.*
+org.textmining.*
+org.texttest.*
+org.tharos.*
+org.thatscloud.*
+org.theblackproject.*
+org.thecommonsproject.*
+org.thehive-project.*
+org.thejavaguy.*
+org.thenx.projects.*
+org.thepalaceproject.audiobook.*
+org.thepalaceproject.audiobook.audioengine.*
+org.thepalaceproject.audiobook.overdrive.*
+org.thepalaceproject.drm.*
+org.thepalaceproject.http.*
+org.thepalaceproject.r2.*
+org.thepavel.*
+org.thepavel.cubaentityloader.*
+org.thermoweb.*
+org.thermoweb.picocli.*
+org.thesoftwarecraftsman.logging.*
+org.thesoftwarecraftsman.parent.*
+org.theta4j.*
+org.thethingsnetwork.*
+org.thethingsnetwork.data.*
+org.thewonderlemming.c4plantuml.*
+org.thiki.*
+org.thingsboard.*
+org.thlws.*
+org.thoriumcube.configurate.*
+org.thoughtcrime.ssl.pinning.*
+org.threadly.*
+org.threeriverdev.*
+org.threeten.*
+org.thriftee.*
+org.thryft.*
+org.thshsh.*
+org.thymeleaf.*
+org.thymeleaf.extras.*
+org.thymeleaf.testing.*
+org.ticdev.*
+org.tickcode.*
+org.tiefaces.*
+org.tigris.antelope.*
+org.tigris.jsapar.*
+org.tigris.log4javascript.*
+org.tikv.*
+org.tiledreader.*
+org.timebench.*
+org.timen.*
+org.timepedia.chronoscope.*
+org.timepedia.exporter.*
+org.timmc.*
+org.timothyb89.*
+org.tindalos.principle.*
+org.tinfour.*
+org.tinspin.*
+org.tinygroup.*
+org.tinygroup.annotation.0.0.12.tinygroup.*
+org.tinyj.lava.*
+org.tinyj.lazy.*
+org.tinyj.web.*
+org.tinyjee.dim.*
+org.tinyjee.jgraphx.*
+org.tinylisp.*
+org.tinylog.*
+org.tinymediamanager.*
+org.tinymediamanager.plugins.*
+org.tinyradius.*
+org.tinyspline.*
+org.tinystruct.*
+org.tinywind.*
+org.tiogasolutions.apis.*
+org.tiogasolutions.app.*
+org.tiogasolutions.couchace.*
+org.tiogasolutions.dev.*
+org.tiogasolutions.jobs.*
+org.tiogasolutions.lib.*
+org.tiogasolutions.notify.*
+org.tiogasolutions.push.*
+org.tiogasolutions.runners.*
+org.tiqr.*
+org.tisonkun.failpoints.*
+org.tisonkun.hlc.*
+org.tkit.ide.*
+org.tkit.lib.*
+org.tkit.maven.*
+org.tkit.quarkus.*
+org.tkit.quarkus.app.*
+org.tkit.quarkus.lib.*
+org.tkit.quarkus.lib.it.*
+org.tkit.rhpam.*
+org.tmate.*
+org.tmatesoft.*
+org.tmatesoft.sqljet.*
+org.tmatesoft.svnkit.*
+org.tmurakam.*
+org.tnmx.*
+org.to2mbn.*
+org.tobarsegais.*
+org.togglz.*
+org.togglz.benchmark.*
+org.toile-libre.libe.*
+org.tokenscript.*
+org.tomdz.maven.*
+org.tomdz.storm.*
+org.tomdz.twirl.*
+org.tomfolga.*
+org.tomitribe.*
+org.tomitribe.activemq.*
+org.tomitribe.asmify.*
+org.tomitribe.inget.*
+org.tomitribe.jamira.*
+org.tomitribe.jkta.*
+org.tomitribe.johnzon.*
+org.tomitribe.quartz.*
+org.tomitribe.quartz.internal.*
+org.tomitribe.transformer.*
+org.tomitribe.tribestream.*
+org.tomlj.*
+org.ton.*
+org.tonicsoft.ebay.*
+org.tonicsoft.timebomb.*
+org.tools4j.*
+org.topbraid.*
+org.topicquests.*
+org.topleet.*
+org.topnetwork.*
+org.torpedoquery.*
+org.torquebox.mojo.*
+org.toucanpdf.*
+org.touchbit.buggy.*
+org.touchbit.kakafka.*
+org.touchbit.retrofit.veslo.*
+org.touchbit.shields4j.*
+org.touchbit.testrail4j.*
+org.touchbit.web.*
+org.toxos.*
+org.toxos.activiti.*
+org.toxos.process-assertions.*
+org.toxos.process-assertions.activiti.*
+org.toxos.process-assertions.flowable.*
+org.toxos.process-assertions.integration.*
+org.tp23.*
+org.tplatform.*
+org.tpolecat.*
+org.traceo.*
+org.trailsframework.*
+org.trailsframework.examples.*
+org.tranql.*
+org.transactionunit.*
+org.transentials.*
+org.travelforge.*
+org.travelforge.product.*
+org.treblereel.*
+org.treblereel.gwt.*
+org.treblereel.gwt.elemental2.*
+org.treblereel.gwt.gwtbootstrap3.*
+org.treblereel.gwt.gwtproject.*
+org.treblereel.gwt.gwtproject.animation.*
+org.treblereel.gwt.gwtproject.aria.*
+org.treblereel.gwt.gwtproject.callback.*
+org.treblereel.gwt.gwtproject.core.*
+org.treblereel.gwt.gwtproject.dom.*
+org.treblereel.gwt.gwtproject.editor.*
+org.treblereel.gwt.gwtproject.event.*
+org.treblereel.gwt.gwtproject.geolocation.*
+org.treblereel.gwt.gwtproject.http.*
+org.treblereel.gwt.gwtproject.i18n.*
+org.treblereel.gwt.gwtproject.json.*
+org.treblereel.gwt.gwtproject.jsonp.*
+org.treblereel.gwt.gwtproject.layout.*
+org.treblereel.gwt.gwtproject.regexp.*
+org.treblereel.gwt.gwtproject.resources.*
+org.treblereel.gwt.gwtproject.safehtml.*
+org.treblereel.gwt.gwtproject.storage.*
+org.treblereel.gwt.gwtproject.time.*
+org.treblereel.gwt.gwtproject.timer.*
+org.treblereel.gwt.gwtproject.typedarrays.*
+org.treblereel.gwt.gwtproject.uibinder.*
+org.treblereel.gwt.gwtproject.user.history.*
+org.treblereel.gwt.gwtproject.user.window.*
+org.treblereel.gwt.gwtproject.validation.*
+org.treblereel.gwt.gwtproject.widgets.*
+org.treblereel.gwt.gwtproject.xhr.*
+org.treblereel.gwt.gwtproject.xml.*
+org.treblereel.gwt.j2cl.*
+org.treblereel.gwt.jakarta.*
+org.treblereel.gwt.jakarta.jaxb.*
+org.treblereel.gwt.jakarta.jsonb.*
+org.treblereel.gwt.javascript.*
+org.treblereel.gwt.json.mapper.*
+org.treblereel.gwt.nio.*
+org.treblereel.gwt.resources.*
+org.treblereel.gwt.xml.mapper.*
+org.treblereel.gwt.yaml.*
+org.treblereel.gwt.yaml.mapper.*
+org.treblereel.j2cl.processors.*
+org.treetank.*
+org.treexl.*
+org.trellisldp.*
+org.trellisldp.ext.*
+org.trendafilov.confucius.*
+org.treppo.*
+org.tresql.*
+org.trestor.*
+org.tribuo.*
+org.trimou.*
+org.tripfaces.*
+org.trippi.*
+org.tros.*
+org.truemail-rb.*
+org.truenewx.*
+org.truenewx.tnxjee.*
+org.truenewx.tnxjeex.*
+org.truenewx.tnxjeex.captcha.*
+org.truenewx.tnxjeex.cas.*
+org.truenewx.tnxjeex.doc.*
+org.truenewx.tnxjeex.fss.*
+org.truenewx.tnxjeex.notice.*
+org.truenewx.tnxjeex.openapi.*
+org.truenewx.tnxjeex.openapi.client.*
+org.truenewx.tnxjeex.payment.*
+org.truffulatree.*
+org.trustedanalytics.*
+org.trustedanalytics.modelcatalog.*
+org.trustedanalytics.servicebroker.repository.*
+org.truth0.*
+org.trypticon.gum.*
+org.trypticon.haqua.*
+org.trypticon.hex.*
+org.trypticon.luceneupgrader.*
+org.tsers.zeison.*
+org.tsugi.*
+org.ttgoss.js.*
+org.ttzero.*
+org.ttzero.plugin.*
+org.tuckey.*
+org.tudalgo.*
+org.tukaani.*
+org.tunnat.*
+org.tunnat.maven.*
+org.tupol.*
+org.turbogwt.*
+org.turbogwt.core.*
+org.turbogwt.ext.*
+org.turbogwt.mvp.*
+org.turbogwt.net.*
+org.turbogwt.tools.*
+org.tuxdevelop.*
+org.tuxdude.logback.extensions.*
+org.tuzhao.*
+org.twdata.maven.*
+org.tweetyproject.*
+org.tweetyproject.agents.*
+org.tweetyproject.arg.*
+org.tweetyproject.logics.*
+org.tweetyproject.lp.*
+org.tweetyproject.lp.asp.*
+org.twelvehart.*
+org.twig4j.*
+org.twiliofaces.*
+org.twinkql.*
+org.twinnation.*
+org.twister2.*
+org.twitter4j.*
+org.twostack.*
+org.tyamashi.*
+org.tynamo.*
+org.tynamo.gae.*
+org.tynamo.security.*
+org.typefactory.*
+org.typeframed.*
+org.typelevel.*
+org.typemeta.*
+org.typesense.*
+org.typeunsafe.*
+org.tyranid.*
+org.uaparser.*
+org.ubercraft.statsd.*
+org.ubercraft.sucre.*
+org.uberfire.*
+org.ucmtwine.*
+org.uddi4j.*
+org.udger.parser.*
+org.udger.parserv4.*
+org.udtopia.*
+org.ufoss.kolog.*
+org.ufoss.kotysa.*
+org.uiautomation.*
+org.uimafit.*
+org.uispec4j.*
+org.uitnet.testing.*
+org.uitnet.testing.smartfwk.*
+org.ujmp.*
+org.ujoframework.*
+org.ujorm.*
+org.uma.jmetal.*
+org.uma.jmetalsp.*
+org.umlatj.*
+org.umlg.*
+org.umlgraph.*
+org.unbescape.*
+org.unbroken-dome.aws-codeartifact-maven-proxy.*
+org.unbroken-dome.base62.*
+org.unbroken-dome.gradle-plugin-utils.*
+org.unbroken-dome.jackson-bean-validation.*
+org.uncommons.*
+org.uncommons.maths.*
+org.uncommons.watchmaker.*
+org.unfoldingword.tools.*
+org.unidal.*
+org.unidal.cat.*
+org.unidal.foundation.*
+org.unidal.framework.*
+org.unidal.maven.plugins.*
+org.unidal.plexus.*
+org.unidal.webres.*
+org.uniflow-kt.*
+org.uniknow.*
+org.uniknow.agiledev.*
+org.uniknow.agiledev.dbc4j.*
+org.uniknow.agiledev.docMockRest.*
+org.uniknow.agiledev.support.*
+org.uniknow.agiledev.tutorials.*
+org.uniknow.asciidoc.*
+org.uniknow.c4Modeling.*
+org.uniknow.maven.plugins.*
+org.uniknow.spring.*
+org.uniknow.tomcat.*
+org.unitedid.*
+org.unitils.*
+org.unitils.cdi.*
+org.unitils.compositetest.*
+org.unitils.ftp.*
+org.unitils.jbehave.*
+org.unitils.jodatime.*
+org.unitils.mail.*
+org.unitils.objectvalidation.*
+org.unitils.selenium.*
+org.unitils.soapui.*
+org.unitils.spring.batch.*
+org.unitils.testlink.*
+org.unitime.*
+org.unittestbot.soot.*
+org.unittested.*
+org.unix4j.*
+org.unlaxer.*
+org.unprotocols.*
+org.update4j.*
+org.uqbar-project.*
+org.uqbar.*
+org.urbanbyte.cueserver.*
+org.urbantower.*
+org.urish.gwt-titanium.*
+org.urish.openal.*
+org.usb4java.*
+org.usefultoys.*
+org.usergrid.*
+org.usergrid.beanstalk.*
+org.utgenome.thirdparty.*
+org.utplsql.*
+org.vaadin.spring.*
+org.vaadin.spring.addons.*
+org.vaadin.spring.extensions.*
+org.vafer.*
+org.valdroz.vscript.*
+org.valid4j.*
+org.validoc.*
+org.valiktor.*
+org.vanilladb.*
+org.vaslabs.talos.*
+org.vatplanner.*
+org.vcsreader.*
+org.vdaas.vald.*
+org.vectomatic.*
+org.vegas-viz.*
+org.venutolo.*
+org.verapdf.*
+org.verapdf.apps.*
+org.verapdf.plugins.*
+org.verdictdb.*
+org.verifx.*
+org.veripacks.*
+org.versly.*
+org.vert-x.*
+org.vertexium.*
+org.vertx-test.*
+org.vesalainen.*
+org.vesalainen.bcc.*
+org.vesalainen.comm.*
+org.vesalainen.dsql.*
+org.vesalainen.gpx.*
+org.vesalainen.kml.*
+org.vesalainen.lpg.*
+org.vesalainen.mailblog.*
+org.vesalainen.nmea.*
+org.vesalainen.parsers.*
+org.vesalainen.rss.*
+org.vg2902.*
+org.vibur.*
+org.videolan.android.*
+org.vidtec.*
+org.viduus.*
+org.viewstreet.*
+org.vincenzolabs.*
+org.vineflower.*
+org.vinturo.api.*
+org.violetlib.*
+org.virtualbox.*
+org.virtuslab.*
+org.virtuslab.ash.*
+org.virtuslab.edi.*
+org.virtuslab.edi.unedifact.*
+org.virtuslab.ideprobe.*
+org.virtuslab.psh.*
+org.virtuslab.scala-cli-signing.*
+org.virtuslab.scala-cli.*
+org.virtuslab.semanticgraphs.*
+org.visallo.*
+org.vishag.*
+org.visola.spring.security.*
+org.visualdataweb.vowl.owl2vowl.*
+org.vite.*
+org.vite.sdk.*
+org.vitrivr.*
+org.vivaconagua.*
+org.vivoweb.*
+org.vngx.*
+org.voeetech.*
+org.voidland.m2e.*
+org.voltdb.*
+org.vootoo.*
+org.voovan.*
+org.votesmart.*
+org.vraptor.*
+org.vrp-rep.*
+org.vulpinedesigns.initiator_set.*
+org.vvcephei.*
+org.vx68k.*
+org.vx68k.bitbucket.*
+org.vx68k.hudson.plugin.*
+org.vx68k.maven.skins.*
+org.vx68k.netbeans.modules.*
+org.vx68k.quercus.*
+org.vx68k.webapp.*
+org.vx68k.webapp.pure.*
+org.vx68k.wordpress.*
+org.w007.activemq.*
+org.w3.*
+org.w3c-schemas.*
+org.w3c.*
+org.w3c.css.*
+org.w3c.ddr.*
+org.w3c.jigsaw.*
+org.w3cloud.api.*
+org.waabox.*
+org.wabase.*
+org.walkerljl.*
+org.walkmod.*
+org.walkmod.maven.plugins.*
+org.wallerlab.*
+org.wallride.*
+org.wamblee.*
+org.wamblee.glassfish.*
+org.wamblee.safe.*
+org.wandledi.*
+org.wartremover.*
+org.watertemplate.*
+org.wazzapps.*
+org.wcdevs.blog.*
+org.weakref.*
+org.web3d.x3d.tools.*
+org.web3j.*
+org.web3j.aion.*
+org.web3j.corda.*
+org.web3j.eth2.*
+org.web3j.openapi.*
+org.web3scala.*
+org.web4thejob.*
+org.webant.*
+org.webbitserver.*
+org.webcastellum.*
+org.webedded.cors.*
+org.webframe.*
+org.webframe.plugins.*
+org.webjars.*
+org.webjars.bower.*
+org.webjars.bowergithub.1000hz.*
+org.webjars.bowergithub.101arrowz.*
+org.webjars.bowergithub.10bestdesign.*
+org.webjars.bowergithub.9inpachi.*
+org.webjars.bowergithub.a1626.*
+org.webjars.bowergithub.a5hik.*
+org.webjars.bowergithub.a8m.*
+org.webjars.bowergithub.abdonrd.*
+org.webjars.bowergithub.abe90.*
+org.webjars.bowergithub.abesny.*
+org.webjars.bowergithub.ablanco.*
+org.webjars.bowergithub.abouolia.*
+org.webjars.bowergithub.abpetkov.*
+org.webjars.bowergithub.accursoft.*
+org.webjars.bowergithub.acordeonl.*
+org.webjars.bowergithub.acornjs.*
+org.webjars.bowergithub.adamwdraper.*
+org.webjars.bowergithub.adeptoas.*
+org.webjars.bowergithub.admwx7.*
+org.webjars.bowergithub.adobe-webplatform.*
+org.webjars.bowergithub.adriengibrat.*
+org.webjars.bowergithub.advanced-rest-client.*
+org.webjars.bowergithub.aesir-net.*
+org.webjars.bowergithub.afarkas.*
+org.webjars.bowergithub.afonsopacifer.*
+org.webjars.bowergithub.ag-grid.*
+org.webjars.bowergithub.agrublev.*
+org.webjars.bowergithub.aguirrel.*
+org.webjars.bowergithub.ahmadnassri.*
+org.webjars.bowergithub.ai.*
+org.webjars.bowergithub.ain.*
+org.webjars.bowergithub.aishek.*
+org.webjars.bowergithub.ajaxorg.*
+org.webjars.bowergithub.ajv-validator.*
+org.webjars.bowergithub.akottr.*
+org.webjars.bowergithub.akryum.*
+org.webjars.bowergithub.albertofdzm.*
+org.webjars.bowergithub.aleeekoi.*
+org.webjars.bowergithub.alessiogiambrone.*
+org.webjars.bowergithub.alex-d.*
+org.webjars.bowergithub.alex-saunders.*
+org.webjars.bowergithub.alexei.*
+org.webjars.bowergithub.alexindigo.*
+org.webjars.bowergithub.alexsasharegan.*
+org.webjars.bowergithub.alferov.*
+org.webjars.bowergithub.algolia.*
+org.webjars.bowergithub.alijaya.*
+org.webjars.bowergithub.alump.*
+org.webjars.bowergithub.alvaro-prieto.*
+org.webjars.bowergithub.alvarotrigo.*
+org.webjars.bowergithub.amahdy.*
+org.webjars.bowergithub.amintado.*
+org.webjars.bowergithub.amphiluke.*
+org.webjars.bowergithub.amsul.*
+org.webjars.bowergithub.andersonfriaca.*
+org.webjars.bowergithub.andreaferretti.*
+org.webjars.bowergithub.andreknieriem.*
+org.webjars.bowergithub.andremachad0.*
+org.webjars.bowergithub.andrewmiroshnichenko.*
+org.webjars.bowergithub.andrewrk.*
+org.webjars.bowergithub.angular-data-grid.*
+org.webjars.bowergithub.angular-dragdrop.*
+org.webjars.bowergithub.angular-gantt.*
+org.webjars.bowergithub.angular-translate.*
+org.webjars.bowergithub.angular-ui-tree.*
+org.webjars.bowergithub.angular-ui.*
+org.webjars.bowergithub.angular.*
+org.webjars.bowergithub.angularifyjs.*
+org.webjars.bowergithub.angulartics.*
+org.webjars.bowergithub.animate-css.*
+org.webjars.bowergithub.annsonn.*
+org.webjars.bowergithub.ansman.*
+org.webjars.bowergithub.anvaka.*
+org.webjars.bowergithub.apache.*
+org.webjars.bowergithub.apexcharts.*
+org.webjars.bowergithub.apvarun.*
+org.webjars.bowergithub.aqoviaelements.*
+org.webjars.bowergithub.arasatasaygin.*
+org.webjars.bowergithub.aratcliffe.*
+org.webjars.bowergithub.arcoirislabs.*
+org.webjars.bowergithub.arekinath.*
+org.webjars.bowergithub.arhs.*
+org.webjars.bowergithub.ariutta.*
+org.webjars.bowergithub.arodic.*
+org.webjars.bowergithub.arschmitz.*
+org.webjars.bowergithub.arsnebula.*
+org.webjars.bowergithub.arthurclemens.*
+org.webjars.bowergithub.artur-.*
+org.webjars.bowergithub.asafdav.*
+org.webjars.bowergithub.asciidoctor.*
+org.webjars.bowergithub.ashleydw.*
+org.webjars.bowergithub.atatanasov.*
+org.webjars.bowergithub.aterrien.*
+org.webjars.bowergithub.auspexeu.*
+org.webjars.bowergithub.auth0.*
+org.webjars.bowergithub.autocompletejs.*
+org.webjars.bowergithub.autonumeric.*
+org.webjars.bowergithub.avdaredevil.*
+org.webjars.bowergithub.awandor.*
+org.webjars.bowergithub.aws.*
+org.webjars.bowergithub.ax5ui.*
+org.webjars.bowergithub.axians.*
+org.webjars.bowergithub.axios.*
+org.webjars.bowergithub.b0bai.*
+org.webjars.bowergithub.babel.*
+org.webjars.bowergithub.backbone-paginator.*
+org.webjars.bowergithub.bahrus.*
+org.webjars.bowergithub.balint777.*
+org.webjars.bowergithub.bantikyan.*
+org.webjars.bowergithub.barrior.*
+org.webjars.bowergithub.basecamp.*
+org.webjars.bowergithub.beatgammit.*
+org.webjars.bowergithub.beautify-web.*
+org.webjars.bowergithub.beevelop.*
+org.webjars.bowergithub.belomx.*
+org.webjars.bowergithub.bendavis78.*
+org.webjars.bowergithub.benjaminvanryseghem.*
+org.webjars.bowergithub.benkeen.*
+org.webjars.bowergithub.benlesh.*
+org.webjars.bowergithub.bennypowers.*
+org.webjars.bowergithub.benpickles.*
+org.webjars.bowergithub.berkan52.*
+org.webjars.bowergithub.berkanakyurek.*
+org.webjars.bowergithub.berkeleytrue.*
+org.webjars.bowergithub.berndhopp.*
+org.webjars.bowergithub.bernii.*
+org.webjars.bowergithub.bestiejs.*
+org.webjars.bowergithub.bevacqua.*
+org.webjars.bowergithub.bgrins.*
+org.webjars.bowergithub.bigeasy.*
+org.webjars.bowergithub.bigskysoftware.*
+org.webjars.bowergithub.billy-hardy.*
+org.webjars.bowergithub.binhbbbb.*
+org.webjars.bowergithub.binhbbui411.*
+org.webjars.bowergithub.bisam-rd.*
+org.webjars.bowergithub.bjornstar.*
+org.webjars.bowergithub.blackrockdigital.*
+org.webjars.bowergithub.blakeembrey.*
+org.webjars.bowergithub.bloggify.*
+org.webjars.bowergithub.blueimp.*
+org.webjars.bowergithub.bluewatertracks.*
+org.webjars.bowergithub.bogie67.*
+org.webjars.bowergithub.bootflat.*
+org.webjars.bowergithub.bootstrap-tagsinput.*
+org.webjars.bowergithub.bootstrap-vue.*
+org.webjars.bowergithub.borgar.*
+org.webjars.bowergithub.borismoore.*
+org.webjars.bowergithub.borjagodoy.*
+org.webjars.bowergithub.bpampuch.*
+org.webjars.bowergithub.bpmn-io.*
+org.webjars.bowergithub.braisdom.*
+org.webjars.bowergithub.bramp.*
+org.webjars.bowergithub.bramstein.*
+org.webjars.bowergithub.brenard.*
+org.webjars.bowergithub.briancherne.*
+org.webjars.bowergithub.brianreavis.*
+org.webjars.bowergithub.brightcove.*
+org.webjars.bowergithub.brightspace.*
+org.webjars.bowergithub.brightspaceui.*
+org.webjars.bowergithub.brix.*
+org.webjars.bowergithub.brockpetrie.*
+org.webjars.bowergithub.broofa.*
+org.webjars.bowergithub.browserify.*
+org.webjars.bowergithub.brunob.*
+org.webjars.bowergithub.bttstrp.*
+org.webjars.bowergithub.buefy.*
+org.webjars.bowergithub.byjg.*
+org.webjars.bowergithub.c3js.*
+org.webjars.bowergithub.caldwell.*
+org.webjars.bowergithub.calebjacob.*
+org.webjars.bowergithub.caligatio.*
+org.webjars.bowergithub.calvinmetcalf.*
+org.webjars.bowergithub.campuslabs.*
+org.webjars.bowergithub.camunda.*
+org.webjars.bowergithub.canvg.*
+org.webjars.bowergithub.caolan.*
+org.webjars.bowergithub.captaincodeman.*
+org.webjars.bowergithub.caribouflex.*
+org.webjars.bowergithub.carrooi.*
+org.webjars.bowergithub.catc.*
+org.webjars.bowergithub.cburgmer.*
+org.webjars.bowergithub.cesiumgs.*
+org.webjars.bowergithub.cferdinandi.*
+org.webjars.bowergithub.cforgeard.*
+org.webjars.bowergithub.cgross.*
+org.webjars.bowergithub.chadweimer.*
+org.webjars.bowergithub.chaijs.*
+org.webjars.bowergithub.chainsafe.*
+org.webjars.bowergithub.chalk.*
+org.webjars.bowergithub.chalker.*
+org.webjars.bowergithub.charliekassel.*
+org.webjars.bowergithub.chartjs.*
+org.webjars.bowergithub.chenfengjw163.*
+org.webjars.bowergithub.chenglou.*
+org.webjars.bowergithub.chieffancypants.*
+org.webjars.bowergithub.chjj.*
+org.webjars.bowergithub.chniter.*
+org.webjars.bowergithub.choffmeister.*
+org.webjars.bowergithub.choices-js.*
+org.webjars.bowergithub.ciaoca.*
+org.webjars.bowergithub.circlingthesun.*
+org.webjars.bowergithub.cisrudlow.*
+org.webjars.bowergithub.ckeditor.*
+org.webjars.bowergithub.clappr.*
+org.webjars.bowergithub.classlinkinc.*
+org.webjars.bowergithub.claviska.*
+org.webjars.bowergithub.clientio.*
+org.webjars.bowergithub.cliffcloud.*
+org.webjars.bowergithub.cloudflare.*
+org.webjars.bowergithub.cloudogu.*
+org.webjars.bowergithub.cloudydirk.*
+org.webjars.bowergithub.codebyzach.*
+org.webjars.bowergithub.codemirror.*
+org.webjars.bowergithub.coderaiser.*
+org.webjars.bowergithub.codeseven.*
+org.webjars.bowergithub.collaborne.*
+org.webjars.bowergithub.colorjs.*
+org.webjars.bowergithub.commonmark.*
+org.webjars.bowergithub.component.*
+org.webjars.bowergithub.components.*
+org.webjars.bowergithub.connec.*
+org.webjars.bowergithub.convoo.*
+org.webjars.bowergithub.coronio.*
+org.webjars.bowergithub.coryasilva.*
+org.webjars.bowergithub.cowboy.*
+org.webjars.bowergithub.crabbly.*
+org.webjars.bowergithub.crabl.*
+org.webjars.bowergithub.craftoncu.*
+org.webjars.bowergithub.craftpip.*
+org.webjars.bowergithub.createjs.*
+org.webjars.bowergithub.creativetimofficial.*
+org.webjars.bowergithub.crossfilter.*
+org.webjars.bowergithub.csakaszamok.*
+org.webjars.bowergithub.csonnhalter.*
+org.webjars.bowergithub.cubexelements.*
+org.webjars.bowergithub.cubiq.*
+org.webjars.bowergithub.cure53.*
+org.webjars.bowergithub.cvuorinen.*
+org.webjars.bowergithub.cwspear.*
+org.webjars.bowergithub.cytoscape.*
+org.webjars.bowergithub.d3.*
+org.webjars.bowergithub.dabeng.*
+org.webjars.bowergithub.dabolus.*
+org.webjars.bowergithub.dagrejs.*
+org.webjars.bowergithub.daihere1993.*
+org.webjars.bowergithub.dakmor.*
+org.webjars.bowergithub.daneden.*
+org.webjars.bowergithub.dangrossman.*
+org.webjars.bowergithub.danialfarid.*
+org.webjars.bowergithub.danielfarrell.*
+org.webjars.bowergithub.danielstern.*
+org.webjars.bowergithub.danielx.*
+org.webjars.bowergithub.danvk.*
+org.webjars.bowergithub.darsain.*
+org.webjars.bowergithub.dashed.*
+org.webjars.bowergithub.datadog.*
+org.webjars.bowergithub.datatables.*
+org.webjars.bowergithub.date-fns.*
+org.webjars.bowergithub.datetime.*
+org.webjars.bowergithub.david-mulder.*
+org.webjars.bowergithub.davidjbradshaw.*
+org.webjars.bowergithub.davidmerfield.*
+org.webjars.bowergithub.davidrleonard.*
+org.webjars.bowergithub.davidstutz.*
+org.webjars.bowergithub.davidvanlaatum.*
+org.webjars.bowergithub.davidwittenbrink.*
+org.webjars.bowergithub.davisford.*
+org.webjars.bowergithub.dbkaplun.*
+org.webjars.bowergithub.dbushell.*
+org.webjars.bowergithub.dc-js.*
+org.webjars.bowergithub.dcodeio.*
+org.webjars.bowergithub.deblanco.*
+org.webjars.bowergithub.ded.*
+org.webjars.bowergithub.deepstreamio.*
+org.webjars.bowergithub.defunctzombie.*
+org.webjars.bowergithub.defunkt.*
+org.webjars.bowergithub.den-dp.*
+org.webjars.bowergithub.denisemauldin.*
+org.webjars.bowergithub.desandro.*
+org.webjars.bowergithub.deuxhuithuit.*
+org.webjars.bowergithub.devbridge.*
+org.webjars.bowergithub.developit.*
+org.webjars.bowergithub.devforth.*
+org.webjars.bowergithub.dgoguerra.*
+org.webjars.bowergithub.dibari.*
+org.webjars.bowergithub.diddledan.*
+org.webjars.bowergithub.diegotremper.*
+org.webjars.bowergithub.digelements.*
+org.webjars.bowergithub.digicorp.*
+org.webjars.bowergithub.digitalbazaar.*
+org.webjars.bowergithub.digitaldesignlabs.*
+org.webjars.bowergithub.diguoyihao.*
+org.webjars.bowergithub.diiogo91.*
+org.webjars.bowergithub.dimitarchristoff.*
+org.webjars.bowergithub.dimsemenov.*
+org.webjars.bowergithub.dimshadowww.*
+org.webjars.bowergithub.diosney.*
+org.webjars.bowergithub.divshot.*
+org.webjars.bowergithub.djbuen.*
+org.webjars.bowergithub.dloeda.*
+org.webjars.bowergithub.dmester.*
+org.webjars.bowergithub.dmitrybaranovskiy.*
+org.webjars.bowergithub.dmuy.*
+org.webjars.bowergithub.docluv.*
+org.webjars.bowergithub.dodo.*
+org.webjars.bowergithub.doersguild.*
+org.webjars.bowergithub.dogfalo.*
+org.webjars.bowergithub.dojo.*
+org.webjars.bowergithub.domenic.*
+org.webjars.bowergithub.domoritz.*
+org.webjars.bowergithub.doowb.*
+org.webjars.bowergithub.doubletrade.*
+org.webjars.bowergithub.dougwilson.*
+org.webjars.bowergithub.dperini.*
+org.webjars.bowergithub.dqmmpb.*
+org.webjars.bowergithub.dreamerlxb.*
+org.webjars.bowergithub.dreamerslab.*
+org.webjars.bowergithub.dreammmr.*
+org.webjars.bowergithub.dropbox.*
+org.webjars.bowergithub.dropzone.*
+org.webjars.bowergithub.drvic10k.*
+org.webjars.bowergithub.dwlabcube.*
+org.webjars.bowergithub.dykisa.*
+org.webjars.bowergithub.easymetahub.*
+org.webjars.bowergithub.easysoft.*
+org.webjars.bowergithub.ebidel.*
+org.webjars.bowergithub.ecomfe.*
+org.webjars.bowergithub.edwar6.*
+org.webjars.bowergithub.edwardsharp.*
+org.webjars.bowergithub.edy5016.*
+org.webjars.bowergithub.ee.*
+org.webjars.bowergithub.egonolieux.*
+org.webjars.bowergithub.ehpc.*
+org.webjars.bowergithub.ekoopmans.*
+org.webjars.bowergithub.electerious.*
+org.webjars.bowergithub.elesdoar.*
+org.webjars.bowergithub.eligrey.*
+org.webjars.bowergithub.ellipticaljs.*
+org.webjars.bowergithub.elmot.*
+org.webjars.bowergithub.elvomka.*
+org.webjars.bowergithub.emersion.*
+org.webjars.bowergithub.emmerich.*
+org.webjars.bowergithub.emn178.*
+org.webjars.bowergithub.enyo.*
+org.webjars.bowergithub.eonasdan.*
+org.webjars.bowergithub.epa-wg.*
+org.webjars.bowergithub.epoberezkin.*
+org.webjars.bowergithub.ergo.*
+org.webjars.bowergithub.ericdrowell.*
+org.webjars.bowergithub.ericjgagnon.*
+org.webjars.bowergithub.erikflowers.*
+org.webjars.bowergithub.eriklumme.*
+org.webjars.bowergithub.es-shims.*
+org.webjars.bowergithub.es128.*
+org.webjars.bowergithub.esapi.*
+org.webjars.bowergithub.eslint.*
+org.webjars.bowergithub.esri.*
+org.webjars.bowergithub.esteinborn.*
+org.webjars.bowergithub.estools.*
+org.webjars.bowergithub.eu-evops.*
+org.webjars.bowergithub.eventemitter2.*
+org.webjars.bowergithub.exif-js.*
+org.webjars.bowergithub.exmg.*
+org.webjars.bowergithub.expandjs.*
+org.webjars.bowergithub.faan11.*
+org.webjars.bowergithub.fabbricadigitale.*
+org.webjars.bowergithub.fabiospampinato.*
+org.webjars.bowergithub.fabricelements.*
+org.webjars.bowergithub.fabricjs.*
+org.webjars.bowergithub.facebook.*
+org.webjars.bowergithub.facebookarchive.*
+org.webjars.bowergithub.faisalferoz.*
+org.webjars.bowergithub.faisalman.*
+org.webjars.bowergithub.fancyapps.*
+org.webjars.bowergithub.farbelous.*
+org.webjars.bowergithub.fb55.*
+org.webjars.bowergithub.felixge.*
+org.webjars.bowergithub.felixruponen.*
+org.webjars.bowergithub.felixzapata.*
+org.webjars.bowergithub.fengyuanchen.*
+org.webjars.bowergithub.fent.*
+org.webjars.bowergithub.ferbueno.*
+org.webjars.bowergithub.feross.*
+org.webjars.bowergithub.festify.*
+org.webjars.bowergithub.fex-team.*
+org.webjars.bowergithub.fezvrasta.*
+org.webjars.bowergithub.fians.*
+org.webjars.bowergithub.filamentgroup.*
+org.webjars.bowergithub.fineuploader.*
+org.webjars.bowergithub.fingerprintjs.*
+org.webjars.bowergithub.firebase.*
+org.webjars.bowergithub.firebaseextended.*
+org.webjars.bowergithub.fjsc.*
+org.webjars.bowergithub.flamingtempura.*
+org.webjars.bowergithub.flatio.*
+org.webjars.bowergithub.flatlogic.*
+org.webjars.bowergithub.flatpickr.*
+org.webjars.bowergithub.flesler.*
+org.webjars.bowergithub.flexberry.*
+org.webjars.bowergithub.floatdrop.*
+org.webjars.bowergithub.floating-ui.*
+org.webjars.bowergithub.florianfe.*
+org.webjars.bowergithub.flot.*
+org.webjars.bowergithub.flowjs.*
+org.webjars.bowergithub.flozz.*
+org.webjars.bowergithub.fluorumlabs.*
+org.webjars.bowergithub.fntneves.*
+org.webjars.bowergithub.foliotek.*
+org.webjars.bowergithub.fomantic.*
+org.webjars.bowergithub.fooloomanzoo.*
+org.webjars.bowergithub.forbeslindesay.*
+org.webjars.bowergithub.form-data.*
+org.webjars.bowergithub.fortawesome.*
+org.webjars.bowergithub.foundation.*
+org.webjars.bowergithub.fraed.*
+org.webjars.bowergithub.franciscop.*
+org.webjars.bowergithub.frdh.*
+org.webjars.bowergithub.free-jqgrid.*
+org.webjars.bowergithub.freudflintstone.*
+org.webjars.bowergithub.fronteed.*
+org.webjars.bowergithub.fs-webcomponents.*
+org.webjars.bowergithub.fsx950223.*
+org.webjars.bowergithub.ftlabs.*
+org.webjars.bowergithub.fullcalendar.*
+org.webjars.bowergithub.fullopt.*
+org.webjars.bowergithub.fxedel.*
+org.webjars.bowergithub.gabceb.*
+org.webjars.bowergithub.gabiaxel.*
+org.webjars.bowergithub.gaearon.*
+org.webjars.bowergithub.gajus.*
+org.webjars.bowergithub.gamtiq.*
+org.webjars.bowergithub.garycourt.*
+org.webjars.bowergithub.gasparesganga.*
+org.webjars.bowergithub.gatanaso.*
+org.webjars.bowergithub.gbrousse-recia.*
+org.webjars.bowergithub.gdi2290.*
+org.webjars.bowergithub.geoloeg.*
+org.webjars.bowergithub.getify.*
+org.webjars.bowergithub.getmeuk.*
+org.webjars.bowergithub.getsentry.*
+org.webjars.bowergithub.ghybs.*
+org.webjars.bowergithub.gianlucaguarini.*
+org.webjars.bowergithub.gillardo.*
+org.webjars.bowergithub.gitbrent.*
+org.webjars.bowergithub.github.*
+org.webjars.bowergithub.gkz.*
+org.webjars.bowergithub.gliffy.*
+org.webjars.bowergithub.glitch0011.*
+org.webjars.bowergithub.glo-js.*
+org.webjars.bowergithub.globalizejs.*
+org.webjars.bowergithub.gnurub.*
+org.webjars.bowergithub.goiblas.*
+org.webjars.bowergithub.goldfire.*
+org.webjars.bowergithub.google.*
+org.webjars.bowergithub.googlearchive.*
+org.webjars.bowergithub.googlecast.*
+org.webjars.bowergithub.googlechrome.*
+org.webjars.bowergithub.googlechromelabs.*
+org.webjars.bowergithub.googlewebcomponents.*
+org.webjars.bowergithub.gpac.*
+org.webjars.bowergithub.grad-michal.*
+org.webjars.bowergithub.granze.*
+org.webjars.bowergithub.greenyouse.*
+org.webjars.bowergithub.gregjacobs.*
+org.webjars.bowergithub.gridstack.*
+org.webjars.bowergithub.groundworkcss.*
+org.webjars.bowergithub.grumpypufferfish.*
+org.webjars.bowergithub.gruntjs.*
+org.webjars.bowergithub.gseguin.*
+org.webjars.bowergithub.gthmb.*
+org.webjars.bowergithub.guillaumepotier.*
+org.webjars.bowergithub.gumroad.*
+org.webjars.bowergithub.gyrocode.*
+org.webjars.bowergithub.hackedbychinese.*
+org.webjars.bowergithub.haithemmosbahi.*
+org.webjars.bowergithub.hakimel.*
+org.webjars.bowergithub.hammerjs.*
+org.webjars.bowergithub.handsontable.*
+org.webjars.bowergithub.harvesthq.*
+org.webjars.bowergithub.haubek.*
+org.webjars.bowergithub.headcr4sh.*
+org.webjars.bowergithub.headjs.*
+org.webjars.bowergithub.heelhook.*
+org.webjars.bowergithub.hejty.*
+org.webjars.bowergithub.helpers.*
+org.webjars.bowergithub.here-be.*
+org.webjars.bowergithub.heremaps.*
+org.webjars.bowergithub.heresyrt.*
+org.webjars.bowergithub.heruan.*
+org.webjars.bowergithub.hgoebl.*
+org.webjars.bowergithub.hhurz.*
+org.webjars.bowergithub.hiddentao.*
+org.webjars.bowergithub.highlightjs.*
+org.webjars.bowergithub.hikarock.*
+org.webjars.bowergithub.hilios.*
+org.webjars.bowergithub.hipay.*
+org.webjars.bowergithub.hippich.*
+org.webjars.bowergithub.hoikin.*
+org.webjars.bowergithub.hollowdoor.*
+org.webjars.bowergithub.homerjonathan.*
+org.webjars.bowergithub.honatas.*
+org.webjars.bowergithub.howking.*
+org.webjars.bowergithub.hoxxep.*
+org.webjars.bowergithub.hrynko.*
+org.webjars.bowergithub.htmlelements.*
+org.webjars.bowergithub.huaban.*
+org.webjars.bowergithub.hubspot.*
+org.webjars.bowergithub.hughsk.*
+org.webjars.bowergithub.hustcc.*
+org.webjars.bowergithub.hwcrypto.*
+org.webjars.bowergithub.hypercubed.*
+org.webjars.bowergithub.i18next.*
+org.webjars.bowergithub.iamdustan.*
+org.webjars.bowergithub.iberasoft.*
+org.webjars.bowergithub.ibmresearch.*
+org.webjars.bowergithub.iconic.*
+org.webjars.bowergithub.icons8.*
+org.webjars.bowergithub.idanen.*
+org.webjars.bowergithub.iftachsadeh.*
+org.webjars.bowergithub.igor10k.*
+org.webjars.bowergithub.igorescobar.*
+org.webjars.bowergithub.igosuki.*
+org.webjars.bowergithub.imakewebthings.*
+org.webjars.bowergithub.imdario.*
+org.webjars.bowergithub.immersive-web.*
+org.webjars.bowergithub.immutable-js.*
+org.webjars.bowergithub.inacho.*
+org.webjars.bowergithub.indrimuska.*
+org.webjars.bowergithub.indutny.*
+org.webjars.bowergithub.inexorabletash.*
+org.webjars.bowergithub.ingressorapidowebcomponents.*
+org.webjars.bowergithub.inikulin.*
+org.webjars.bowergithub.inorganik.*
+org.webjars.bowergithub.insites.*
+org.webjars.bowergithub.intercoolerjs.*
+org.webjars.bowergithub.inuitcss.*
+org.webjars.bowergithub.ionden.*
+org.webjars.bowergithub.ionic-team.*
+org.webjars.bowergithub.ireade.*
+org.webjars.bowergithub.irvingwa.*
+org.webjars.bowergithub.isaacs.*
+org.webjars.bowergithub.isteven.*
+org.webjars.bowergithub.istvan-ujjmeszaros.*
+org.webjars.bowergithub.isuwang.*
+org.webjars.bowergithub.iswpolymerelements.*
+org.webjars.bowergithub.italia.*
+org.webjars.bowergithub.itsjavi.*
+org.webjars.bowergithub.ivaynberg.*
+org.webjars.bowergithub.jackmoore.*
+org.webjars.bowergithub.jackocnr.*
+org.webjars.bowergithub.jacobs63.*
+org.webjars.bowergithub.jakubpawlowicz.*
+org.webjars.bowergithub.jalaali.*
+org.webjars.bowergithub.jam3.*
+org.webjars.bowergithub.jamesflorentino.*
+org.webjars.bowergithub.jamiebuilds.*
+org.webjars.bowergithub.janantala.*
+org.webjars.bowergithub.janl.*
+org.webjars.bowergithub.janpaepke.*
+org.webjars.bowergithub.jaredhanson.*
+org.webjars.bowergithub.jashkenas.*
+org.webjars.bowergithub.jasmine.*
+org.webjars.bowergithub.jasny.*
+org.webjars.bowergithub.jasondavies.*
+org.webjars.bowergithub.jasonday.*
+org.webjars.bowergithub.javadev.*
+org.webjars.bowergithub.jaysunsyn.*
+org.webjars.bowergithub.jaywcjlove.*
+org.webjars.bowergithub.jaz303.*
+org.webjars.bowergithub.jbaysolutions.*
+org.webjars.bowergithub.jcgueriaud.*
+org.webjars.bowergithub.jchamois.*
+org.webjars.bowergithub.jcrestel.*
+org.webjars.bowergithub.jcubic.*
+org.webjars.bowergithub.jdecked.*
+org.webjars.bowergithub.jdewit.*
+org.webjars.bowergithub.jdorn.*
+org.webjars.bowergithub.jedwatson.*
+org.webjars.bowergithub.jefflefoll.*
+org.webjars.bowergithub.jensyt.*
+org.webjars.bowergithub.jgraph.*
+org.webjars.bowergithub.jgthms.*
+org.webjars.bowergithub.jhaygt.*
+org.webjars.bowergithub.jifalops.*
+org.webjars.bowergithub.jjcosgrove.*
+org.webjars.bowergithub.jmesnil.*
+org.webjars.bowergithub.jnyryan.*
+org.webjars.bowergithub.jo-geek.*
+org.webjars.bowergithub.joaomarccos.*
+org.webjars.bowergithub.joeherwig.*
+org.webjars.bowergithub.joelcolucci.*
+org.webjars.bowergithub.joeldbirch.*
+org.webjars.bowergithub.joequery.*
+org.webjars.bowergithub.jonaszuberbuehler.*
+org.webjars.bowergithub.jonathanong.*
+org.webjars.bowergithub.jonrimmer.*
+org.webjars.bowergithub.jonschlinkert.*
+org.webjars.bowergithub.jonthornton.*
+org.webjars.bowergithub.jorgecasar.*
+org.webjars.bowergithub.josdejong.*
+org.webjars.bowergithub.josecebe.*
+org.webjars.bowergithub.joshwnj.*
+org.webjars.bowergithub.jouni.*
+org.webjars.bowergithub.joyent.*
+org.webjars.bowergithub.jpillora.*
+org.webjars.bowergithub.jquery-form.*
+org.webjars.bowergithub.jquery-validation.*
+org.webjars.bowergithub.jquery.*
+org.webjars.bowergithub.js-cli.*
+org.webjars.bowergithub.js-cookie.*
+org.webjars.bowergithub.jschr.*
+org.webjars.bowergithub.jsdom.*
+org.webjars.bowergithub.jshjohnson.*
+org.webjars.bowergithub.jshttp.*
+org.webjars.bowergithub.jsmreese.*
+org.webjars.bowergithub.jsonform.*
+org.webjars.bowergithub.jsonpath-plus.*
+org.webjars.bowergithub.jsor.*
+org.webjars.bowergithub.jsplumb.*
+org.webjars.bowergithub.jsteunou.*
+org.webjars.bowergithub.jstroem.*
+org.webjars.bowergithub.jsxc.*
+org.webjars.bowergithub.juchar.*
+org.webjars.bowergithub.juicy.*
+org.webjars.bowergithub.juliangarnier.*
+org.webjars.bowergithub.juliangruber.*
+org.webjars.bowergithub.julianshapiro.*
+org.webjars.bowergithub.julmot.*
+org.webjars.bowergithub.juravenator.*
+org.webjars.bowergithub.justinribeiro.*
+org.webjars.bowergithub.jvandemo.*
+org.webjars.bowergithub.jvitela.*
+org.webjars.bowergithub.jzaefferer.*
+org.webjars.bowergithub.kabirbaidhya.*
+org.webjars.bowergithub.kaffamobile.*
+org.webjars.bowergithub.kaihenzler.*
+org.webjars.bowergithub.kaluginserg.*
+org.webjars.bowergithub.kamranahmedse.*
+org.webjars.bowergithub.kangax.*
+org.webjars.bowergithub.kaperusov.*
+org.webjars.bowergithub.kapetan.*
+org.webjars.bowergithub.kartena.*
+org.webjars.bowergithub.kartik-v.*
+org.webjars.bowergithub.katex.*
+org.webjars.bowergithub.katmore.*
+org.webjars.bowergithub.kazupon.*
+org.webjars.bowergithub.kbartas.*
+org.webjars.bowergithub.kcmr.*
+org.webjars.bowergithub.keanulee.*
+org.webjars.bowergithub.kelektiv.*
+org.webjars.bowergithub.kennethklee.*
+org.webjars.bowergithub.kentcdodds.*
+org.webjars.bowergithub.kenwheeler.*
+org.webjars.bowergithub.kevalbhatt.*
+org.webjars.bowergithub.kevinchappell.*
+org.webjars.bowergithub.kevva.*
+org.webjars.bowergithub.keyamoon.*
+org.webjars.bowergithub.khan.*
+org.webjars.bowergithub.kikinteractive.*
+org.webjars.bowergithub.killercodemonkey.*
+org.webjars.bowergithub.kimmobrunfeldt.*
+org.webjars.bowergithub.kindsoft.*
+org.webjars.bowergithub.kirstein.*
+org.webjars.bowergithub.kjur.*
+org.webjars.bowergithub.kkliebersbach.*
+org.webjars.bowergithub.kklorenzotesta.*
+org.webjars.bowergithub.kkpoon.*
+org.webjars.bowergithub.klaudeta.*
+org.webjars.bowergithub.knockout-contrib.*
+org.webjars.bowergithub.knockout.*
+org.webjars.bowergithub.knreise.*
+org.webjars.bowergithub.koada-os.*
+org.webjars.bowergithub.kogmbh.*
+org.webjars.bowergithub.kollavarsham.*
+org.webjars.bowergithub.konvajs.*
+org.webjars.bowergithub.koss-lebedev.*
+org.webjars.bowergithub.kpdecker.*
+org.webjars.bowergithub.krasimir.*
+org.webjars.bowergithub.krisk.*
+org.webjars.bowergithub.kriskowal.*
+org.webjars.bowergithub.krispo.*
+org.webjars.bowergithub.kristoferjoseph.*
+org.webjars.bowergithub.kristopolous.*
+org.webjars.bowergithub.kriszyp.*
+org.webjars.bowergithub.kswedberg.*
+org.webjars.bowergithub.ksylvest.*
+org.webjars.bowergithub.kuhnza.*
+org.webjars.bowergithub.kurento.*
+org.webjars.bowergithub.kurentoforks.*
+org.webjars.bowergithub.kurtcarpenter.*
+org.webjars.bowergithub.kyleamathews.*
+org.webjars.bowergithub.kylefox.*
+org.webjars.bowergithub.lai-nam.*
+org.webjars.bowergithub.lancedikson.*
+org.webjars.bowergithub.landi1993.*
+org.webjars.bowergithub.larrymyers.*
+org.webjars.bowergithub.layerssss.*
+org.webjars.bowergithub.layui.*
+org.webjars.bowergithub.leaflet-extras.*
+org.webjars.bowergithub.leaflet.*
+org.webjars.bowergithub.lekoala.*
+org.webjars.bowergithub.lemaik.*
+org.webjars.bowergithub.leocaseiro.*
+org.webjars.bowergithub.leongersen.*
+org.webjars.bowergithub.leonidas-from-xiv.*
+org.webjars.bowergithub.less.*
+org.webjars.bowergithub.lgalfaso.*
+org.webjars.bowergithub.lgarron.*
+org.webjars.bowergithub.liabru.*
+org.webjars.bowergithub.liferay.*
+org.webjars.bowergithub.likeastore.*
+org.webjars.bowergithub.limonte.*
+org.webjars.bowergithub.lindell.*
+org.webjars.bowergithub.link2twenty.*
+org.webjars.bowergithub.linkgod.*
+org.webjars.bowergithub.linusu.*
+org.webjars.bowergithub.lipis.*
+org.webjars.bowergithub.lirantal.*
+org.webjars.bowergithub.ljharb.*
+org.webjars.bowergithub.lloiser.*
+org.webjars.bowergithub.lodash.*
+org.webjars.bowergithub.loefflefarn.*
+org.webjars.bowergithub.lokesh.*
+org.webjars.bowergithub.lordoftheflies.*
+org.webjars.bowergithub.lostinbrittany.*
+org.webjars.bowergithub.lou.*
+org.webjars.bowergithub.lovasoa.*
+org.webjars.bowergithub.lpology.*
+org.webjars.bowergithub.lquixada.*
+org.webjars.bowergithub.lrsjng.*
+org.webjars.bowergithub.lsspolymerelements.*
+org.webjars.bowergithub.lttb.*
+org.webjars.bowergithub.ludo.*
+org.webjars.bowergithub.lukasolson.*
+org.webjars.bowergithub.lukasoppermann.*
+org.webjars.bowergithub.lukemarsh.*
+org.webjars.bowergithub.lydell.*
+org.webjars.bowergithub.maciej-gurban.*
+org.webjars.bowergithub.madbook.*
+org.webjars.bowergithub.madrobby.*
+org.webjars.bowergithub.makeusabrew.*
+org.webjars.bowergithub.malihu.*
+org.webjars.bowergithub.manohar-gunturu.*
+org.webjars.bowergithub.manolo.*
+org.webjars.bowergithub.manuelstofer.*
+org.webjars.bowergithub.manufosela.*
+org.webjars.bowergithub.mapbox.*
+org.webjars.bowergithub.maps4html.*
+org.webjars.bowergithub.mar10.*
+org.webjars.bowergithub.marioizquierdo.*
+org.webjars.bowergithub.mariomka.*
+org.webjars.bowergithub.marionettejs.*
+org.webjars.bowergithub.maritzstl.*
+org.webjars.bowergithub.mariusgundersen.*
+org.webjars.bowergithub.markcell.*
+org.webjars.bowergithub.markdown-it.*
+org.webjars.bowergithub.markedjs.*
+org.webjars.bowergithub.markjameshoward.*
+org.webjars.bowergithub.markushedvall.*
+org.webjars.bowergithub.markusslima.*
+org.webjars.bowergithub.massiveart.*
+org.webjars.bowergithub.material-components.*
+org.webjars.bowergithub.matfish2.*
+org.webjars.bowergithub.mathiasbynens.*
+org.webjars.bowergithub.mathjax.*
+org.webjars.bowergithub.matiasgagliano.*
+org.webjars.bowergithub.mattbryson.*
+org.webjars.bowergithub.mattdesl.*
+org.webjars.bowergithub.matthew-andrews.*
+org.webjars.bowergithub.matthewp.*
+org.webjars.bowergithub.max-favilli.*
+org.webjars.bowergithub.maxart2501.*
+org.webjars.bowergithub.maxazan.*
+org.webjars.bowergithub.mbenford.*
+org.webjars.bowergithub.mbostock-bower.*
+org.webjars.bowergithub.mckamey.*
+org.webjars.bowergithub.mckreukniet.*
+org.webjars.bowergithub.mcsherrylabs.*
+org.webjars.bowergithub.mdarse.*
+org.webjars.bowergithub.mdbootstrap.*
+org.webjars.bowergithub.mdgeek.*
+org.webjars.bowergithub.mediaelement.*
+org.webjars.bowergithub.medialize.*
+org.webjars.bowergithub.medikoo.*
+org.webjars.bowergithub.meetecho.*
+org.webjars.bowergithub.mermaid-js.*
+org.webjars.bowergithub.messageformat.*
+org.webjars.bowergithub.metafizzy.*
+org.webjars.bowergithub.metricsgraphics.*
+org.webjars.bowergithub.mfranzke.*
+org.webjars.bowergithub.mgalante.*
+org.webjars.bowergithub.mgcrea.*
+org.webjars.bowergithub.mgibas.*
+org.webjars.bowergithub.mhart.*
+org.webjars.bowergithub.mhevery.*
+org.webjars.bowergithub.mholt.*
+org.webjars.bowergithub.mhuggins.*
+org.webjars.bowergithub.micc83.*
+org.webjars.bowergithub.michael-silva.*
+org.webjars.bowergithub.michaelrhodes.*
+org.webjars.bowergithub.michaelwittig.*
+org.webjars.bowergithub.micku7zu.*
+org.webjars.bowergithub.micromatch.*
+org.webjars.bowergithub.microsoft.*
+org.webjars.bowergithub.miguelsmuller.*
+org.webjars.bowergithub.mikejacobson.*
+org.webjars.bowergithub.mikemcl.*
+org.webjars.bowergithub.milligram.*
+org.webjars.bowergithub.minitek.*
+org.webjars.bowergithub.miromannino.*
+org.webjars.bowergithub.mistic100.*
+org.webjars.bowergithub.mistio.*
+org.webjars.bowergithub.miztroh.*
+org.webjars.bowergithub.mkoryak.*
+org.webjars.bowergithub.mlisook.*
+org.webjars.bowergithub.mlunnay.*
+org.webjars.bowergithub.mmckegg.*
+org.webjars.bowergithub.mmpcelements.*
+org.webjars.bowergithub.mnater.*
+org.webjars.bowergithub.mobius1.*
+org.webjars.bowergithub.mochajs.*
+org.webjars.bowergithub.mohammadyounes.*
+org.webjars.bowergithub.mojs.*
+org.webjars.bowergithub.moll.*
+org.webjars.bowergithub.moment.*
+org.webjars.bowergithub.mondial7.*
+org.webjars.bowergithub.monodnb.*
+org.webjars.bowergithub.monospaced.*
+org.webjars.bowergithub.mootools.*
+org.webjars.bowergithub.morbidick.*
+org.webjars.bowergithub.morgul.*
+org.webjars.bowergithub.morrisjs.*
+org.webjars.bowergithub.motss.*
+org.webjars.bowergithub.mottie.*
+org.webjars.bowergithub.mourner.*
+org.webjars.bowergithub.mouse0270.*
+org.webjars.bowergithub.moxiecode.*
+org.webjars.bowergithub.mozilla-comm.*
+org.webjars.bowergithub.mozilla.*
+org.webjars.bowergithub.mpachnis.*
+org.webjars.bowergithub.mridgway.*
+org.webjars.bowergithub.mrjasonweaver.*
+org.webjars.bowergithub.mrmarkfrench.*
+org.webjars.bowergithub.mroderick.*
+org.webjars.bowergithub.mrrio.*
+org.webjars.bowergithub.muan.*
+org.webjars.bowergithub.muhansng.*
+org.webjars.bowergithub.muicss.*
+org.webjars.bowergithub.mulesoft.*
+org.webjars.bowergithub.mvindahl.*
+org.webjars.bowergithub.myclabs.*
+org.webjars.bowergithub.myfrom.*
+org.webjars.bowergithub.mymth.*
+org.webjars.bowergithub.myscript.*
+org.webjars.bowergithub.mziccard.*
+org.webjars.bowergithub.n1k145.*
+org.webjars.bowergithub.naereen.*
+org.webjars.bowergithub.nakupanda.*
+org.webjars.bowergithub.natashawylie.*
+org.webjars.bowergithub.naver.*
+org.webjars.bowergithub.ndavison.*
+org.webjars.bowergithub.necolas.*
+org.webjars.bowergithub.needim.*
+org.webjars.bowergithub.neilj.*
+org.webjars.bowergithub.neilujd.*
+org.webjars.bowergithub.neofusion.*
+org.webjars.bowergithub.neovici.*
+org.webjars.bowergithub.nervgh.*
+org.webjars.bowergithub.neveldo.*
+org.webjars.bowergithub.next-ui.*
+org.webjars.bowergithub.nfrasser.*
+org.webjars.bowergithub.ngreact.*
+org.webjars.bowergithub.nhn.*
+org.webjars.bowergithub.nhnent.*
+org.webjars.bowergithub.nickcherry.*
+org.webjars.bowergithub.nicolaskruchten.*
+org.webjars.bowergithub.nicolasr75.*
+org.webjars.bowergithub.nightowl888.*
+org.webjars.bowergithub.niklasvh.*
+org.webjars.bowergithub.niksy.*
+org.webjars.bowergithub.nippur72.*
+org.webjars.bowergithub.nobleclem.*
+org.webjars.bowergithub.node-browser-compat.*
+org.webjars.bowergithub.nodeca.*
+org.webjars.bowergithub.nodws.*
+org.webjars.bowergithub.noelboss.*
+org.webjars.bowergithub.nolimits4web.*
+org.webjars.bowergithub.norkart.*
+org.webjars.bowergithub.nosir.*
+org.webjars.bowergithub.notadd.*
+org.webjars.bowergithub.notwaldorf.*
+org.webjars.bowergithub.novus.*
+org.webjars.bowergithub.npm-dom.*
+org.webjars.bowergithub.npm.*
+org.webjars.bowergithub.nuclei.*
+org.webjars.bowergithub.nuxeo.*
+org.webjars.bowergithub.nuxodin.*
+org.webjars.bowergithub.nuxt.*
+org.webjars.bowergithub.nv.*
+org.webjars.bowergithub.nytimes.*
+org.webjars.bowergithub.ocassio.*
+org.webjars.bowergithub.oclyke-forks.*
+org.webjars.bowergithub.ocombe.*
+org.webjars.bowergithub.oesmith.*
+org.webjars.bowergithub.ofirdagan.*
+org.webjars.bowergithub.olado.*
+org.webjars.bowergithub.olifolkerd.*
+org.webjars.bowergithub.olivernn.*
+org.webjars.bowergithub.olton.*
+org.webjars.bowergithub.ombradifenice.*
+org.webjars.bowergithub.omichelsen.*
+org.webjars.bowergithub.onokumus.*
+org.webjars.bowergithub.onsip.*
+org.webjars.bowergithub.onuridrisoglu.*
+org.webjars.bowergithub.opencagedata.*
+org.webjars.bowergithub.openpgpjs.*
+org.webjars.bowergithub.openseadragon.*
+org.webjars.bowergithub.openshift.*
+org.webjars.bowergithub.openvidu.*
+org.webjars.bowergithub.orangehill.*
+org.webjars.bowergithub.orianda.*
+org.webjars.bowergithub.origoni.*
+org.webjars.bowergithub.osano.*
+org.webjars.bowergithub.osartun.*
+org.webjars.bowergithub.osbi.*
+org.webjars.bowergithub.outline.*
+org.webjars.bowergithub.outworkers.*
+org.webjars.bowergithub.owlcarousel2.*
+org.webjars.bowergithub.owox.*
+org.webjars.bowergithub.oyeharry.*
+org.webjars.bowergithub.pa7.*
+org.webjars.bowergithub.pagekit.*
+org.webjars.bowergithub.pandao.*
+org.webjars.bowergithub.paperfireelements.*
+org.webjars.bowergithub.parallax.*
+org.webjars.bowergithub.pascalebeier.*
+org.webjars.bowergithub.patlux.*
+org.webjars.bowergithub.patosai.*
+org.webjars.bowergithub.patternfly.*
+org.webjars.bowergithub.paulkinlan.*
+org.webjars.bowergithub.pauluithol.*
+org.webjars.bowergithub.paulzi.*
+org.webjars.bowergithub.paweldecowski.*
+org.webjars.bowergithub.pbaris.*
+org.webjars.bowergithub.pc035860.*
+org.webjars.bowergithub.pedro2555.*
+org.webjars.bowergithub.pennyfx.*
+org.webjars.bowergithub.perliedman.*
+org.webjars.bowergithub.petja.*
+org.webjars.bowergithub.petkaantonov.*
+org.webjars.bowergithub.petrbroz.*
+org.webjars.bowergithub.pfelements.*
+org.webjars.bowergithub.phihag.*
+org.webjars.bowergithub.picocss.*
+org.webjars.bowergithub.picturepan2.*
+org.webjars.bowergithub.pieroxy.*
+org.webjars.bowergithub.pikaday.*
+org.webjars.bowergithub.pillarjs.*
+org.webjars.bowergithub.pingcheng.*
+org.webjars.bowergithub.pinguinjkeke.*
+org.webjars.bowergithub.piotr-gawlowski.*
+org.webjars.bowergithub.pixijs.*
+org.webjars.bowergithub.pkaske.*
+org.webjars.bowergithub.plotly.*
+org.webjars.bowergithub.ploughingabytefield.*
+org.webjars.bowergithub.pnts87.*
+org.webjars.bowergithub.podio.*
+org.webjars.bowergithub.pointhi.*
+org.webjars.bowergithub.polikin.*
+org.webjars.bowergithub.polydile.*
+org.webjars.bowergithub.polygonplanet.*
+org.webjars.bowergithub.polymer.*
+org.webjars.bowergithub.polymerappelements.*
+org.webjars.bowergithub.polymerelements.*
+org.webjars.bowergithub.polymerlabs.*
+org.webjars.bowergithub.polymervis.*
+org.webjars.bowergithub.pomax.*
+org.webjars.bowergithub.pomber.*
+org.webjars.bowergithub.popperjs.*
+org.webjars.bowergithub.pouchdb.*
+org.webjars.bowergithub.powerpan.*
+org.webjars.bowergithub.pqina.*
+org.webjars.bowergithub.predixdesignsystem.*
+org.webjars.bowergithub.prendus.*
+org.webjars.bowergithub.prhythm.*
+org.webjars.bowergithub.primefaces.*
+org.webjars.bowergithub.primer.*
+org.webjars.bowergithub.primus.*
+org.webjars.bowergithub.prismjs.*
+org.webjars.bowergithub.proj4js.*
+org.webjars.bowergithub.protobufjs.*
+org.webjars.bowergithub.protonet.*
+org.webjars.bowergithub.protoss78.*
+org.webjars.bowergithub.prototypejs.*
+org.webjars.bowergithub.prtksxna.*
+org.webjars.bowergithub.pshihn.*
+org.webjars.bowergithub.pure-css.*
+org.webjars.bowergithub.pytesnet.*
+org.webjars.bowergithub.qix-.*
+org.webjars.bowergithub.que-etc.*
+org.webjars.bowergithub.racp.*
+org.webjars.bowergithub.rainabba.*
+org.webjars.bowergithub.ramda.*
+org.webjars.bowergithub.raulsntos.*
+org.webjars.bowergithub.rayabhagis.*
+org.webjars.bowergithub.raynos.*
+org.webjars.bowergithub.razorjack.*
+org.webjars.bowergithub.rbuckton.*
+org.webjars.bowergithub.rdash.*
+org.webjars.bowergithub.reach-digital.*
+org.webjars.bowergithub.react-component.*
+org.webjars.bowergithub.reactjs.*
+org.webjars.bowergithub.reacttraining.*
+org.webjars.bowergithub.redbility.*
+org.webjars.bowergithub.redux-saga.*
+org.webjars.bowergithub.reduxjs.*
+org.webjars.bowergithub.regexhq.*
+org.webjars.bowergithub.remix-design.*
+org.webjars.bowergithub.request.*
+org.webjars.bowergithub.requirejs.*
+org.webjars.bowergithub.ressio.*
+org.webjars.bowergithub.reworkcss.*
+org.webjars.bowergithub.richardcarls.*
+org.webjars.bowergithub.richtr.*
+org.webjars.bowergithub.rickstrahl.*
+org.webjars.bowergithub.riot.*
+org.webjars.bowergithub.rkgrep.*
+org.webjars.bowergithub.rmm5t.*
+org.webjars.bowergithub.rndme.*
+org.webjars.bowergithub.rob--w.*
+org.webjars.bowergithub.rob-64.*
+org.webjars.bowergithub.robinherbots.*
+org.webjars.bowergithub.robinn1.*
+org.webjars.bowergithub.robloach.*
+org.webjars.bowergithub.rocketsciencesolutions.*
+org.webjars.bowergithub.rodikh.*
+org.webjars.bowergithub.rohithsathya.*
+org.webjars.bowergithub.rowanwins.*
+org.webjars.bowergithub.roxus.*
+org.webjars.bowergithub.rstacruz.*
+org.webjars.bowergithub.rstaib.*
+org.webjars.bowergithub.rubaxa.*
+org.webjars.bowergithub.rubenspgcavalcante.*
+org.webjars.bowergithub.rudiejd.*
+org.webjars.bowergithub.ruhley.*
+org.webjars.bowergithub.ruimarinho.*
+org.webjars.bowergithub.running-coder.*
+org.webjars.bowergithub.rvagg.*
+org.webjars.bowergithub.rvera.*
+org.webjars.bowergithub.rxaviers.*
+org.webjars.bowergithub.ryanburns23.*
+org.webjars.bowergithub.sachinchoolur.*
+org.webjars.bowergithub.saeidzebardast.*
+org.webjars.bowergithub.safetychanger.*
+org.webjars.bowergithub.sagrawal31.*
+org.webjars.bowergithub.saifjerbi.*
+org.webjars.bowergithub.salesforce.*
+org.webjars.bowergithub.salte-io.*
+org.webjars.bowergithub.samie.*
+org.webjars.bowergithub.sampotts.*
+org.webjars.bowergithub.samverschueren.*
+org.webjars.bowergithub.sapo.*
+org.webjars.bowergithub.sascha0912.*
+org.webjars.bowergithub.sblommers.*
+org.webjars.bowergithub.scarygami.*
+org.webjars.bowergithub.schemerapp.*
+org.webjars.bowergithub.schteppe.*
+org.webjars.bowergithub.sciactive.*
+org.webjars.bowergithub.scottcorgan.*
+org.webjars.bowergithub.scottjehl.*
+org.webjars.bowergithub.sebastiansulinski.*
+org.webjars.bowergithub.seiyria.*
+org.webjars.bowergithub.select2.*
+org.webjars.bowergithub.selectize.*
+org.webjars.bowergithub.selvinfehric.*
+org.webjars.bowergithub.semantic-org.*
+org.webjars.bowergithub.sensortower.*
+org.webjars.bowergithub.sentsin.*
+org.webjars.bowergithub.seonim-ryu.*
+org.webjars.bowergithub.serhioromano.*
+org.webjars.bowergithub.serratus.*
+org.webjars.bowergithub.sespiros.*
+org.webjars.bowergithub.shama.*
+org.webjars.bowergithub.sharedlabs.*
+org.webjars.bowergithub.sheabunge.*
+org.webjars.bowergithub.sheetjs.*
+org.webjars.bowergithub.shelljs.*
+org.webjars.bowergithub.shentao.*
+org.webjars.bowergithub.sherbyelements.*
+org.webjars.bowergithub.shibuielements.*
+org.webjars.bowergithub.shockey.*
+org.webjars.bowergithub.shokai.*
+org.webjars.bowergithub.showdownjs.*
+org.webjars.bowergithub.shprink.*
+org.webjars.bowergithub.shramov.*
+org.webjars.bowergithub.shyykoserhiy.*
+org.webjars.bowergithub.sibiraj-s.*
+org.webjars.bowergithub.silentmatt.*
+org.webjars.bowergithub.simonbengtsson.*
+org.webjars.bowergithub.simontabor.*
+org.webjars.bowergithub.simontaite.*
+org.webjars.bowergithub.simonwep.*
+org.webjars.bowergithub.simpleelements.*
+org.webjars.bowergithub.sindresorhus.*
+org.webjars.bowergithub.sitepen.*
+org.webjars.bowergithub.skalamichal.*
+org.webjars.bowergithub.skwee357.*
+org.webjars.bowergithub.slevithan.*
+org.webjars.bowergithub.slicedsilver.*
+org.webjars.bowergithub.smalot.*
+org.webjars.bowergithub.smartprocure.*
+org.webjars.bowergithub.smashah.*
+org.webjars.bowergithub.smeijer.*
+org.webjars.bowergithub.snapappointments.*
+org.webjars.bowergithub.socceroos.*
+org.webjars.bowergithub.sockjs.*
+org.webjars.bowergithub.sofish.*
+org.webjars.bowergithub.solarpatrol.*
+org.webjars.bowergithub.songoo.*
+org.webjars.bowergithub.sonicdoe.*
+org.webjars.bowergithub.sorin-davidoi.*
+org.webjars.bowergithub.sortablejs.*
+org.webjars.bowergithub.soulmatters.*
+org.webjars.bowergithub.sparksuite.*
+org.webjars.bowergithub.spatialillusions.*
+org.webjars.bowergithub.spind42.*
+org.webjars.bowergithub.spring-projects.*
+org.webjars.bowergithub.springmeyer.*
+org.webjars.bowergithub.sryther.*
+org.webjars.bowergithub.stacktracejs.*
+org.webjars.bowergithub.stampit-org.*
+org.webjars.bowergithub.stanlemon.*
+org.webjars.bowergithub.starcounter-jack.*
+org.webjars.bowergithub.startbootstrap.*
+org.webjars.bowergithub.startpolymer.*
+org.webjars.bowergithub.stefanocudini.*
+org.webjars.bowergithub.stenin-nikita.*
+org.webjars.bowergithub.stevenbenner.*
+org.webjars.bowergithub.stevenrskelton.*
+org.webjars.bowergithub.stevesanderson.*
+org.webjars.bowergithub.stomp-js.*
+org.webjars.bowergithub.stream-utils.*
+org.webjars.bowergithub.streetturtle.*
+org.webjars.bowergithub.strml.*
+org.webjars.bowergithub.struts-community-plugins.*
+org.webjars.bowergithub.studio-42.*
+org.webjars.bowergithub.stuk.*
+org.webjars.bowergithub.stuyam.*
+org.webjars.bowergithub.substack.*
+org.webjars.bowergithub.suguru03.*
+org.webjars.bowergithub.summernote.*
+org.webjars.bowergithub.supachailllpay.*
+org.webjars.bowergithub.superraytin.*
+org.webjars.bowergithub.supportclass.*
+org.webjars.bowergithub.svbergerem.*
+org.webjars.bowergithub.svgdotjs.*
+org.webjars.bowergithub.swastikpareek.*
+org.webjars.bowergithub.sweetalert2.*
+org.webjars.bowergithub.swisnl.*
+org.webjars.bowergithub.syndybat.*
+org.webjars.bowergithub.szimek.*
+org.webjars.bowergithub.t1m0n.*
+org.webjars.bowergithub.t2ym.*
+org.webjars.bowergithub.t4t5.*
+org.webjars.bowergithub.tabalinas.*
+org.webjars.bowergithub.talv.*
+org.webjars.bowergithub.tandibar.*
+org.webjars.bowergithub.tangbc.*
+org.webjars.bowergithub.tangrams.*
+org.webjars.bowergithub.tapmodo.*
+org.webjars.bowergithub.tarekraafat.*
+org.webjars.bowergithub.tarent.*
+org.webjars.bowergithub.targetprocess.*
+org.webjars.bowergithub.taylorhakes.*
+org.webjars.bowergithub.techlab.*
+org.webjars.bowergithub.tehapo.*
+org.webjars.bowergithub.tehshrike.*
+org.webjars.bowergithub.teleborder.*
+org.webjars.bowergithub.telecomsante.*
+org.webjars.bowergithub.templarian.*
+org.webjars.bowergithub.tempusdominus.*
+org.webjars.bowergithub.ten1seven.*
+org.webjars.bowergithub.tencent.*
+org.webjars.bowergithub.terryz.*
+org.webjars.bowergithub.tg9413.*
+org.webjars.bowergithub.thatisuday.*
+org.webjars.bowergithub.thdoan.*
+org.webjars.bowergithub.the-control-group.*
+org.webjars.bowergithub.thedersen.*
+org.webjars.bowergithub.thejoshwolfe.*
+org.webjars.bowergithub.themyth92.*
+org.webjars.bowergithub.then.*
+org.webjars.bowergithub.thenikso.*
+org.webjars.bowergithub.therapychat.*
+org.webjars.bowergithub.thesabbir.*
+org.webjars.bowergithub.thiht.*
+org.webjars.bowergithub.thlorenz.*
+org.webjars.bowergithub.thomascybulski.*
+org.webjars.bowergithub.thomasjang.*
+org.webjars.bowergithub.thomaspark.*
+org.webjars.bowergithub.thoughtbot.*
+org.webjars.bowergithub.thysultan.*
+org.webjars.bowergithub.tictail.*
+org.webjars.bowergithub.timdown.*
+org.webjars.bowergithub.timeu.*
+org.webjars.bowergithub.timhettler.*
+org.webjars.bowergithub.timmywil.*
+org.webjars.bowergithub.timograw.*
+org.webjars.bowergithub.timruffles.*
+org.webjars.bowergithub.timvdlippe.*
+org.webjars.bowergithub.tinymce.*
+org.webjars.bowergithub.tj.*
+org.webjars.bowergithub.tjenkinson.*
+org.webjars.bowergithub.tltv.*
+org.webjars.bowergithub.tmsolution.*
+org.webjars.bowergithub.tobiasahlin.*
+org.webjars.bowergithub.todc.*
+org.webjars.bowergithub.toji.*
+org.webjars.bowergithub.tomasalabes.*
+org.webjars.bowergithub.tomik23.*
+org.webjars.bowergithub.tone-row.*
+org.webjars.bowergithub.tonekk.*
+org.webjars.bowergithub.tonetime.*
+org.webjars.bowergithub.toopay.*
+org.webjars.bowergithub.tootallnate.*
+org.webjars.bowergithub.travist.*
+org.webjars.bowergithub.trentm.*
+org.webjars.bowergithub.tristen.*
+org.webjars.bowergithub.trysound.*
+org.webjars.bowergithub.tscanlin.*
+org.webjars.bowergithub.tschaub.*
+org.webjars.bowergithub.tshi0912.*
+org.webjars.bowergithub.ttretau.*
+org.webjars.bowergithub.tulios.*
+org.webjars.bowergithub.tur-nr.*
+org.webjars.bowergithub.turbolinks.*
+org.webjars.bowergithub.turfjs.*
+org.webjars.bowergithub.turuslan.*
+org.webjars.bowergithub.twbs.*
+org.webjars.bowergithub.twitter.*
+org.webjars.bowergithub.typeiii.*
+org.webjars.bowergithub.typekit.*
+org.webjars.bowergithub.udeselements.*
+org.webjars.bowergithub.uikit.*
+org.webjars.bowergithub.umbe1987.*
+org.webjars.bowergithub.unclechu.*
+org.webjars.bowergithub.unicef-polymer.*
+org.webjars.bowergithub.unionthugface.*
+org.webjars.bowergithub.unshiftio.*
+org.webjars.bowergithub.urdeveloper.*
+org.webjars.bowergithub.urish.*
+org.webjars.bowergithub.us-cbp.*
+org.webjars.bowergithub.ushelp.*
+org.webjars.bowergithub.utatti.*
+org.webjars.bowergithub.uxsolutions.*
+org.webjars.bowergithub.vaadin.*
+org.webjars.bowergithub.vakata.*
+org.webjars.bowergithub.valdrinkoshi.*
+org.webjars.bowergithub.validatorjs.*
+org.webjars.bowergithub.valleweb.*
+org.webjars.bowergithub.vast-engineering.*
+org.webjars.bowergithub.vedmack.*
+org.webjars.bowergithub.vega.*
+org.webjars.bowergithub.veith.*
+org.webjars.bowergithub.verlok.*
+org.webjars.bowergithub.vert-x3.*
+org.webjars.bowergithub.vestride.*
+org.webjars.bowergithub.vguillou.*
+org.webjars.bowergithub.vic10us.*
+org.webjars.bowergithub.victorjonsson.*
+org.webjars.bowergithub.video-dev.*
+org.webjars.bowergithub.videojs.*
+org.webjars.bowergithub.viima.*
+org.webjars.bowergithub.viljamis.*
+org.webjars.bowergithub.vimalkumar010.*
+org.webjars.bowergithub.vimeo.*
+org.webjars.bowergithub.vinceg.*
+org.webjars.bowergithub.visionmedia.*
+org.webjars.bowergithub.visjs.*
+org.webjars.bowergithub.vitalets.*
+org.webjars.bowergithub.vividcortex.*
+org.webjars.bowergithub.vladimirbrasil.*
+org.webjars.bowergithub.vpegado.*
+org.webjars.bowergithub.vpusher.*
+org.webjars.bowergithub.vroegop.*
+org.webjars.bowergithub.vstirbu.*
+org.webjars.bowergithub.vtimbuc.*
+org.webjars.bowergithub.vuejs.*
+org.webjars.bowergithub.vuetifyjs.*
+org.webjars.bowergithub.wa0x6e.*
+org.webjars.bowergithub.walkermatt.*
+org.webjars.bowergithub.walmik.*
+org.webjars.bowergithub.wasc-io.*
+org.webjars.bowergithub.watsonlogic-software.*
+org.webjars.bowergithub.wbinnssmith.*
+org.webjars.bowergithub.wbotelhos.*
+org.webjars.bowergithub.wcoder.*
+org.webjars.bowergithub.web-animations.*
+org.webjars.bowergithub.webcomponents.*
+org.webjars.bowergithub.webix-hub.*
+org.webjars.bowergithub.webreflection.*
+org.webjars.bowergithub.webrtc.*
+org.webjars.bowergithub.webrtchacks.*
+org.webjars.bowergithub.websanova.*
+org.webjars.bowergithub.websockets.*
+org.webjars.bowergithub.wenzhixin.*
+org.webjars.bowergithub.wesleytodd.*
+org.webjars.bowergithub.whitequark.*
+org.webjars.bowergithub.wicg.*
+org.webjars.bowergithub.wikiki.*
+org.webjars.bowergithub.wikimedia.*
+org.webjars.bowergithub.wilddeer.*
+org.webjars.bowergithub.willtemperley.*
+org.webjars.bowergithub.wilsonpage.*
+org.webjars.bowergithub.wincinderith.*
+org.webjars.bowergithub.windyakin.*
+org.webjars.bowergithub.winify-ag.*
+org.webjars.bowergithub.wintersandroid.*
+org.webjars.bowergithub.wiredjs.*
+org.webjars.bowergithub.wisvch.*
+org.webjars.bowergithub.wnr.*
+org.webjars.bowergithub.wrangr.*
+org.webjars.bowergithub.wycats.*
+org.webjars.bowergithub.x-tag.*
+org.webjars.bowergithub.xbsoftware.*
+org.webjars.bowergithub.xcash.*
+org.webjars.bowergithub.xch89820.*
+org.webjars.bowergithub.xdan.*
+org.webjars.bowergithub.xliiv.*
+org.webjars.bowergithub.xpressengine.*
+org.webjars.bowergithub.xsokev.*
+org.webjars.bowergithub.xtermjs.*
+org.webjars.bowergithub.xwiki-contrib.*
+org.webjars.bowergithub.xwiki-labs.*
+org.webjars.bowergithub.yahoo.*
+org.webjars.bowergithub.yaru22.*
+org.webjars.bowergithub.yesmeck.*
+org.webjars.bowergithub.yidas.*
+org.webjars.bowergithub.yieme.*
+org.webjars.bowergithub.yiminghe.*
+org.webjars.bowergithub.yingshandeng.*
+org.webjars.bowergithub.ymedaghri.*
+org.webjars.bowergithub.yohanboniface.*
+org.webjars.bowergithub.yola.*
+org.webjars.bowergithub.yomguithereal.*
+org.webjars.bowergithub.yotamberk.*
+org.webjars.bowergithub.ys-hkwong.*
+org.webjars.bowergithub.ysbealan.*
+org.webjars.bowergithub.yuanfux.*
+org.webjars.bowergithub.zacharytamas.*
+org.webjars.bowergithub.zachsnow.*
+org.webjars.bowergithub.zazuko.*
+org.webjars.bowergithub.zce.*
+org.webjars.bowergithub.zdhxiong.*
+org.webjars.bowergithub.zecat.*
+org.webjars.bowergithub.zellwk.*
+org.webjars.bowergithub.zengabor.*
+org.webjars.bowergithub.zenorocha.*
+org.webjars.bowergithub.zeroclipboard.*
+org.webjars.bowergithub.zertosh.*
+org.webjars.bowergithub.zhangbobell.*
+org.webjars.bowergithub.zleub.*
+org.webjars.bowergithub.zurb.*
+org.webjars.bowergithub.zvakanaka.*
+org.webjars.bowergithub.zwacky.*
+org.webjars.bowergithub.zxing-js.*
+org.webjars.npm.*
+org.webkit.*
+org.webpieces.*
+org.webpieces.aws.*
+org.webpieces.cloud.*
+org.webpieces.core.*
+org.webpieces.googlecloud.*
+org.webpieces.http.*
+org.webpieces.lib.*
+org.webpieces.server.*
+org.webpieces.server.plugin.*
+org.webpieces.template.*
+org.webswing.*
+org.webswing.security.*
+org.weixin4j.*
+org.weixin4j.spring.boot.*
+org.wercker4j.*
+org.wesec.*
+org.wetator.*
+org.wetator.maven.*
+org.whaka.*
+org.whiley.*
+org.whispercomm.c2dm4j.*
+org.whispersystems.*
+org.whispersystems.libpastelog.*
+org.whistlepost.*
+org.whitesource.*
+org.whizu.*
+org.wickedsource.*
+org.wickedsource.docx-stamper.*
+org.wickedsource.logunit.*
+org.wicketeer.*
+org.wicketopia.*
+org.wicketstuff.*
+org.wicketstuff.foundation.*
+org.wicketstuff.htmlvalidator.*
+org.wicketstuff.scala.*
+org.wicketstuff.wiquery.*
+org.wickettools.extjs.*
+org.wikbook.*
+org.wikibrainapi.*
+org.wikiclean.*
+org.wikidata.query.rdf.*
+org.wikidata.wdtk.*
+org.wikimedia.discovery.*
+org.wikimedia.elasticsearch.swift.*
+org.wikimedia.metrics.*
+org.wikimedia.search.*
+org.wikimedia.search.highlighter.*
+org.wikimodel.*
+org.wildbits.*
+org.wildfly.*
+org.wildfly.archetype.*
+org.wildfly.archetypes.*
+org.wildfly.arquillian.*
+org.wildfly.bom.*
+org.wildfly.bridge.*
+org.wildfly.build.*
+org.wildfly.camel.*
+org.wildfly.camel.archetypes.*
+org.wildfly.camel.example.*
+org.wildfly.channel.*
+org.wildfly.checkstyle.*
+org.wildfly.client.*
+org.wildfly.cloud.*
+org.wildfly.clustering.*
+org.wildfly.common.*
+org.wildfly.configuration.*
+org.wildfly.core.*
+org.wildfly.deployment.*
+org.wildfly.discovery.*
+org.wildfly.extras.*
+org.wildfly.extras.batavia.*
+org.wildfly.extras.creaper.*
+org.wildfly.extras.db_bootstrap.*
+org.wildfly.extras.graphql.*
+org.wildfly.extras.grpc.*
+org.wildfly.extras.patch.*
+org.wildfly.extras.reactive.*
+org.wildfly.extras.sunstone.*
+org.wildfly.galleon-plugins.*
+org.wildfly.installation-manager.*
+org.wildfly.legacy.test.*
+org.wildfly.managed-server-builder.*
+org.wildfly.maven.plugins.*
+org.wildfly.nosql.*
+org.wildfly.openssl.*
+org.wildfly.plugins.*
+org.wildfly.prospero.*
+org.wildfly.quarkus.*
+org.wildfly.security.*
+org.wildfly.security.elytron-web.*
+org.wildfly.security.jakarta.*
+org.wildfly.security.mp.*
+org.wildfly.swarm.*
+org.wildfly.swarm.cli.*
+org.wildfly.swarm.docs.*
+org.wildfly.swarm.servers.*
+org.wildfly.swarm.testsuite.*
+org.wildfly.tools.*
+org.wildfly.transaction.*
+org.wildfly.url.http.*
+org.wildfly.wildfly-http-client.*
+org.wing4j.*
+org.wing4j.annotation.*
+org.wing4j.common.*
+org.wing4j.network.*
+org.wing4j.orm.*
+org.wing4j.parent.*
+org.wing4j.test.*
+org.wing4j.toolkit.*
+org.wingsource.*
+org.wintersleep.avro.*
+org.wintersleep.graphviz.*
+org.wintersleep.nnzero.*
+org.wintersleep.snmp.*
+org.wintersleep.yang.*
+org.wiperdog.*
+org.wiremock.*
+org.wisdom-framework.*
+org.wisdom-framework.jcr.*
+org.wisepersist.*
+org.witea.analyzer.*
+org.wixtoolset.*
+org.wixtoolset.maven.*
+org.wixtoolset.sdk.nar.*
+org.wixtoolset.sdk.npanday.*
+org.wiztools.*
+org.wiztools.commons.*
+org.wiztools.wizcrypt.*
+org.wmn4j.*
+org.wmtechnology.wmsweetalert.*
+org.woelker.jimix.*
+org.woelker.jimix.war.*
+org.wololo.*
+org.wololo.jdbc.*
+org.wonderdb.*
+org.wonderdb.journaling.*
+org.wooddog.mavenplugins.*
+org.woodylab.boot.*
+org.wordinator.*
+org.wordpress.*
+org.work100.*
+org.world-engine.*
+org.worldcubeassociation.tnoodle.*
+org.wowtools.*
+org.wquery.*
+org.writeforward.*
+org.wso2.*
+org.wso2.am.*
+org.wso2.am.analytics.publisher.*
+org.wso2.am.choreo.connect.*
+org.wso2.am.choreo.extensions.*
+org.wso2.am.microgw.*
+org.wso2.analytics.apim.*
+org.wso2.analytics.common.*
+org.wso2.analytics.esb.*
+org.wso2.analytics.http.*
+org.wso2.analytics.is.*
+org.wso2.analytics.solutions.*
+org.wso2.andes.*
+org.wso2.andes.wso2.*
+org.wso2.apache.hadoop.*
+org.wso2.apache.httpcomponents.*
+org.wso2.apache.lucene.*
+org.wso2.apache.solr.*
+org.wso2.apache.spark.*
+org.wso2.apk.*
+org.wso2.appfactory.*
+org.wso2.appmanager.*
+org.wso2.appserver.*
+org.wso2.appserver.shade.commons-httpclient.*
+org.wso2.appserver.shade.commons-logging.*
+org.wso2.appserver.shade.log4j.*
+org.wso2.appserver.shade.net.shibboleth.utilities.*
+org.wso2.appserver.shade.org.apache.santuario.*
+org.wso2.appserver.shade.org.apache.thrift.*
+org.wso2.appserver.shade.org.jaggeryjs.*
+org.wso2.appserver.shade.org.opensaml.*
+org.wso2.appserver.shade.org.springframework.*
+org.wso2.appserver.shade.org.wso2.carbon.analytics-common.*
+org.wso2.appserver.shade.slf4j.*
+org.wso2.balana.*
+org.wso2.ballerina-integrator.*
+org.wso2.ballerina.connectors.*
+org.wso2.ballerina.jre.artifacts.*
+org.wso2.bpel.*
+org.wso2.bpel.extensions.*
+org.wso2.bps.*
+org.wso2.bps.samples.HumanTaskWebApp.*
+org.wso2.brs.*
+org.wso2.carbon.*
+org.wso2.carbon.analytics-common.*
+org.wso2.carbon.analytics.*
+org.wso2.carbon.analytics.cdmf.*
+org.wso2.carbon.analytics.emm.*
+org.wso2.carbon.analytics.is.*
+org.wso2.carbon.analytics.shared.*
+org.wso2.carbon.apim.migration.resources.*
+org.wso2.carbon.apimgt.*
+org.wso2.carbon.apimgt.identity.migration.resources.*
+org.wso2.carbon.apimgt.ui.*
+org.wso2.carbon.appfactory.*
+org.wso2.carbon.appmgt.*
+org.wso2.carbon.auth.*
+org.wso2.carbon.automation.*
+org.wso2.carbon.automationutils.*
+org.wso2.carbon.business-process.*
+org.wso2.carbon.business.messaging.*
+org.wso2.carbon.caching.*
+org.wso2.carbon.callhome.*
+org.wso2.carbon.commons.*
+org.wso2.carbon.config.*
+org.wso2.carbon.consent.mgt.*
+org.wso2.carbon.coordination.*
+org.wso2.carbon.crypto.*
+org.wso2.carbon.dashboards.*
+org.wso2.carbon.dashboards.samples.*
+org.wso2.carbon.dashboards.samples.widgets.*
+org.wso2.carbon.data.*
+org.wso2.carbon.datasources.*
+org.wso2.carbon.deployment.*
+org.wso2.carbon.devicemgt-plugins.*
+org.wso2.carbon.devicemgt-proprietary.*
+org.wso2.carbon.devicemgt.*
+org.wso2.carbon.event-processing.*
+org.wso2.carbon.extension.analytics.*
+org.wso2.carbon.extension.analytics.receiver.*
+org.wso2.carbon.extension.archetype.*
+org.wso2.carbon.extension.identity.authenticator.*
+org.wso2.carbon.extension.identity.authenticator.inbound.cas.*
+org.wso2.carbon.extension.identity.authenticator.outbound.amazon.*
+org.wso2.carbon.extension.identity.authenticator.outbound.backupcode.*
+org.wso2.carbon.extension.identity.authenticator.outbound.duo.*
+org.wso2.carbon.extension.identity.authenticator.outbound.emailotp.*
+org.wso2.carbon.extension.identity.authenticator.outbound.foursquare.*
+org.wso2.carbon.extension.identity.authenticator.outbound.instagram.*
+org.wso2.carbon.extension.identity.authenticator.outbound.linkedin.*
+org.wso2.carbon.extension.identity.authenticator.outbound.mepin.*
+org.wso2.carbon.extension.identity.authenticator.outbound.office365.*
+org.wso2.carbon.extension.identity.authenticator.outbound.pinterest.*
+org.wso2.carbon.extension.identity.authenticator.outbound.smsotp.*
+org.wso2.carbon.extension.identity.authenticator.outbound.totp.*
+org.wso2.carbon.extension.identity.authenticator.outbound.twitter.*
+org.wso2.carbon.extension.identity.authenticator.outbound.x509Certificate.*
+org.wso2.carbon.extension.identity.authenticator.utils.*
+org.wso2.carbon.extension.identity.dao.stored.procedure.*
+org.wso2.carbon.extension.identity.oauth.addons.*
+org.wso2.carbon.extension.identity.oauth2.grantType.jwt.*
+org.wso2.carbon.extension.identity.oauth2.grantType.organizationswitch.*
+org.wso2.carbon.extension.identity.oauth2.grantType.token.exchange.*
+org.wso2.carbon.extension.identity.provisioning.*
+org.wso2.carbon.extension.identity.provisioning.outbound.duo.*
+org.wso2.carbon.extension.identity.scim2.*
+org.wso2.carbon.extension.identity.serializer.fst.*
+org.wso2.carbon.extension.identity.x509certificate.*
+org.wso2.carbon.feature.repository.*
+org.wso2.carbon.gateway.*
+org.wso2.carbon.governance-extensions.*
+org.wso2.carbon.governance.*
+org.wso2.carbon.hash.provider.pbkdf2.*
+org.wso2.carbon.healthcheck.*
+org.wso2.carbon.identity.*
+org.wso2.carbon.identity.agent.entitlement.filter.*
+org.wso2.carbon.identity.agent.entitlement.mediator.*
+org.wso2.carbon.identity.agent.onprem.userstore.*
+org.wso2.carbon.identity.agent.onprem.userstore.java.*
+org.wso2.carbon.identity.agent.sso.java.*
+org.wso2.carbon.identity.api.*
+org.wso2.carbon.identity.application.auth.basic.*
+org.wso2.carbon.identity.application.auth.iwa.ntlm.*
+org.wso2.carbon.identity.application.authz.opa.*
+org.wso2.carbon.identity.application.authz.xacml.*
+org.wso2.carbon.identity.association.account.*
+org.wso2.carbon.identity.auth.organization.login.*
+org.wso2.carbon.identity.auth.rest.*
+org.wso2.carbon.identity.authenticator.outbound.nuxeo.*
+org.wso2.carbon.identity.authenticator.outbound.saml2sso.*
+org.wso2.carbon.identity.branding.preference.management.*
+org.wso2.carbon.identity.carbon.auth.iwa.*
+org.wso2.carbon.identity.carbon.auth.jwt.*
+org.wso2.carbon.identity.carbon.auth.mutualssl.*
+org.wso2.carbon.identity.carbon.auth.saml2.*
+org.wso2.carbon.identity.casque.authenticator.*
+org.wso2.carbon.identity.cloud.*
+org.wso2.carbon.identity.commons.*
+org.wso2.carbon.identity.conditional.auth.entgra.*
+org.wso2.carbon.identity.conditional.auth.functions.*
+org.wso2.carbon.identity.conditional.auth.typingdna.*
+org.wso2.carbon.identity.content.repository.*
+org.wso2.carbon.identity.data.publisher.audit.*
+org.wso2.carbon.identity.data.publisher.oauth.*
+org.wso2.carbon.identity.datapublisher.authentication.*
+org.wso2.carbon.identity.developer.*
+org.wso2.carbon.identity.ekyc.*
+org.wso2.carbon.identity.event.handler.accountlock.*
+org.wso2.carbon.identity.event.handler.notification.*
+org.wso2.carbon.identity.feature.category.*
+org.wso2.carbon.identity.fetch.remote.*
+org.wso2.carbon.identity.framework.*
+org.wso2.carbon.identity.gateway.*
+org.wso2.carbon.identity.governance.*
+org.wso2.carbon.identity.hash.provider.pbkdf2.*
+org.wso2.carbon.identity.inbound.auth.jwt.*
+org.wso2.carbon.identity.inbound.auth.oauth2.*
+org.wso2.carbon.identity.inbound.auth.openid.*
+org.wso2.carbon.identity.inbound.auth.saml.cloud.*
+org.wso2.carbon.identity.inbound.auth.saml2.*
+org.wso2.carbon.identity.inbound.auth.sts.*
+org.wso2.carbon.identity.inbound.provisioning.scim.*
+org.wso2.carbon.identity.inbound.provisioning.scim2.*
+org.wso2.carbon.identity.keyrotation.*
+org.wso2.carbon.identity.local.auth.api.*
+org.wso2.carbon.identity.local.auth.fido.*
+org.wso2.carbon.identity.local.auth.iwa.*
+org.wso2.carbon.identity.local.auth.magiclink.*
+org.wso2.carbon.identity.local.auth.requestpath.basic.*
+org.wso2.carbon.identity.local.auth.requestpath.oauth.*
+org.wso2.carbon.identity.media.*
+org.wso2.carbon.identity.metadata.saml2.*
+org.wso2.carbon.identity.mgt.*
+org.wso2.carbon.identity.migration.resources.*
+org.wso2.carbon.identity.oauth.uma.*
+org.wso2.carbon.identity.organization.management.*
+org.wso2.carbon.identity.organization.management.api.*
+org.wso2.carbon.identity.organization.management.connector.*
+org.wso2.carbon.identity.organization.management.core.*
+org.wso2.carbon.identity.outbound.auth.apple.*
+org.wso2.carbon.identity.outbound.auth.cognito.*
+org.wso2.carbon.identity.outbound.auth.facebook.*
+org.wso2.carbon.identity.outbound.auth.google.*
+org.wso2.carbon.identity.outbound.auth.hypr.*
+org.wso2.carbon.identity.outbound.auth.kakao.*
+org.wso2.carbon.identity.outbound.auth.live.*
+org.wso2.carbon.identity.outbound.auth.oauth2.*
+org.wso2.carbon.identity.outbound.auth.oidc.*
+org.wso2.carbon.identity.outbound.auth.openid.*
+org.wso2.carbon.identity.outbound.auth.push.*
+org.wso2.carbon.identity.outbound.auth.saml2.*
+org.wso2.carbon.identity.outbound.auth.sts.passive.*
+org.wso2.carbon.identity.outbound.auth.yahoo.*
+org.wso2.carbon.identity.outbound.provisioning.connector.office365.*
+org.wso2.carbon.identity.outbound.provisioning.google.*
+org.wso2.carbon.identity.outbound.provisioning.salesforce.*
+org.wso2.carbon.identity.outbound.provisioning.scim.*
+org.wso2.carbon.identity.outbound.provisioning.scim2.*
+org.wso2.carbon.identity.rest.dispatcher.*
+org.wso2.carbon.identity.saml.common.*
+org.wso2.carbon.identity.server.api.*
+org.wso2.carbon.identity.tool.validator.sso.saml2.*
+org.wso2.carbon.identity.tools.*
+org.wso2.carbon.identity.user.api.*
+org.wso2.carbon.identity.user.ws.*
+org.wso2.carbon.identity.userstore.aws.*
+org.wso2.carbon.identity.userstore.cassandra.*
+org.wso2.carbon.identity.userstore.ldap.*
+org.wso2.carbon.identity.userstore.mongodb.*
+org.wso2.carbon.identity.userstore.onprem.*
+org.wso2.carbon.identity.userstore.remote.*
+org.wso2.carbon.identity.verification.*
+org.wso2.carbon.identity.workflow.impl.bps.*
+org.wso2.carbon.identity.workflow.template.multisteps.*
+org.wso2.carbon.identity.workflow.user.*
+org.wso2.carbon.kubernetes.artifacts.*
+org.wso2.carbon.lcm.*
+org.wso2.carbon.maven.*
+org.wso2.carbon.mediation.*
+org.wso2.carbon.messaging.*
+org.wso2.carbon.metrics.*
+org.wso2.carbon.ml.*
+org.wso2.carbon.multitenancy.*
+org.wso2.carbon.polling.core.*
+org.wso2.carbon.privacy.*
+org.wso2.carbon.registry.*
+org.wso2.carbon.rules.*
+org.wso2.carbon.secvault.*
+org.wso2.carbon.store.*
+org.wso2.carbon.transport.*
+org.wso2.carbon.uis.*
+org.wso2.carbon.uis.tests.*
+org.wso2.carbon.uiserver.*
+org.wso2.carbon.uiserver.tests.*
+org.wso2.carbon.utils.*
+org.wso2.carbon.wum.client.*
+org.wso2.charon.*
+org.wso2.choreo.connect.*
+org.wso2.ciphertool.*
+org.wso2.cloud.secrets.*
+org.wso2.config.mapper.*
+org.wso2.das.*
+org.wso2.ei.*
+org.wso2.ei.b7a.*
+org.wso2.esb.integration.*
+org.wso2.extension.siddhi.eventtable.hazelcast.*
+org.wso2.extension.siddhi.execution.approximate.*
+org.wso2.extension.siddhi.execution.env.*
+org.wso2.extension.siddhi.execution.extrema.*
+org.wso2.extension.siddhi.execution.geo.*
+org.wso2.extension.siddhi.execution.graph.*
+org.wso2.extension.siddhi.execution.json.*
+org.wso2.extension.siddhi.execution.kalmanfilter.*
+org.wso2.extension.siddhi.execution.map.*
+org.wso2.extension.siddhi.execution.markov.*
+org.wso2.extension.siddhi.execution.math.*
+org.wso2.extension.siddhi.execution.priority.*
+org.wso2.extension.siddhi.execution.regex.*
+org.wso2.extension.siddhi.execution.reorder.*
+org.wso2.extension.siddhi.execution.sentiment.*
+org.wso2.extension.siddhi.execution.stats.*
+org.wso2.extension.siddhi.execution.streamingml.*
+org.wso2.extension.siddhi.execution.string.*
+org.wso2.extension.siddhi.execution.tensorflow.*
+org.wso2.extension.siddhi.execution.time.*
+org.wso2.extension.siddhi.execution.timeseries.*
+org.wso2.extension.siddhi.execution.unique.*
+org.wso2.extension.siddhi.execution.unitconversion.*
+org.wso2.extension.siddhi.gpl.execution.geo.*
+org.wso2.extension.siddhi.gpl.execution.nlp.*
+org.wso2.extension.siddhi.gpl.execution.pmml.*
+org.wso2.extension.siddhi.gpl.execution.r.*
+org.wso2.extension.siddhi.gpl.execution.streamingml.*
+org.wso2.extension.siddhi.io.cdc.*
+org.wso2.extension.siddhi.io.email.*
+org.wso2.extension.siddhi.io.file.*
+org.wso2.extension.siddhi.io.googlepubsub.*
+org.wso2.extension.siddhi.io.hl7.*
+org.wso2.extension.siddhi.io.http.*
+org.wso2.extension.siddhi.io.ibmmq.*
+org.wso2.extension.siddhi.io.jms.*
+org.wso2.extension.siddhi.io.kafka.*
+org.wso2.extension.siddhi.io.mqtt.*
+org.wso2.extension.siddhi.io.nats.*
+org.wso2.extension.siddhi.io.prometheus.*
+org.wso2.extension.siddhi.io.rabbitmq.*
+org.wso2.extension.siddhi.io.snmp.*
+org.wso2.extension.siddhi.io.sqs.*
+org.wso2.extension.siddhi.io.tcp.*
+org.wso2.extension.siddhi.io.twitter.*
+org.wso2.extension.siddhi.io.websocket.*
+org.wso2.extension.siddhi.io.wso2event.*
+org.wso2.extension.siddhi.map.avro.*
+org.wso2.extension.siddhi.map.binary.*
+org.wso2.extension.siddhi.map.csv.*
+org.wso2.extension.siddhi.map.json.*
+org.wso2.extension.siddhi.map.keyvalue.*
+org.wso2.extension.siddhi.map.text.*
+org.wso2.extension.siddhi.map.wso2event.*
+org.wso2.extension.siddhi.map.xml.*
+org.wso2.extension.siddhi.script.js.*
+org.wso2.extension.siddhi.script.scala.*
+org.wso2.extension.siddhi.store.cassandra.*
+org.wso2.extension.siddhi.store.elasticsearch.*
+org.wso2.extension.siddhi.store.hbase.*
+org.wso2.extension.siddhi.store.influxdb.*
+org.wso2.extension.siddhi.store.mongodb.*
+org.wso2.extension.siddhi.store.rdbms.*
+org.wso2.extension.siddhi.store.redis.*
+org.wso2.extension.siddhi.store.solr.*
+org.wso2.httpcomponents.*
+org.wso2.identity.apps.*
+org.wso2.identity.outbound.adapters.*
+org.wso2.iot.*
+org.wso2.is.*
+org.wso2.km.ext.auth0.*
+org.wso2.km.ext.azure.*
+org.wso2.km.ext.forgerock.*
+org.wso2.km.ext.keycloak.*
+org.wso2.km.ext.okta.*
+org.wso2.km.ext.pingfederate.*
+org.wso2.km.ext.wso2is.*
+org.wso2.maven.*
+org.wso2.messaging.*
+org.wso2.msf4j.*
+org.wso2.msf4j.example.*
+org.wso2.msf4j.perftest.echo.*
+org.wso2.msf4j.sample.*
+org.wso2.msf4j.samples.*
+org.wso2.orbit.com.amazonaws.*
+org.wso2.orbit.com.atlassian.oai.*
+org.wso2.orbit.com.azure.*
+org.wso2.orbit.com.fasterxml.jackson.core.*
+org.wso2.orbit.com.fasterxml.jackson.dataformat.*
+org.wso2.orbit.com.fasterxml.jackson.module.*
+org.wso2.orbit.com.github.fge.*
+org.wso2.orbit.com.github.jknack.*
+org.wso2.orbit.com.google.api-client.*
+org.wso2.orbit.com.google.http-client.*
+org.wso2.orbit.com.google.oauth-client.*
+org.wso2.orbit.com.googlecode.json-simple.*
+org.wso2.orbit.com.h2database.*
+org.wso2.orbit.com.hazelcast.*
+org.wso2.orbit.com.jayway.jsonpath.*
+org.wso2.orbit.com.jcraft.*
+org.wso2.orbit.com.lmax.*
+org.wso2.orbit.com.microsoft.azure.*
+org.wso2.orbit.com.nimbusds.*
+org.wso2.orbit.com.predic8.*
+org.wso2.orbit.com.squareup.okhttp.*
+org.wso2.orbit.com.squareup.okio.*
+org.wso2.orbit.commons-beanutils.*
+org.wso2.orbit.commons-codec.*
+org.wso2.orbit.commons-fileupload.*
+org.wso2.orbit.commons-net.*
+org.wso2.orbit.commons-text.*
+org.wso2.orbit.gogoproto-java.*
+org.wso2.orbit.graphQL.*
+org.wso2.orbit.httpcomponents.*
+org.wso2.orbit.io.fabric8.*
+org.wso2.orbit.io.grpc.*
+org.wso2.orbit.io.jaeger.*
+org.wso2.orbit.io.netty.*
+org.wso2.orbit.io.opencensus.*
+org.wso2.orbit.io.opentelemetry.*
+org.wso2.orbit.io.projectreactor.*
+org.wso2.orbit.io.swagger.*
+org.wso2.orbit.io.swagger.parser.v3.*
+org.wso2.orbit.io.swagger.v3.*
+org.wso2.orbit.javax.activation.*
+org.wso2.orbit.javax.rmi.*
+org.wso2.orbit.javax.transaction.*
+org.wso2.orbit.javax.xml.bind.*
+org.wso2.orbit.joda-time.*
+org.wso2.orbit.jsr105.*
+org.wso2.orbit.org.activiti.*
+org.wso2.orbit.org.apache.commons.*
+org.wso2.orbit.org.apache.cxf.*
+org.wso2.orbit.org.apache.directory.*
+org.wso2.orbit.org.apache.geronimo.specs.*
+org.wso2.orbit.org.apache.httpcomponents.*
+org.wso2.orbit.org.apache.lucene.*
+org.wso2.orbit.org.apache.mina.*
+org.wso2.orbit.org.apache.ode.*
+org.wso2.orbit.org.apache.olingo.*
+org.wso2.orbit.org.apache.poi.*
+org.wso2.orbit.org.apache.solr.*
+org.wso2.orbit.org.apache.tiles.*
+org.wso2.orbit.org.apache.tomcat.*
+org.wso2.orbit.org.apache.velocity.*
+org.wso2.orbit.org.apache.xmlbeans.*
+org.wso2.orbit.org.apache.zookeeper.*
+org.wso2.orbit.org.bouncycastle.*
+org.wso2.orbit.org.codehaus.jettison.*
+org.wso2.orbit.org.everit.json.*
+org.wso2.orbit.org.mapstruct.*
+org.wso2.orbit.org.milyn.*
+org.wso2.orbit.org.mozilla.*
+org.wso2.orbit.org.openapitools.*
+org.wso2.orbit.org.openapitools.swagger.parser.*
+org.wso2.orbit.org.openid4java.*
+org.wso2.orbit.org.opensaml.*
+org.wso2.orbit.org.owasp.*
+org.wso2.orbit.org.quartz-scheduler.*
+org.wso2.orbit.org.reflections.*
+org.wso2.orbit.org.springframework.ws.*
+org.wso2.orbit.org.webharvest.*
+org.wso2.orbit.org.yaml.*
+org.wso2.orbit.re2j.*
+org.wso2.orbit.sun.xml.bind.*
+org.wso2.orbit.sun.xml.ws.*
+org.wso2.orbit.tranql.*
+org.wso2.orbit.webauthn4j.*
+org.wso2.orbit.xerces.*
+org.wso2.orbit.xml-apis.*
+org.wso2.orbit.yubico.webauthn.*
+org.wso2.org.apache.commons.*
+org.wso2.org.apache.mina.*
+org.wso2.org.apache.shindig.*
+org.wso2.org.ops4j.pax.logging.*
+org.wso2.org.owasp.*
+org.wso2.performance.apim.*
+org.wso2.performance.common.*
+org.wso2.samples.is.*
+org.wso2.santuario.*
+org.wso2.santuario.orbit.*
+org.wso2.securevault.*
+org.wso2.siddhi.*
+org.wso2.siddhi.extension.archetype.*
+org.wso2.siddhi.sdk.*
+org.wso2.sp.*
+org.wso2.testgrid.*
+org.wso2.tomcat.*
+org.wso2.tomcat.ha.*
+org.wso2.transport.email.*
+org.wso2.transport.file.*
+org.wso2.transport.http.*
+org.wso2.transport.jms.*
+org.wso2.webharvest.*
+org.wso2.wsdl4j.*
+org.wso2.wum.client.*
+org.wte4j.*
+org.wtsl.*
+org.wuokko.robot.*
+org.wurbelizer.*
+org.wuwz.*
+org.wvlet.*
+org.wvlet.airframe.*
+org.wvlet.msgframe.*
+org.wwarn.localforage.*
+org.wwarn.mapssurveyor.*
+org.wymiwyg.*
+org.wymiwyg.clerezza.*
+org.wymiwyg.js.*
+org.wymiwyg.karaf.tooling.*
+org.wyona.html2mrkdwn.*
+org.wyona.triton.client.*
+org.x-meta.*
+org.x2br.*
+org.xBaseJ.*
+org.xacml4j.*
+org.xaloon.*
+org.xaloon.archetype.*
+org.xaloon.core.*
+org.xaloon.plugins.*
+org.xaloon.profiles.*
+org.xaloon.wicket.*
+org.xanot.*
+org.xbean.*
+org.xbery.*
+org.xbib.*
+org.xbib.elasticsearch.*
+org.xbib.elasticsearch.plugin.*
+org.xbib.gradle.plugin.*
+org.xbib.graphics.*
+org.xbib.groovy.*
+org.xbib.helianthus.*
+org.xbib.jdbc.*
+org.xbib.malva.*
+org.xblackcat.ant.*
+org.xblackcat.sjpu.*
+org.xcmis.*
+org.xcorpion.*
+org.xcsp.*
+org.xdef.*
+org.xdty.hugo.*
+org.xdty.media.*
+org.xdty.phone.number.*
+org.xdty.preference.*
+org.xdty.webdav.*
+org.xenei.*
+org.xenei.logging.*
+org.xerial.*
+org.xerial.example.*
+org.xerial.java.*
+org.xerial.larray.*
+org.xerial.maven.*
+org.xerial.sbt.*
+org.xerial.snappy.*
+org.xerial.thirdparty.*
+org.xerial.thirdparty.org_scala-js.*
+org.xeustechnologies.*
+org.xflatdb.*
+org.xhtmlrenderer.*
+org.xiaov.*
+org.xidea.*
+org.xifix.maven.*
+org.xillium.*
+org.ximinghui.*
+org.xins.*
+org.xipki.*
+org.xipki.assemblies.*
+org.xipki.assemblies.features.*
+org.xipki.assembly.*
+org.xipki.commons.*
+org.xipki.example.*
+org.xipki.examples.*
+org.xipki.feature.*
+org.xipki.features.*
+org.xipki.gateway.*
+org.xipki.http.*
+org.xipki.iaik.*
+org.xipki.p11proxy.*
+org.xipki.p11proxy.assemblies.*
+org.xipki.p11proxy.assemblies.features.*
+org.xipki.p11proxy.features.*
+org.xipki.pki.*
+org.xipki.pki.features.*
+org.xipki.qa.*
+org.xipki.qa.shells.*
+org.xipki.scep.*
+org.xipki.sdk.*
+org.xipki.shell.*
+org.xipki.shells.*
+org.xipki.tk.*
+org.xipki.tools.*
+org.xj4.*
+org.xkonnex.spring.generators.*
+org.xlightweb.*
+org.xmid.*
+org.xml-cml.*
+org.xmlactions.*
+org.xmlbeam.*
+org.xmlium.*
+org.xmlmatchers.*
+org.xmlobjects.*
+org.xmlobjects.gml.*
+org.xmlobjects.xal.*
+org.xmlresolver.*
+org.xmlunit.*
+org.xmtp.*
+org.xobo.dorado.*
+org.xolstice.maven.plugins.*
+org.xowl.hime.*
+org.xowl.infra.*
+org.xowl.platform.*
+org.xowl.toolkit.*
+org.xparse.*
+org.xpathqs.*
+org.xpertss.*
+org.xpl4java.*
+org.xpur.*
+org.xqdoc.*
+org.xrpl.*
+org.xs4j.*
+org.xsnake.*
+org.xsnake.cloud.*
+org.xsocket.*
+org.xson.*
+org.xtce.*
+org.xtend.*
+org.xtext.*
+org.xtuml.*
+org.xuanlisoft.daintydoc.*
+org.xujin.halo.*
+org.xume.*
+org.xume.easybuilders.*
+org.xutils.*
+org.xwidgets.*
+org.xwiki.commons.*
+org.xwiki.rendering.*
+org.xworker.*
+org.xxtea.*
+org.xylan.mailspy.*
+org.xyou.*
+org.xyro.*
+org.y-op.*
+org.yagnus.*
+org.yakworks.*
+org.yamcs.*
+org.yamevetwo.*
+org.yamj.*
+org.yaml.*
+org.yardstickframework.*
+org.yarnandtail.*
+org.yatech.commons.*
+org.yatech.jedis.*
+org.yeauty.*
+org.yestech.*
+org.yestech.maven.*
+org.yesworkflow.*
+org.yetiz.lib.*
+org.yetiz.utils.*
+org.yggd.*
+org.yggd.server.*
+org.yorm.*
+org.youngmonkeys.*
+org.yql4j.*
+org.ysb33r.gradle.*
+org.ytheohar.*
+org.yuanheng.*
+org.yuanheng.cookcc.*
+org.yuanheng.cookjson.*
+org.yuanheng.cookxml.*
+org.yuequan.*
+org.yunchen.gb.*
+org.yunghegel.gdx.*
+org.yupana.*
+org.zahnleiter.*
+org.zalando.*
+org.zalando.automata.*
+org.zalando.github.*
+org.zalando.guild.api.*
+org.zalando.jpa.*
+org.zalando.maven.plugins.*
+org.zalando.nakadi.client.*
+org.zalando.opentracing.*
+org.zalando.org.springframework.build.*
+org.zalando.paradox.*
+org.zalando.phrs.*
+org.zalando.reactivenakadi.*
+org.zalando.research.*
+org.zalando.spring.*
+org.zalando.straw.*
+org.zalando.stups.*
+org.zalando.stups.build.*
+org.zalando.stups.io.fabric8.*
+org.zalando.stups.org.jolokia.*
+org.zalando.zauth.*
+org.zalando.zjsonpatch.*
+org.zalando.zmon.*
+org.zanata.*
+org.zapodot.*
+org.zaproxy.*
+org.zaproxy.addon.*
+org.zbus.*
+org.zcore.maven.*
+org.zdevra.*
+org.zdevra.sparrow.*
+org.zenframework.z8.dependencies.*
+org.zenframework.z8.dependencies.commons.*
+org.zenframework.z8.dependencies.minimizers.*
+org.zenframework.z8.dependencies.servlet.*
+org.zeromq.*
+org.zeroturnaround.*
+org.zhangxiao.paladin2.*
+org.zhongweixian.*
+org.zionusa.*
+org.zkoss.*
+org.zkoss.calendar.*
+org.zkoss.common.*
+org.zkoss.maven.*
+org.zkoss.theme.*
+org.zkoss.zest.*
+org.zkoss.zk.*
+org.zkoss.zkforge.*
+org.zkoss.zkforge.el.*
+org.zkoss.zkoss.*
+org.zkovari.changelog.*
+org.zkovari.mermaid.*
+org.zlwl.*
+org.znerd.*
+org.zols.*
+org.zoodb.*
+org.zoomba-lang.*
+org.zooper.gradle.*
+org.zouzias.*
+org.zowe.client.java.sdk.*
+org.zoxweb.*
+org.zstacks.*
+org.ztemplates.*
+org.zuchini.*
+org.zuchini.examples.*
+org.zwobble.mammoth.*
+oro.*
+oscube.*
+ovh.lumen.*
+ovh.plrapps.*
+ovh.plrapps.mapview.*
+ovh.ruokki.query.*
+ovh.vicart.splashfx.*
+p2psockets.*
+p6spy.*
+page.foliage.*
+party.52it.*
+party.iroiro.*
+party.iroiro.jua.*
+party.iroiro.luajava.*
+party.liyin.*
+party.para.*
+pathwaycommons.*
+patterntesting.*
+payload.*
+pcj.*
+pdfbox.*
+pe.com.sss.*
+penguin.*
+pet.orca.*
+ph.com.autodeal.*
+ph.com.globe.connect.*
+ph.com.nightowlstudios.*
+ph.extremelogic.*
+ph.samson.*
+ph.samson.daac.*
+ph.samson.flickr4java.*
+ph.samson.fork.*
+ph.samson.japper.*
+ph.samson.logback.*
+ph.samson.maven.*
+ph.samson.pmgy.*
+ph.samson.remder.*
+ph.samson.ws.*
+ph.samson.xdg.*
+piccolo.*
+picocontainer.*
+picounit.*
+pink.catty.*
+pink.cozydev.*
+pink.madis.apk.arsc.*
+pink.madis.bigaar.*
+pircbot.*
+pitt.search.*
+pl.ais.commons.*
+pl.ais.maven.*
+pl.ais.tools.*
+pl.allegro.*
+pl.allegro.android.*
+pl.allegro.android.slinger.*
+pl.allegro.android.typedlistadapter.*
+pl.allegro.finance.*
+pl.allegro.mobile.*
+pl.allegro.search.solr.*
+pl.allegro.tech.*
+pl.allegro.tech.boot.*
+pl.allegro.tech.build.*
+pl.allegro.tech.build.axion-release.*
+pl.allegro.tech.couchbase-commons.*
+pl.allegro.tech.discovery.*
+pl.allegro.tech.elasticsearch.plugin.*
+pl.allegro.tech.graphql.*
+pl.allegro.tech.hermes.*
+pl.allegro.tech.servicemesh.*
+pl.alyx.range.*
+pl.amazingcode.*
+pl.applover.*
+pl.bclogic.*
+pl.beone.lib.*
+pl.beone.promena.actor-creator.*
+pl.beone.promena.alfresco.lib.rendition.*
+pl.beone.promena.alfresco.lib.transformer-rendition.*
+pl.beone.promena.alfresco.module.*
+pl.beone.promena.alfresco.module.connector.*
+pl.beone.promena.alfresco.module.rendition.*
+pl.beone.promena.alfresco.module.transformer-rendition.*
+pl.beone.promena.alfresco.module.transformer.*
+pl.beone.promena.base.*
+pl.beone.promena.cluster.management.*
+pl.beone.promena.communication.*
+pl.beone.promena.communication.file.external.*
+pl.beone.promena.communication.file.internal.*
+pl.beone.promena.communication.file.model.*
+pl.beone.promena.communication.memory.external.*
+pl.beone.promena.communication.memory.internal.*
+pl.beone.promena.communication.memory.model.*
+pl.beone.promena.connector.*
+pl.beone.promena.lib.connector.*
+pl.beone.promena.maven.plugin.*
+pl.beone.promena.sdk.maven.archetype.*
+pl.beone.promena.sdk.maven.parent.*
+pl.beone.promena.transformer.*
+pl.brightone.jcircuitbreaker.*
+pl.brightone.security.web.*
+pl.bristleback.*
+pl.chalapuk.muice.*
+pl.charmas.android.*
+pl.chilldev.commons.*
+pl.chilldev.facelets.*
+pl.chilldev.lambda.*
+pl.chilldev.parent.*
+pl.chilldev.web.*
+pl.clareo.coroutines.*
+pl.clareo.coroutines.core.*
+pl.clareo.coroutines.user.*
+pl.coderion.*
+pl.coderion.mongodb.*
+pl.coderion.openfoodfacts.*
+pl.codewise.*
+pl.codewise.canaveral.*
+pl.codewise.commons.*
+pl.codewise.globee.*
+pl.codewise.spotty.*
+pl.com.labaj.*
+pl.com.labaj.autorecord.*
+pl.damianszczepanik.*
+pl.databucket.*
+pl.datart.*
+pl.decerto.*
+pl.decerto.hyperon.persistence.*
+pl.delukesoft.*
+pl.devcoffee.*
+pl.dexterxx.dev.alfresco.*
+pl.digitalvirgo.justsend.*
+pl.droidsonroids.*
+pl.droidsonroids.androiddebugdatabase.*
+pl.droidsonroids.foqa.*
+pl.droidsonroids.gif.*
+pl.droidsonroids.gradle.*
+pl.droidsonroids.gradle.localization.*
+pl.droidsonroids.pitest.*
+pl.droidsonroids.pitest.aggregator.*
+pl.droidsonroids.relinker.*
+pl.droidsonroids.retrofit2.*
+pl.droidsonroids.testing.*
+pl.droidsonroids.yaml.*
+pl.ds.websight.*
+pl.edu.agh.scalamas.*
+pl.edu.icm.*
+pl.edu.icm.pcj.*
+pl.edu.pw.mini.zmog.*
+pl.edu.radomski.*
+pl.essekkat.*
+pl.execon.commons.*
+pl.fhframework.*
+pl.fhframework.aspects.*
+pl.fhframework.commons.*
+pl.fhframework.core.security.permission.*
+pl.fhframework.core.security.provider.*
+pl.fhframework.dp.*
+pl.fhframework.example.*
+pl.fhframework.fhbr.*
+pl.fhframework.integration.*
+pl.fhframework.persistence.*
+pl.fhframework.reports.*
+pl.foltak.polish-identification-numbers-utils.*
+pl.gdela.*
+pl.gildur.*
+pl.grizzlysoftware.*
+pl.grizzlysoftware.chlorek.*
+pl.grizzlysoftware.chlorek.core.*
+pl.immutables.*
+pl.iogreen.lols.*
+pl.iogreen.scalapi.*
+pl.iterators.*
+pl.jalokim.coderules.*
+pl.jalokim.parentpom.*
+pl.jalokim.propertiestojson.*
+pl.jalokim.utils.*
+pl.javadevelopers.*
+pl.javadevelopers.junit.*
+pl.javahello.*
+pl.joegreen.*
+pl.jojczykp.maven.plugins.*
+pl.jsolve.*
+pl.kaszaq.agile.*
+pl.kaszaq.howfastyouaregoing.*
+pl.koder95.*
+pl.kotcrab.*
+pl.kotcrab.vis.*
+pl.ksdev.*
+pl.kubiczak.*
+pl.maciejkopec.*
+pl.makasprzak.*
+pl.marchwicki.*
+pl.marcinchwedczuk.*
+pl.marcinchwedczuk.javafx.validation.*
+pl.mareklangiewicz.*
+pl.matisoft.*
+pl.matsuo.*
+pl.matsuo.installer.*
+pl.matsuo.interfacer.*
+pl.matsuo.liquid.*
+pl.matsuo.maven.skins.*
+pl.matsuo.tools.kafka.*
+pl.memleak.*
+pl.metaprogramming.*
+pl.metastack.*
+pl.mg6.hrisey.*
+pl.mg6.rxjava2.disposeondestroy.*
+pl.mg6.veni.divi.*
+pl.michal-grzesiak.*
+pl.mietkins.*
+pl.miloszgilga.*
+pl.mk5.gdx-fireapp.*
+pl.mkazik.core.*
+pl.mkazik.core.android-app.*
+pl.mkazik.core.android-lib.*
+pl.morgaroth.*
+pl.morgwai.base.*
+pl.msitko.*
+pl.muninn.*
+pl.najda.*
+pl.net.bluesoft.*
+pl.net.falcon.*
+pl.newicom.*
+pl.newicom.akka.*
+pl.newicom.dddd.*
+pl.newicom.scalexpr.*
+pl.ninecube.slicer.*
+pl.nk.*
+pl.nort.*
+pl.oakfusion.*
+pl.org.miki.*
+pl.owlsy.*
+pl.panasoft.*
+pl.pkazenas.*
+pl.pkk82.*
+pl.pkk82.ci.*
+pl.pkk82.file-hierarchy-assert.*
+pl.pkk82.file-hierarchy-generator.*
+pl.pkk82.test.*
+pl.pkk82.test.ci.*
+pl.pkk82.tests.ci.*
+pl.pojo.*
+pl.polidea.*
+pl.polinc.dummycastle.*
+pl.powermilk.*
+pl.poznan.put.*
+pl.ppwozniak.*
+pl.pragmatists.*
+pl.pragmatists.tumbler.*
+pl.project13.*
+pl.project13.janbanery.*
+pl.project13.maven.*
+pl.project13.scala.*
+pl.raszkowski.*
+pl.rspective.opengdansk.*
+pl.rspective.pagerdatepicker.*
+pl.rspective.voucherify.android.client.*
+pl.rspective.voucherify.client.*
+pl.rzrz.*
+pl.serwersms.*
+pl.setblack.*
+pl.sigmapoint.*
+pl.solr.ag.*
+pl.solr.datamodel.*
+pl.sparkbit.*
+pl.speednet.c-shadow.*
+pl.stachuofficial.*
+pl.stypka.jevidence.*
+pl.symentis.lua4j.*
+pl.symentis.shelly.*
+pl.tahona.*
+pl.tajchert.*
+pl.tecna.gwt.*
+pl.tfij.*
+pl.thewalkingcode.sha3.*
+pl.tkowalcz.*
+pl.tkowalcz.tjahzi.*
+pl.tlinkowski.annotation.*
+pl.tlinkowski.gradle.my.*
+pl.tlinkowski.gradle.my.settings.*
+pl.tlinkowski.gradle.my.superpom.*
+pl.tlinkowski.unij.*
+pl.touk.*
+pl.touk.android.*
+pl.touk.cxf.*
+pl.touk.influxdb-reporter.*
+pl.touk.krush.*
+pl.touk.nussknacker.*
+pl.touk.osgi.*
+pl.touk.pscheduler.*
+pl.touk.sputnik.*
+pl.treksoft.*
+pl.unak7.pesel-validator.*
+pl.unforgiven.*
+pl.wavesoftware.*
+pl.wavesoftware.sampler.*
+pl.wavesoftware.testing.*
+pl.wavesoftware.testing.examples.*
+pl.wavesoftware.utils.*
+pl.wavesoftware.webjars.*
+pl.waw.michal.maven.plugin.*
+pl.wendigo.*
+pl.wkr.*
+pl.wojtun.*
+pl.wrzasq.cform.*
+pl.wrzasq.commons.*
+pl.wrzasq.lambda.*
+pl.wrzasq.parent.*
+pl.zankowski.*
+pl.zycienakodach.*
+pl.zygielo.*
+plexus.*
+plj.*
+plus.adaptive.*
+plus.easydo.*
+plus.hutool.*
+plus.jdk.*
+plus.jdk.grpc.*
+plus.jdk.zookeeper.*
+plus.kat.*
+plus.ojbk.*
+plus.wcj.*
+pluto-container.*
+pm.pride.*
+pmd.*
+pnuts.*
+poi.*
+poolman.*
+portlet-api.*
+postgresql.*
+prevayler.*
+pro.alexzaitsev.*
+pro.apphub.*
+pro.auditofthings.*
+pro.avodonosov.*
+pro.boto.*
+pro.chenggang.*
+pro.cryptoevil.*
+pro.cutout.*
+pro.dagen.*
+pro.devsvc.*
+pro.eng.yui.*
+pro.felixo.*
+pro.fessional.*
+pro.foundev.cassandra.*
+pro.gravit.launcher.*
+pro.haichuang.framework.*
+pro.horde.os.*
+pro.idax.api.client.*
+pro.jaitl.*
+pro.javatar.commons.*
+pro.javatar.security.*
+pro.javatar.security.gateway.*
+pro.jayeshseth.madifiers.*
+pro.jefferson.*
+pro.johndunlap.*
+pro.juxt.clojars-forks.com.stuartsierra.*
+pro.juxt.clojars-forks.com.taoensso.*
+pro.juxt.clojars-forks.edn-query-language.*
+pro.juxt.clojars-mirrors.camel-snake-kebab.*
+pro.juxt.clojars-mirrors.cheshire.*
+pro.juxt.clojars-mirrors.clj-commons.*
+pro.juxt.clojars-mirrors.clj-http.*
+pro.juxt.clojars-mirrors.com.github.seancorfield.*
+pro.juxt.clojars-mirrors.com.stuartsierra.*
+pro.juxt.clojars-mirrors.com.taoensso.*
+pro.juxt.clojars-mirrors.crux.*
+pro.juxt.clojars-mirrors.edn-query-language.*
+pro.juxt.clojars-mirrors.hato.*
+pro.juxt.clojars-mirrors.hiccup.*
+pro.juxt.clojars-mirrors.integrant.*
+pro.juxt.clojars-mirrors.metosin.*
+pro.juxt.clojars-mirrors.ring.*
+pro.juxt.clojars-mirrors.weavejester.*
+pro.juxt.clojars-mirrors.xtdb.*
+pro.juxt.clojars-mirrors.ztellman.*
+pro.juxt.crux-labs.*
+pro.juxt.crux.*
+pro.kordyjan.*
+pro.labster.*
+pro.leaco.dev.*
+pro.leaco.qrcode.*
+pro.lukasgorny.*
+pro.mickey.*
+pro.panopticon.*
+pro.parseq.*
+pro.projo.*
+pro.redsoft.iframework.*
+pro.requena.ea.*
+pro.respawn.apiresult.*
+pro.respawn.flowmvi.*
+pro.respawn.kmmutils.*
+pro.safeworld.*
+pro.savant.circumflex.*
+pro.shuangxi.*
+pro.streem.*
+pro.streem.metrics-datadog.*
+pro.streem.pbandk.*
+pro.streem.sceneform.*
+pro.taskana.*
+pro.taskana.history.*
+pro.taskana.simplehistory.*
+pro.topme.*
+pro.trautmann.*
+pro.tyshchenko.*
+pro.useit.recyclerview.*
+pro.vdshb.*
+pro.verron.*
+pro.wangfeng.*
+pro.yinghuo.*
+pro.youquan.*
+pro.zackpollard.telegrambot.api.*
+proctor.*
+profiler.*
+proxool.*
+proxytoys.*
+pt.davidafsilva.apple.*
+pt.davidafsilva.jvm.kotlin.*
+pt.davidafsilva.vertx.*
+pt.kcry.*
+pt.lighthouselabs.obd.*
+pt.lighthouselabs.sherlock.*
+pt.lightweightform.*
+pt.lightweightform.plugins.*
+pt.lr-os.*
+pt.neticle.ark.*
+pt.nmusic.*
+pt.rcaap.*
+pt.sharespot.*
+pt.solomo.*
+pt.tecnico.dsi.*
+pt.ulisboa.*
+pt.ulusofona.deisi.*
+pt.uminho.ceb.biosystems.*
+pt.uminho.ceb.biosystems.mcslibrary.*
+pt.uminho.ceb.biosystems.mew.*
+pt.unl.fct.novalincs.*
+pt.unparallel.*
+pt.up.fe.specs.*
+pub.adfly.*
+pub.carzy.*
+pub.codex.*
+pub.conf.nginx.*
+pub.devrel.*
+pub.doric.*
+pub.doric.dangle.*
+pub.doric.extension.*
+pub.dsb.framework.*
+pub.dsb.framework.boot.*
+pub.ihub.lib.*
+pub.ingress.*
+pub.iseekframework.*
+pub.iyu.*
+pub.jcr.android.*
+pub.techfun.*
+pubscribe.*
+pull-parser.*
+pw.binom.*
+pw.forst.*
+pw.hysteria.*
+pw.hysteria.input.*
+pw.ian.*
+pw.kmp.*
+pw.krejci.*
+pw.mihou.*
+pw.prok.*
+pw.prok.bootstrap.*
+pw.spn.*
+pw.stamina.*
+qa.hedgehog.*
+qa.justtestlah.*
+qdox.*
+quartz.*
+quilt.*
+radeox.*
+re.mko.jsnprsr.*
+red.honey.*
+red.htt.*
+red.lixiang.tools.*
+red.mulan.boot.*
+red.stu.coder.*
+red.sukun1899.*
+red.wjf.*
+red.zyc.*
+red.zyc.boot.*
+red.zyc.toolkit.*
+redhill.*
+redis.clients.*
+redmine.*
+regexp.*
+relaxngDatatype.*
+ren.crux.*
+ren.erdong.*
+ren.hankai.*
+ren.imyan.endureblazex.adapter.*
+ren.imyan.endureblazex.base.*
+ren.imyan.endureblazex.ktx.*
+ren.imyan.endureblazex.util.*
+ren.tzcc.*
+ren.wenchao.*
+ren.yale.java.*
+report.donut.*
+reportrunner.*
+rest.bef.*
+rhino.*
+ro.altom.*
+ro.andreimatei.*
+ro.coderdojo.spigot.*
+ro.derbederos.*
+ro.derbederos.hamcrest.*
+ro.dragossusi.*
+ro.dragossusi.android.*
+ro.dragossusi.kodein.viewmodel.*
+ro.dragossusi.sevens.*
+ro.esolutions.*
+ro.fortsoft.*
+ro.fortsoft.auditor.*
+ro.fortsoft.dada.*
+ro.fortsoft.dataset.*
+ro.fortsoft.ff2j.*
+ro.fortsoft.gogo.*
+ro.fortsoft.licensius.*
+ro.fortsoft.log2j.*
+ro.fortsoft.pf4j.*
+ro.fortsoft.pf4j.demo.*
+ro.fortsoft.pippo.*
+ro.fortsoft.sms-util.*
+ro.fortsoft.wicket.dashboard.*
+ro.fortsoft.wicket.dashboard.widgets.*
+ro.fortsoft.wicket.jade.*
+ro.fortsoft.wicket.pivot.*
+ro.fortsoft.wicket.plugin.*
+ro.fortsoft.wicket.plugin.demo.*
+ro.ghionoiu.*
+ro.go.kpaxplanet.*
+ro.hasna.commons.*
+ro.hasna.ts.*
+ro.holdone.*
+ro.isdc.wro4j.*
+ro.josekibold.*
+ro.kuberam.*
+ro.kuberam.expath.exist.*
+ro.kuberam.libs.*
+ro.kuberam.libs.java.*
+ro.kuberam.maven.plugins.*
+ro.mirceanistor.*
+ro.nextreports.*
+ro.nom.vmt.*
+ro.oiste.notify.*
+ro.pippo.*
+ro.polak.*
+ro.stancalau.*
+ro.startx.*
+ro.tsuku.*
+ro.tudorluca.numberpicker.*
+roboguice.*
+rocks.bastion.*
+rocks.cleancode.*
+rocks.coffeenet.*
+rocks.earlyeffect.*
+rocks.elegantly.bd.*
+rocks.frieler.android.*
+rocks.frieler.android.release.*
+rocks.grape.*
+rocks.heikoseeberger.*
+rocks.inspectit.*
+rocks.juergen.*
+rocks.kavin.*
+rocks.limburg.cdimock.*
+rocks.palaiologos.*
+rocks.prestodb.*
+rocks.spiffy.*
+rocks.teagantotally.*
+rocks.vilaverde.*
+rocks.voss.*
+rocks.voss.androidutils.*
+rocks.voss.maven.plugins.*
+rocks.waffle.telekt.*
+rocks.xmpp.*
+rodeo.password.*
+roller.*
+rome.*
+rs.arthu.*
+rs.fon.kvizic.*
+rs.in.zivanovic.*
+rs.innolabsolutions.*
+rs.ltt.autocrypt.*
+rs.ltt.jmap.*
+rss4j.*
+rsslibj.*
+ru.adm123.*
+ru.albemuth.jcuda.*
+ru.albemuth.tentura.*
+ru.androidpirates.permissions.*
+ru.apps-m.*
+ru.argento.*
+ru.arigativa.*
+ru.arkoit.*
+ru.arkoit.jackson.module.*
+ru.ars-co.*
+ru.aslcraft.*
+ru.aslcraft.bell.oauth.discord.*
+ru.asmsoft.*
+ru.astrainteractive.astralibs.*
+ru.astrainteractive.gradleplugin.*
+ru.astrainteractive.klibs.*
+ru.astrainteractive.klibs.kdi.*
+ru.astrainteractive.mobilex.*
+ru.asubezdna.*
+ru.avicomp.*
+ru.avicorp.*
+ru.bartwell.*
+ru.beryukhov.*
+ru.blizzed.*
+ru.bozaro.gitlfs.*
+ru.brikster.*
+ru.build-crm.*
+ru.burov4j.storm.*
+ru.cerbe.kotlin.*
+ru.chermenin.*
+ru.chermenin.kio.*
+ru.chrshnv.*
+ru.cian.*
+ru.circumflex.*
+ru.classbase.*
+ru.cleverpumpkin.*
+ru.concerteza.buildnumber.*
+ru.concerteza.spring-embedded-tomcat.*
+ru.concerteza.util.*
+ru.cookedapp.trckr.*
+ru.creditnet.*
+ru.curs.*
+ru.d-shap.*
+ru.d10xa.*
+ru.darklogic.*
+ru.darklogic.jericho.*
+ru.delimobil.*
+ru.dezhik.*
+ru.dgolubets.*
+ru.dimgel.*
+ru.dimsuz.*
+ru.divinecraft.*
+ru.dmerkushov.*
+ru.easydonate.easydonate4j.*
+ru.endlesscode.inspector.*
+ru.endlesscode.mimic.*
+ru.ex-data.*
+ru.exxo.jutil.*
+ru.fatrat.jsonmarshal.*
+ru.finam.*
+ru.finnetrolle.*
+ru.finnetrolle.tools.*
+ru.fix.*
+ru.freedomlogic.*
+ru.frostman.dropbox.*
+ru.frostman.web.*
+ru.fusionsoft.*
+ru.gildor.coroutines.*
+ru.gildor.databinding.*
+ru.gladorange.*
+ru.greatbit.*
+ru.greatbit.plow.*
+ru.greatbit.utils.*
+ru.greatbit.whoru.*
+ru.harati.*
+ru.hh.oauth.subscribe.*
+ru.hixon.*
+ru.hnau.*
+ru.homyakin.*
+ru.i-novus.common.*
+ru.i-novus.components.*
+ru.i-novus.messaging.*
+ru.i-novus.ms.audit.*
+ru.i-novus.ms.rdm.*
+ru.i-novus.ms.rdm.sync.*
+ru.icbcom.aistdap.*
+ru.ilb.adjustdate.*
+ru.ilb.aspectlock.*
+ru.ilb.basicuuid.*
+ru.ilb.buildtools.*
+ru.ilb.callcontext.*
+ru.ilb.common.*
+ru.ilb.containeraccessor.*
+ru.ilb.filedossier.*
+ru.ilb.jfunction.*
+ru.ilb.jndicontext.*
+ru.ilb.jsonschema.*
+ru.ilb.openapiutils.*
+ru.ilb.parent.*
+ru.ilb.pdfgen.*
+ru.ilb.scripting.*
+ru.ilb.swagger.*
+ru.ilb.testhttpserver.*
+ru.ilb.uriaccessor.*
+ru.ilb.w3c.*
+ru.infon.oss.*
+ru.iopump.koproc.*
+ru.iopump.kotest.*
+ru.iopump.pumpfw.*
+ru.iopump.qa.*
+ru.iris.*
+ru.ispras.*
+ru.ispras.modis.*
+ru.it-syn.*
+ru.itbasis.gradle.plugins.*
+ru.itbasis.utils.*
+ru.ivi.opensource.*
+ru.jdbreport.*
+ru.johnspade.*
+ru.keepupproject.*
+ru.kiryam.*
+ru.kliniki-online.*
+ru.kode.*
+ru.kode.pathfinder.*
+ru.koluch.morphdict.*
+ru.kontur.extern-api.*
+ru.kontur.kinfra.kfixture.*
+ru.kontur.mobile.visualfsm.*
+ru.kosdev.gwtwebsocket.*
+ru.kraftu.*
+ru.l3r8y.*
+ru.lagoshny.*
+ru.lanwen.diff.*
+ru.lanwen.feign.*
+ru.lanwen.raml.*
+ru.lanwen.verbalregex.*
+ru.lanwen.wiremock.*
+ru.ldralighieri.composites.*
+ru.ldralighieri.corbind.*
+ru.leon0399.*
+ru.loolzaaa.*
+ru.m2.*
+ru.mail.*
+ru.mail.im.*
+ru.mail.libnotify.*
+ru.mail.verify.*
+ru.makkarpov.*
+ru.maksimvoloshin.utility.*
+ru.mardaunt.*
+ru.mars-lab.*
+ru.megadevelopers.*
+ru.mihailovprog.*
+ru.mihailpro.lib.*
+ru.mihaly4.httpsdkspec.*
+ru.mihkopylov.*
+ru.mipt.npm.*
+ru.mipt.npm.gradle.common.*
+ru.mipt.npm.gradle.js.*
+ru.mipt.npm.gradle.jvm.*
+ru.mipt.npm.gradle.mpp.*
+ru.mipt.npm.gradle.native.*
+ru.mipt.npm.gradle.node.*
+ru.mipt.npm.gradle.project.*
+ru.mipt.npm.gradle.publish.*
+ru.mobiledev.*
+ru.mobileup.*
+ru.mobileup.code-quality-android.*
+ru.mobileup.module-graph.*
+ru.modulkassa.pos.*
+ru.moysklad.api.*
+ru.mrgrd56.*
+ru.mynewtons.*
+ru.napalabs.spark.*
+ru.nesferatos.*
+ru.ngs.developer.*
+ru.nichost.enroi.*
+ru.nikitav.android.archetypes.*
+ru.noties.*
+ru.noties.handle.*
+ru.noties.markwon.*
+ru.noties.simpleprefs.*
+ru.noties.spg.*
+ru.noties.storm.*
+ru.noties.todo.*
+ru.nsumedia.*
+ru.objectsfill.*
+ru.odnoklassniki.*
+ru.ok.*
+ru.oleg-cherednik.gson.*
+ru.oleg-cherednik.icoman.*
+ru.oleg-cherednik.jackson.*
+ru.oleg-cherednik.utils.*
+ru.oleg-cherednik.utils.jackson.*
+ru.oleg-cherednik.utils.reflection.*
+ru.oleg-cherednik.zip4jvm.*
+ru.omickron.*
+ru.onlinesim.*
+ru.opensecreto.*
+ru.oprosso.*
+ru.pavkin.*
+ru.perm.kefir.*
+ru.pixnews.igdbclient.*
+ru.playa.keycloak.*
+ru.pocketbyte.hydra.*
+ru.pocketbyte.kydra.*
+ru.pocketbyte.locolaser.*
+ru.potatophobe.*
+ru.potatophobe.konfig.*
+ru.pravbeseda.*
+ru.pravo.*
+ru.primetalk.*
+ru.prof-itgroup.*
+ru.progrm-jarvis.*
+ru.progrm-jarvis.reflector.*
+ru.proninyaroslav.*
+ru.qatools.*
+ru.qatools.commons.*
+ru.qatools.seleniumkit.*
+ru.quipy.*
+ru.r2cloud.*
+ru.r2cloud.openapi.*
+ru.radiationx.*
+ru.real-time-intelligence.*
+ru.redcom.lib.*
+ru.rofleksey.refl.*
+ru.romangr.*
+ru.rutoken.*
+ru.rutoken.pkcs11wrapper.*
+ru.sadv1r.spring.graphql.*
+ru.sadv1r.vk.*
+ru.saidgadjiev.*
+ru.saidgadjiev.ormnext.*
+ru.saidgadjiev.ormnext.support.*
+ru.sber.platformv.faas.*
+ru.sberdevices.smartapp.*
+ru.sberdevices.smartapp.sdk.*
+ru.sberdevices.smartapp.sdk.appstate.*
+ru.sberdevices.smartapp.sdk.binderhelper.*
+ru.sberdevices.smartapp.sdk.cv.*
+ru.sberdevices.smartapp.sdk.messaging.*
+ru.sberdevices.smartapp.sdk.mic_camera_state.*
+ru.sberned.*
+ru.sberned.statemachine.*
+ru.sbtqa.*
+ru.sbtqa.htmlelements.*
+ru.sbtqa.tag.*
+ru.sbtqa.tag.datajack.*
+ru.sbtqa.tag.datajack.adaptors.*
+ru.sbtqa.tag.datajack.providers.*
+ru.sbtqa.tag.pagefactory.*
+ru.sbtqa.tag.parsers.*
+ru.send-to.*
+ru.send-to.archetypes.*
+ru.send-to.barcode.*
+ru.send-to.dto.*
+ru.send-to.ejb.*
+ru.send-to.gwt.*
+ru.send-to.gwt.html.*
+ru.send-to.less.*
+ru.send-to.log.*
+ru.send-to.rest.*
+ru.send-to.telegram.*
+ru.send-to.versionManagement.*
+ru.send-to.websocket.*
+ru.sergkorot.dynamic.*
+ru.shadam.*
+ru.shadam.gretty.*
+ru.shadam.spring-boot.*
+ru.shemplo.*
+ru.shubert.*
+ru.siblion.lab.*
+ru.siksmfp.*
+ru.simplex_software.*
+ru.sms-activate.*
+ru.sokomishalov.commons.*
+ru.sokomishalov.jackson.*
+ru.sokomishalov.skraper.*
+ru.solrudev.ackpine.*
+ru.soniir.*
+ru.spb.devclub.*
+ru.spb.devclub.utils.*
+ru.stachek66.nlp.*
+ru.starksoft.*
+ru.stm-labs.http2rpc.*
+ru.stm-labs.rpc.*
+ru.stqa.*
+ru.stqa.selenium.*
+ru.studiomobile.*
+ru.surfstudio.android.*
+ru.systemate.*
+ru.taskurotta.*
+ru.teadev.*
+ru.technology45.*
+ru.telamon.*
+ru.tensor.sabycom.*
+ru.testit.*
+ru.textanalysis.tfwwt.*
+ru.tinkoff.*
+ru.tinkoff.acquiring.*
+ru.tinkoff.allure.*
+ru.tinkoff.core.*
+ru.tinkoff.core.components.log.*
+ru.tinkoff.core.components.nfc.*
+ru.tinkoff.core.components.security.*
+ru.tinkoff.core.tinkoffauth.*
+ru.tinkoff.decoro.*
+ru.tinkoff.dolyame.*
+ru.tinkoff.eba.*
+ru.tinkoff.gradle.*
+ru.tinkoff.invest.*
+ru.tinkoff.kora.*
+ru.tinkoff.kotea.*
+ru.tinkoff.mobile.*
+ru.tinkoff.piapi.*
+ru.tinkoff.recyclerviewpager.*
+ru.tinkoff.scrollingpagerindicator.*
+ru.tinkoff.testops.droidherd.*
+ru.tinkoff.testops.droidherd.chimprunner.*
+ru.tinkoff.tisdk.*
+ru.tinkoff.top.*
+ru.tinkoff.vkarmane.sdk.*
+ru.tochkak.*
+ru.toolkas.*
+ru.trylogic.groovy.inline.*
+ru.trylogic.groovy.macro.*
+ru.trylogic.maven.*
+ru.trylogic.maven.plugins.*
+ru.turlir.android.*
+ru.upagge.*
+ru.urururu.*
+ru.vibrotek.*
+ru.vyarus.*
+ru.vyarus.guice.jakarta.*
+ru.vyarus.guicey.*
+ru.vyukov.*
+ru.webim.sdk.*
+ru.wildbot.*
+ru.xajile.fuchakubutsu4j.*
+ru.yaal.hamcrest.*
+ru.yaal.maven.*
+ru.yaal.project.hhapi.*
+ru.yandex.*
+ru.yandex.android.tools.*
+ru.yandex.clickhouse.*
+ru.yandex.cocaine.*
+ru.yandex.qatools.*
+ru.yandex.qatools.actions.*
+ru.yandex.qatools.allure.*
+ru.yandex.qatools.ashot.*
+ru.yandex.qatools.beanloader.*
+ru.yandex.qatools.camelot.*
+ru.yandex.qatools.camelot.utils.*
+ru.yandex.qatools.clay.*
+ru.yandex.qatools.embed.*
+ru.yandex.qatools.htmlelements.*
+ru.yandex.qatools.matchers.*
+ru.yandex.qatools.processors.*
+ru.yandex.qatools.properties.*
+ru.ydn.*
+ru.ydn.wicket.wicket-console.*
+ru.ydn.wicket.wicket-orientdb.*
+ru.yoomoney.gradle.plugins.*
+ru.yoomoney.sdk.*
+ru.yoomoney.sdk.2fa.*
+ru.yoomoney.sdk.auth.*
+ru.yoomoney.sdk.gui.*
+ru.yoomoney.sdk.guiCompose.*
+ru.yoomoney.sdk.kassa.payments.*
+ru.yoomoney.sdk.marchcompose.*
+ru.yoomoney.sdk.partner-cards.*
+ru.yoomoney.sdk.sharedPublicationSample.*
+ru.yoomoney.sdk.wallet.*
+ru.yoomoney.sdk.yoopinning.*
+ru.yoomoney.sdk.yooprofiler.*
+ru.yoomoney.tech.*
+ru.zinal.*
+ru.zinin.*
+ru.zoommax.*
+ru.ztrap.*
+ru.ztrap.iconics.*
+ru.ztrap.tools.*
+ru.ztrap.views.*
+rubygems.*
+run.cobalt.*
+run.facet.agent.java.*
+run.halo.dependencies.*
+run.halo.gradle.*
+run.halo.plugin.devtools.*
+run.iget.*
+run.ktcheck.*
+run.mydata.*
+run.nabla.*
+run.qontract.*
+run.smt.f.*
+run.smt.ktest.*
+run.wj.*
+run.yang.lib.*
+run.zhinan.*
+sa.com.clickpay.*
+sa.com.stc.*
+sa.sy.*
+sablecc.*
+sax.*
+saxon.*
+saxpath.*
+sc.ala.*
+sc.tyro.*
+science.aist.*
+science.aist.gtf.*
+science.aist.imaging.*
+science.aist.machinelearning.*
+science.aist.neo4j.*
+science.aist.seshat.*
+science.doing.*
+science.raketen.voodoo.*
+scout.*
+scraping-engine.*
+se.ade.kuri.*
+se.akerfeldt.*
+se.alipsa.*
+se.alipsa.groovy.*
+se.ansman.autoplugin.*
+se.ansman.dagger.auto.*
+se.ansman.deager.*
+se.ansman.kotshi.*
+se.arkalix.*
+se.ayoy.*
+se.ayoy.maven-plugins.*
+se.bjornblomqvist.*
+se.bjurr.assertj.snapshot.*
+se.bjurr.bitbucketcloud.*
+se.bjurr.bom.*
+se.bjurr.byggarmonster.*
+se.bjurr.gitchangelog.*
+se.bjurr.gradle.*
+se.bjurr.jmib.*
+se.bjurr.openapitowiremock.*
+se.bjurr.springrestclient.*
+se.bjurr.springresttemplateclient.*
+se.bjurr.violations.*
+se.bjurr.wiremock.*
+se.bluebrim.maven.plugin.*
+se.bth.serl.*
+se.codeby.*
+se.codeunlimited.android.bitmap_utils.*
+se.codeunlimited.android.exception_handler.*
+se.codeunlimited.utils.*
+se.comhem.cucumber.annotations.*
+se.culvertsoft.*
+se.curity.identityserver.*
+se.dannej.*
+se.deadlock.*
+se.digg.dgc.*
+se.digiplant.*
+se.disu.*
+se.eelde.toggles.*
+se.emilsjolander.*
+se.emilsjolander.sprinkles.*
+se.emilsjolander.stickylistheaders.*
+se.emirbuc.randomsentence.*
+se.erebusit.*
+se.eris.*
+se.eris.util.*
+se.europeanspallationsource.*
+se.fearless.*
+se.fishtank.*
+se.fnord.*
+se.fortnox.reactivewizard.*
+se.gawell.*
+se.gawell.ktvstore.*
+se.gewalli.kyminon.*
+se.gothiaforum.gothia_actors.*
+se.grunddata.dzo.*
+se.gustavkarlsson.*
+se.hackney.jwt.*
+se.hackney.vittfaren.*
+se.haleby.aspectj.*
+se.haleby.kystrix.*
+se.hiq.oss.*
+se.hiq.oss.commons.*
+se.hiq.oss.kafka.*
+se.hiq.oss.qa.*
+se.hirt.jmc.*
+se.idsec.signservice.commons.*
+se.idsec.signservice.integration.*
+se.idsec.sigval.*
+se.idsec.sigval.base.*
+se.idsec.utils.*
+se.ikama.*
+se.imagick.*
+se.irori.kafka.*
+se.ivankrizsan.spring.*
+se.javasoft.development.*
+se.javasoft.maven.*
+se.jbee.*
+se.jguru.codestyle.*
+se.jguru.codestyle.annotations.*
+se.jguru.codestyle.poms.*
+se.jguru.codestyle.poms.java.*
+se.jguru.codestyle.poms.kotlin.*
+se.jguru.nazgul.core.algorithms.api.*
+se.jguru.nazgul.core.algorithms.event.api.*
+se.jguru.nazgul.core.algorithms.event.spi.eventbus.*
+se.jguru.nazgul.core.algorithms.launcher.api.*
+se.jguru.nazgul.core.algorithms.tree.api.*
+se.jguru.nazgul.core.algorithms.tree.model.*
+se.jguru.nazgul.core.cache.api.*
+se.jguru.nazgul.core.cache.example.*
+se.jguru.nazgul.core.cache.impl.ehcache.*
+se.jguru.nazgul.core.cache.impl.hazelcast.*
+se.jguru.nazgul.core.cache.impl.inmemory.*
+se.jguru.nazgul.core.clustering.api.*
+se.jguru.nazgul.core.configuration.model.*
+se.jguru.nazgul.core.features.*
+se.jguru.nazgul.core.jmx.api.*
+se.jguru.nazgul.core.jmx.test.mbeanserver.*
+se.jguru.nazgul.core.osgi.launcher.api.*
+se.jguru.nazgul.core.osgi.launcher.impl.felix.*
+se.jguru.nazgul.core.parser.api.*
+se.jguru.nazgul.core.persistence.api.*
+se.jguru.nazgul.core.persistence.model.*
+se.jguru.nazgul.core.poms.core-api-parent.*
+se.jguru.nazgul.core.poms.core-model-parent.*
+se.jguru.nazgul.core.poms.core-parent.*
+se.jguru.nazgul.core.poms.model-parent.*
+se.jguru.nazgul.core.quickstart.analyzer.api.*
+se.jguru.nazgul.core.quickstart.analyzer.impl.nazgul.*
+se.jguru.nazgul.core.quickstart.api.*
+se.jguru.nazgul.core.quickstart.impl.nazgul.*
+se.jguru.nazgul.core.quickstart.model.*
+se.jguru.nazgul.core.reflection.api.*
+se.jguru.nazgul.core.resource.api.*
+se.jguru.nazgul.core.resource.impl.resourcebundle.*
+se.jguru.nazgul.core.xmlbinding.api.*
+se.jguru.nazgul.core.xmlbinding.spi.jaxb.*
+se.jguru.nazgul.test.*
+se.jguru.nazgul.test.blueprint.*
+se.jguru.nazgul.test.bundles.*
+se.jguru.nazgul.test.bundles.hello.*
+se.jguru.nazgul.test.bundles.hello.api.*
+se.jguru.nazgul.test.bundles.hello.client.blueprint.*
+se.jguru.nazgul.test.bundles.hello.impl.blueprint.*
+se.jguru.nazgul.test.bundles.hello.impl.plain.*
+se.jguru.nazgul.test.messaging.*
+se.jguru.nazgul.test.osgi.*
+se.jguru.nazgul.test.persistence.*
+se.jguru.nazgul.test.poms.*
+se.jguru.nazgul.test.poms.parent.*
+se.jguru.nazgul.test.xmlbinding.*
+se.jguru.nazgul.tools.*
+se.jguru.nazgul.tools.codestyle.*
+se.jguru.nazgul.tools.features.*
+se.jguru.nazgul.tools.plugin.*
+se.jguru.nazgul.tools.plugin.checkstyle.*
+se.jguru.nazgul.tools.poms.*
+se.jguru.nazgul.tools.poms.external.*
+se.jguru.nazgul.tools.validation.*
+se.jguru.nazgul.tools.validation.api.*
+se.jguru.nazgul.tools.validation.aspect.*
+se.jguru.shared.*
+se.jguru.shared.algorithms.api.*
+se.jguru.shared.bom.*
+se.jguru.shared.jaxb.*
+se.jguru.shared.jaxb.eclipselink.example.*
+se.jguru.shared.jaxb.spi.adapters.*
+se.jguru.shared.jaxb.spi.eclipselink.*
+se.jguru.shared.jaxb.spi.metro.*
+se.jguru.shared.jaxb.spi.shared.*
+se.jguru.shared.json.*
+se.jguru.shared.json.jackson.example.*
+se.jguru.shared.json.spi.jackson.*
+se.jguru.shared.messaging.*
+se.jguru.shared.messaging.api.*
+se.jguru.shared.messaging.test.jms.*
+se.jguru.shared.persistence.*
+se.jguru.shared.persistence.spi.hibernate.*
+se.jguru.shared.persistence.spi.jdbc.*
+se.jguru.shared.persistence.spi.jpa.*
+se.jguru.shared.restful.*
+se.jguru.shared.restful.spi.jaxrs.*
+se.jguru.shared.service.*
+se.jguru.shared.service.model.*
+se.jguru.shared.service.spi.camel.*
+se.jguru.shared.test.entity.*
+se.jhaals.*
+se.jiderhamn.*
+se.jiderhamn.classloader-leak-prevention.*
+se.johanteleman.*
+se.kb.*
+se.koc.*
+se.kth.castor.*
+se.kth.infosys.*
+se.kth.infosys.log4j.*
+se.kth.infosys.log4j2.*
+se.kth.infosys.logback.*
+se.kth.infosys.smx.*
+se.kth.infosys.smx.alma.*
+se.kth.infosys.smx.ladok3.*
+se.kth.infosys.tomcat.*
+se.kth.infosys.ug.*
+se.kuseman.*
+se.kuseman.payloadbuilder.*
+se.l4.aurochs.*
+se.l4.commons.*
+se.l4.crayon.*
+se.l4.dust.*
+se.l4.exobytes.*
+se.l4.exoconf.*
+se.l4.graphql.binding.*
+se.l4.jobs.*
+se.l4.lect.*
+se.l4.otter.*
+se.l4.silo.*
+se.l4.vibe.*
+se.l4.ylem.ids.*
+se.l4.ylem.io.*
+se.l4.ylem.types.*
+se.laz.casual.*
+se.lindhen.qrgame.*
+se.litsec.bankid.*
+se.litsec.eidas.*
+se.litsec.opensaml.*
+se.litsec.opensaml.sweid.*
+se.litsec.sweid.idp.*
+se.liu.imt.mi.snomedct.*
+se.llbit.*
+se.lovef.*
+se.lth.cs.*
+se.lth.immun.*
+se.marcuslonnberg.*
+se.marteinn.utils.logging.*
+se.mdh.*
+se.mdh.driftavbrott.*
+se.mdh.jaxb.*
+se.mdh.nuget.*
+se.mdh.nuspec.*
+se.michaelthelin.spotify.*
+se.mikael-berglund.*
+se.mithlond.codestyle.*
+se.mithlond.codestyle.appserver.*
+se.mithlond.codestyle.appserver.wildfly.*
+se.mithlond.codestyle.appserver.wildfly.v10_0.*
+se.mithlond.codestyle.appserver.wildfly.v10_1.*
+se.mithlond.codestyle.appserver.wildfly.v11.*
+se.mithlond.codestyle.appserver.wildfly.v14.*
+se.mithlond.codestyle.appserver.wildfly.v15.*
+se.mithlond.codestyle.appserver.wildfly.v9_0.*
+se.mithlond.codestyle.codestyle.*
+se.mithlond.codestyle.poms.*
+se.mithlond.services.*
+se.mithlond.services.backend.*
+se.mithlond.services.backend.war.*
+se.mithlond.services.content.*
+se.mithlond.services.content.api.*
+se.mithlond.services.content.impl.ejb.*
+se.mithlond.services.content.model.*
+se.mithlond.services.organisation.*
+se.mithlond.services.organisation.api.*
+se.mithlond.services.organisation.impl.ejb.*
+se.mithlond.services.organisation.model.*
+se.mithlond.services.shared.*
+se.mithlond.services.shared.authorization.*
+se.mithlond.services.shared.authorization.api.*
+se.mithlond.services.shared.authorization.model.*
+se.mithlond.services.shared.spi.algorithms.*
+se.mithlond.services.shared.spi.jaxb.*
+se.mithlond.services.shared.spi.jpa.*
+se.mithlond.services.shared.test.entity.*
+se.mnord.scribe.*
+se.mockachino.*
+se.motility.*
+se.motility.inheritables.*
+se.mtm.addons.*
+se.natusoft.tools.codelicmgr.*
+se.natusoft.tools.doc.markdowndoc.*
+se.natusoft.tools.fileeditor.*
+se.natusoft.tools.optionsmgr.*
+se.nimsa.*
+se.oidc.nimbus.*
+se.oyabun.criters.*
+se.oyabun.criters.test.*
+se.premex.premex-lints.*
+se.radley.*
+se.redmind.*
+se.rivta.tools.*
+se.romanredz.mouse.*
+se.rosenbaum.*
+se.sawano.akka.japi.*
+se.sawano.eureka.*
+se.sawano.java.*
+se.sawano.java.security.*
+se.scalablesolutions.akka.*
+se.sekvy.*
+se.sics.kompics.*
+se.sics.kompics.basic.*
+se.sics.kompics.simulator.*
+se.simbio.encryption.*
+se.skltp.adapterservices.crm.carelisting.*
+se.skltp.adapterservices.druglogistics.dosdispensing.*
+se.skltp.adapterservices.ehr.accesscontrol.*
+se.skltp.adapterservices.insuranceprocess.healthreporting.*
+se.skltp.adapterservices.npoadapter.*
+se.skltp.adapterservices.se.apotekensservice.*
+se.skltp.admin.*
+se.skltp.aggregatingservices.clinicalprocess.activityprescription.actoutcome.*
+se.skltp.aggregatingservices.clinicalprocess.healthcond.actoutcome.*
+se.skltp.aggregatingservices.clinicalprocess.healthcond.description.*
+se.skltp.aggregatingservices.clinicalprocess.logistics.logistics.*
+se.skltp.aggregatingservices.crm.requeststatus.*
+se.skltp.aggregatingservices.crm.scheduling.*
+se.skltp.aggregatingservices.riv.clinicalprocess.activity.actions.*
+se.skltp.aggregatingservices.riv.clinicalprocess.activity.request.*
+se.skltp.aggregatingservices.riv.clinicalprocess.activityprescription.actoutcome.*
+se.skltp.aggregatingservices.riv.clinicalprocess.healthcond.actoutcome.*
+se.skltp.aggregatingservices.riv.clinicalprocess.healthcond.basic.*
+se.skltp.aggregatingservices.riv.clinicalprocess.healthcond.description.*
+se.skltp.aggregatingservices.riv.clinicalprocess.logistics.logistics.*
+se.skltp.aggregatingservices.riv.crm.requeststatus.*
+se.skltp.aggregatingservices.riv.crm.scheduling.*
+se.skltp.aggregatingservices.riv.ehr.log.*
+se.skltp.agp.*
+se.skltp.commons.*
+se.skltp.components.*
+se.skltp.ei.*
+se.skltp.hsa-cache.*
+se.skltp.infrastructure.itintegration.*
+se.skltp.itintegration.monitoring.*
+se.skltp.jms-admin-web.*
+se.skltp.mb.*
+se.skltp.patch.cxf.rtbindingssoap.*
+se.skltp.patch.mule.tls.default.*
+se.skltp.patch.mule.transport.http.*
+se.skltp.tak.*
+se.skltp.tk.*
+se.skltp.tools.agt-gen.*
+se.skltp.vp.*
+se.snylt.*
+se.softhouse.*
+se.softstuff.nb.*
+se.solrike.aws.*
+se.solrike.spring-aws-extras.*
+se.somath.publisher.*
+se.soy.gpg.*
+se.soy.kanna.*
+se.soy.securerstring.*
+se.spagettikod.*
+se.sundsvall.*
+se.sundsvall.dept44.*
+se.sunet.ati.*
+se.sunet.ati.ladok.*
+se.svt.oss.*
+se.svt.oss.junit5.*
+se.swedenconnect.ca.*
+se.swedenconnect.opensaml.*
+se.swedenconnect.schemas.*
+se.swedenconnect.schemas.cert.*
+se.swedenconnect.schemas.csig.*
+se.swedenconnect.security.*
+se.swedenconnect.signservice.*
+se.swedenconnect.sigval.*
+se.swedenconnect.spring.saml.idp.*
+se.tada.*
+se.tedro.async.*
+se.tedro.maven.plugins.*
+se.telton.core.dependency.*
+se.thinkcode.wait.*
+se.tla.call-catcher.*
+se.transmode.gradle.*
+se.trixon.almond.*
+se.ugli.*
+se.ugli.bigqueue.*
+se.ugli.durian.*
+se.ugli.habanero.*
+se.ugli.habanero.servlet-driver.*
+se.ugli.jocote.*
+se.ugli.modica.*
+se.ugli.pecan.*
+se.ugli.pineapple.*
+se.ugli.ugli-commons.*
+se.uhr.simone.*
+se.unbound.*
+se.uu.it.*
+se.vandmo.*
+se.veritate.*
+se.vgregion.HsaTools.*
+se.vgregion.alfresco-client.*
+se.vgregion.common.*
+se.vgregion.commons-util.*
+se.vgregion.cs-iframe.*
+se.vgregion.daoframework.*
+se.vgregion.ews-services.*
+se.vgregion.healthcare-context.*
+se.vgregion.iFeed.*
+se.vgregion.icc.*
+se.vgregion.icc.sd.authorization.*
+se.vgregion.icc.sd.delegation.*
+se.vgregion.icc.sd.portal.*
+se.vgregion.innovationsslussen-theme.*
+se.vgregion.innovationsslussen.*
+se.vgregion.javg.*
+se.vgregion.javg.maven.archetypes.*
+se.vgregion.javg.maven.plugins.*
+se.vgregion.javg.poc.*
+se.vgregion.javg.poc.schema-versioning.*
+se.vgregion.javg.refsystems.*
+se.vgregion.javg.tools.*
+se.vgregion.liferay-user-associations.*
+se.vgregion.medcontrol.*
+se.vgregion.mobile.*
+se.vgregion.my-usd-issues.*
+se.vgregion.notifications.*
+se.vgregion.oppna-program-account-activation.*
+se.vgregion.oppna-program-account-management.*
+se.vgregion.oppna-program-bookmarks-jsf.*
+se.vgregion.oppna-program-hsatools-mobile-webservice.*
+se.vgregion.oppna-program-navigation.*
+se.vgregion.oppna-program-notessystem.*
+se.vgregion.oppna-program-piwik-tracking.*
+se.vgregion.oppna-program-vap.*
+se.vgregion.paf-web.*
+se.vgregion.pubsubhubbub.*
+se.vgregion.rp-layouttpl-2.*
+se.vgregion.rss-client.*
+se.vgregion.signer-service-schemas.*
+se.vgregion.signer-service.*
+se.vgregion.signer-service.reference-application.*
+se.vgregion.tasklist.*
+se.vgregion.tyck-till.*
+se.vgregion.user-wizard.*
+se.vgregion.vertikala-prioriteringar.*
+se.vgregion.vgr-custom-jsp-hook.*
+se.vgregion.vgr-layouttpl.*
+se.vgregion.vgr-rp-theme.*
+se.vgregion.vgr-rp-theme2.*
+se.vgregion.webbisar.*
+se.walkercrou.*
+se.warting.billy.*
+se.warting.datepicker.*
+se.warting.firebase-compose.*
+se.warting.in-app-update.*
+se.warting.permissionsui.*
+se.warting.signature.*
+se.weightpoint.datanucleus.*
+se.wfh.libs.*
+se.wfh.libs.common.*
+se.wfh.tools.*
+se.wollan.*
+securityfilter.*
+servicemix.*
+services.tangxin.mysqls.*
+services.videa.*
+servletapi.*
+servlets.com.*
+setpoint.*
+sfx4j.*
+sg.dex.*
+sg.enixsoft.*
+sh.almond.*
+sh.almond.tmp.ammonite.*
+sh.bader.common.*
+sh.blake.niouring.*
+sh.brocode.*
+sh.christian.aaraar.*
+sh.christian.ozone.*
+sh.christian.ozone.generator.*
+sh.den.*
+sh.joinery.*
+sh.jove.*
+sh.jove.sbt.*
+sh.locus.*
+sh.locus.common.*
+sh.locus.lotr.*
+sh.loggy.*
+sh.nerd.*
+sh.ory.*
+sh.ory.hydra.*
+sh.ory.keto.*
+sh.ory.kratos.*
+sh.ory.oathkeeper.*
+sh.platform.*
+sh.platform.archetype.*
+sh.props.*
+sh.stein.*
+sh.tak.appbundler.*
+sh.tyy.*
+sh.vcm.sensiblelogging.*
+shocks.*
+shop.itbug.mdddj.*
+show.lmm.*
+si.inova.*
+si.inova.kotlinova.*
+si.kobalj.utilities.*
+si.poponline.*
+si.slotex.nlp.*
+si.trina.*
+si.uom.*
+si.urbas.*
+sillyexceptions.*
+simple-jms.*
+simple-jndi.*
+site.chenwei.data.*
+site.dungang.*
+site.dunhanson.*
+site.dunhanson.ocr.*
+site.dunhanson.redis.*
+site.dunhanson.utils.*
+site.gutschi.*
+site.hanschen.*
+site.heaven96.*
+site.hellooo.*
+site.howaric.*
+site.kason.*
+site.kason.kalang.*
+site.lanmushan.*
+site.littlehands.ncmapi.*
+site.lizhivscaomei.*
+site.morn.*
+site.morn.boot.*
+site.morn.framework.*
+site.peaklee.framework.*
+site.qiuyuan.*
+site.qiuyuan.library.*
+site.sorghum.*
+site.sorghum.anno.*
+site.sorghum.easy-join.*
+site.sorghum.feignless.*
+site.sorghum.sorghum-plugin.*
+site.srht.hutzdog.*
+site.tanghy.*
+site.tanghy.oss.*
+site.wentailai.example.*
+site.ybwrp.ubms.*
+site.ycsb.*
+site.zfei.*
+site.zido.*
+sk.32bit.*
+sk.annotation.library.jam.*
+sk.annotation.projects.signito.*
+sk.demtec.neo4j.*
+sk.gbox.swing.*
+sk.lukasvasek.*
+sk.mlobb.*
+sk.objectify.*
+sk.openhouse.*
+sk.seges.acris.*
+sk.seges.corpis.*
+sk.seges.sesam.*
+sk.softwave.*
+sk.teamsoft.*
+sk.tuke.yajco.*
+sk.uniq.protobuf.*
+sk.upjs.*
+sk.upjs.jpaz2.archetypes.*
+sk.upjs.paz.*
+sk.upjs.zirro.*
+skaringa.*
+ski.chrzanow.*
+ski.gagar.*
+ski.gagar.vxutil.*
+skinlf.*
+slide.*
+smartrics.iotics.*
+smartrics.restfixture.*
+sn.sonatel.api.*
+so.dang.cool.*
+so.dang.cool.clobar.*
+so.kciter.*
+so.macalu.*
+soap.*
+social.midas.*
+software.amazon.*
+software.amazon.ai.*
+software.amazon.appflow.*
+software.amazon.aps.*
+software.amazon.aws.clients.swf.flux.*
+software.amazon.awscdk.*
+software.amazon.awsconstructs.*
+software.amazon.awssdk.*
+software.amazon.awssdk.crt.*
+software.amazon.awssdk.iotdevicesdk.*
+software.amazon.awsssmchaosrunner.*
+software.amazon.c3r.*
+software.amazon.checkerframework.*
+software.amazon.cloudformation.*
+software.amazon.cloudwatchlogs.*
+software.amazon.codeguruprofiler.*
+software.amazon.cryptography.*
+software.amazon.cryptools.*
+software.amazon.dax.*
+software.amazon.disco.*
+software.amazon.documentdb.jdbc.*
+software.amazon.encryption.s3.*
+software.amazon.event.ruler.*
+software.amazon.eventstream.*
+software.amazon.freertos.*
+software.amazon.glue.*
+software.amazon.halo.*
+software.amazon.ion.*
+software.amazon.jdbc.*
+software.amazon.jsii.*
+software.amazon.kinesis.*
+software.amazon.konstruk.*
+software.amazon.lambda.*
+software.amazon.lambda.snapstart.*
+software.amazon.lynx.*
+software.amazon.msk.*
+software.amazon.neptune.*
+software.amazon.nio.s3.*
+software.amazon.opentelemetry.*
+software.amazon.pay.*
+software.amazon.payloadoffloading.*
+software.amazon.profiler.*
+software.amazon.qldb.*
+software.amazon.randomcutforest.*
+software.amazon.rdsdata.*
+software.amazon.sagemaker.featurestore.*
+software.amazon.serverless.*
+software.amazon.smithy.*
+software.amazon.smithy.dafny.*
+software.amazon.smithy.kotlin.*
+software.amazon.smithy.ruby.*
+software.amazon.smithy.typescript.*
+software.amazon.sns.*
+software.amazon.textract.idp.*
+software.amazon.timestream.*
+software.aws.*
+software.aws.awsprototypingsdk.*
+software.aws.chimesdk.*
+software.aws.jsiisamples.java.*
+software.aws.jsiisamples.jsii.*
+software.aws.mcs.*
+software.aws.rds.*
+software.aws.solution.*
+software.aws.toolkits.*
+software.betamax.*
+software.coley.*
+software.committed.*
+software.constructs.*
+software.coolstuff.*
+software.crldev.*
+software.egger.*
+software.fitz.*
+software.hoegg.mule.*
+software.kes.*
+software.mandal.encoding.*
+software.momento.java.*
+software.nealk.*
+software.nectar.java.*
+software.pando.crypto.*
+software.plusminus.*
+software.purpledragon.*
+software.purpledragon.xml.*
+software.reinvent.*
+software.reloadly.*
+software.sandc.labs.*
+software.sham.*
+software.tingle.*
+software.tnb.*
+software.uncharted.salt.*
+software.uncharted.sparkpipe.*
+software.uncharted.sparkplug.*
+software.uncharted.splog.*
+software.visionary.*
+software.visionary.serialization.*
+software.xdev.*
+soimp.*
+solar.squares.*
+solarisrealm.*
+solutions.a2.kafka.*
+solutions.a2.oracle.*
+solutions.bismi.excel.*
+solutions.bkit.*
+solutions.deepfield.*
+solutions.elevation.camel.*
+solutions.fluidity.*
+solutions.iog.*
+solutions.linked.*
+solutions.rty.*
+solutions.siren.*
+solutions.tveit.nissanconnect.*
+solutions.viae.*
+solutions.xivo.*
+space.arim.dazzleconf.*
+space.arim.injector.*
+space.arxode.*
+space.chensheng.wechatty.*
+space.chensheng.wsmessenger.*
+space.controlnet.*
+space.crickets.*
+space.dector.tuyalib.*
+space.divergence.*
+space.game.gswallet.opensdk.*
+space.glome.*
+space.inevitable.*
+space.iseki.bencoding.*
+space.iseki.cmdpipe.*
+space.iseki.envproxyselector.*
+space.iseki.hashutil.*
+space.iseki.maven.pom.*
+space.iseki.strings.*
+space.jasan.*
+space.jooflint.*
+space.kscience.*
+space.kscience.gradle.js.*
+space.kscience.gradle.jvm.*
+space.kscience.gradle.mpp.*
+space.kscience.gradle.project.*
+space.lingu.fiesta.*
+space.lingu.light.*
+space.maxus.*
+space.scalapatisserie.*
+space.spacelift.*
+space.spulsar.*
+space.tanghy.*
+space.testflight.*
+space.thedocking.infinitu.*
+space.traversal.kapsule.*
+space.tscg.*
+space.tscg.common.*
+space.vector.*
+space.vectrix.flare.*
+space.vectrix.ignite.*
+space.wuxu.*
+space.yizhu.*
+speexx.*
+spice.*
+spring.*
+springframework.*
+springmodules.*
+sqlline.*
+srl.forge.*
+sshtools.*
+sslext.*
+st.alzo.*
+st.digitru.*
+st.extreme.*
+st.lowlevel.*
+st.tks.*
+st.tks.cdk.*
+stapler.*
+statcvs.*
+stax-utils.*
+stax.*
+store.galaxy.sample.*
+store.galaxy.samsung.installreferrer.*
+store.idragon.tool.*
+store.javac.fyutil.*
+store.jesframework.*
+store.kalvan.framework.*
+store.kalvan.gateway.*
+store.kalvan.platform.*
+store.shimo.*
+store.sophi.xjr.*
+store.taotao.docbook.*
+store.taotao.docbook.archetypes.*
+stratum.*
+stream.alwaysbecrafting.*
+stream.nebula.*
+stream.scotty.*
+struts-menu.*
+struts.*
+strutstestcase.*
+studio.clapp.*
+studio.crud.crudframework.*
+studio.crud.feature.*
+studio.forface.*
+studio.jfcoder.*
+studio.lunabee.compose.*
+studio.pokkbaby.*
+studio.pokkbaby.kotlinknifer.*
+studio.raptor.*
+studio.wetrack.*
+stxx.*
+su.boleyn.oj.*
+su.boleyn.urlshortener.*
+su.izotov.*
+su.litvak.chromecast.*
+su.lychee.*
+su.nlq.*
+su.pernova.*
+su.piskun.exlib.*
+subpersistence.*
+subshell.*
+suiterunner.*
+surefire.*
+swarmcache.*
+swt.*
+systems.aesel.*
+systems.bos.*
+systems.composable.*
+systems.crigges.*
+systems.danger.*
+systems.dennis.*
+systems.dmx.*
+systems.fehn.*
+systems.furdei.*
+systems.kuu.*
+systems.manifold.*
+systems.microservice.*
+systems.opalia.*
+systems.ora.*
+systems.reformcloud.reformcloud2.*
+systems.speedy.time.*
+systems.uom.*
+sysunit.*
+tablelayout.*
+tagalog.*
+tagishauth.*
+taglibrarydoc.*
+taglibs.*
+tagsoup.*
+tambora.*
+tanukisoft.*
+tapestry.*
+tclib.*
+team.bangbang.*
+team.codemonsters.*
+team.duckie.quack.*
+team.duckie.quackquack.aide.*
+team.duckie.quackquack.animation.*
+team.duckie.quackquack.bom.*
+team.duckie.quackquack.casa.*
+team.duckie.quackquack.material.*
+team.duckie.quackquack.runtime.*
+team.duckie.quackquack.sugar.*
+team.duckie.quackquack.ui.*
+team.duckie.quackquack.util.*
+team.fastflow.kusu.*
+team.flint.*
+team.quad.*
+team.razz.eva.*
+team.yi.gradle.plugin.*
+team.yi.jacksync.*
+team.yi.ktor.*
+team.yi.maven.plugin.*
+team.yi.rsql.*
+team.yi.tools.*
+tec.units.*
+tec.uom.*
+tec.uom.domain.*
+tec.uom.impl.*
+tec.uom.lib.*
+tech.abd3lraouf.*
+tech.aegean.*
+tech.aegean.next.*
+tech.aiq.*
+tech.alexib.*
+tech.allegro.schema.json2avro.*
+tech.alyz.*
+tech.amwal.auth.*
+tech.amwal.justpassme.*
+tech.amwal.payment.*
+tech.anima.*
+tech.ant8e.*
+tech.antibytes.kfixture.*
+tech.antibytes.kmock.*
+tech.antibytes.kmock.kmock-gradle.*
+tech.arauk.ark.*
+tech.aroma.*
+tech.aroma.banana.*
+tech.b180.cordaptor.*
+tech.backwards.*
+tech.bam.*
+tech.bam.alpha-movie.*
+tech.bam.kstate.*
+tech.barbero.http-messages-signing.*
+tech.becoming.*
+tech.beepbeep.*
+tech.beshu.ror.*
+tech.bilal.*
+tech.bitey.*
+tech.bitstwinkle.jelly.*
+tech.blueglacier.*
+tech.carcadex.*
+tech.carpentum.sdk.payment.java.*
+tech.cassandre.trading.bot.*
+tech.catheu.*
+tech.clickhouse.*
+tech.codingless.*
+tech.codingzen.*
+tech.coinbub.*
+tech.coner.crispyfish.*
+tech.coner.snoozle.*
+tech.cryptonomic.*
+tech.dbgsoftware.easyrest.*
+tech.decentro.in.collections.*
+tech.decentro.in.kyc.*
+tech.deepdreams.*
+tech.deplant.commons.*
+tech.deplant.java4ever.*
+tech.deplant.javapoet.*
+tech.dev-scion.*
+tech.dolch.plantarch.*
+tech.energyit.*
+tech.epic-breakfast-productions.openQuarterMaster.lib.*
+tech.fanlinglong.common.*
+tech.favware.*
+tech.feldman.forgekt.*
+tech.ferus.*
+tech.ferus.util.*
+tech.figure.*
+tech.figure.aggregate.*
+tech.figure.approval.member.group.*
+tech.figure.block.*
+tech.figure.classification.asset.*
+tech.figure.coroutines.*
+tech.figure.eventstream.*
+tech.figure.hdwallet.*
+tech.figure.objectstore.gateway.*
+tech.figure.spec.*
+tech.figure.validationoracle.*
+tech.fika.macaron.*
+tech.firas.framework.*
+tech.fullink.sdk.*
+tech.generated.*
+tech.ghenkle.*
+tech.gklijs.bkes.*
+tech.grasshopper.*
+tech.greenfield.*
+tech.guanli.boot.suite.*
+tech.guazi.base.*
+tech.guazi.com.*
+tech.guazi.com.mipushcollect.*
+tech.gujin.*
+tech.gusavila92.*
+tech.guyi.component.*
+tech.guyi.ipojo.*
+tech.guyi.web.quick.*
+tech.harmonysoft.*
+tech.hdis.*
+tech.heartin.starters.*
+tech.hiddenproject.*
+tech.hiddenproject.compaj.*
+tech.hillview.*
+tech.hljzj.framework.*
+tech.hokkaydo.*
+tech.huffman.re-retrying.*
+tech.ibit.*
+tech.iboot.*
+tech.ignission.*
+tech.ikora.*
+tech.inner.*
+tech.iooo.boot.*
+tech.iooo.coco.*
+tech.iooo.maven.archetypes.*
+tech.iscanner.*
+tech.iscanner.iscanner.*
+tech.javajefe.*
+tech.jhipster.*
+tech.jhipster.lite.*
+tech.justagod.*
+tech.justen.concord.*
+tech.kmsys.*
+tech.koolnano.generic1.*
+tech.kronicle.*
+tech.legislate.*
+tech.linbox.*
+tech.linqu.webpb.*
+tech.lisza.*
+tech.lity.rea.*
+tech.magratheaai.*
+tech.mamontov.blackradish.*
+tech.mervyn.*
+tech.mgl.*
+tech.mhuang.*
+tech.mhuang.pacebox.*
+tech.miam.sdk.*
+tech.mlsql.*
+tech.mlsql.api.jdbc.*
+tech.mlsql.byzer-client-sdk.*
+tech.mlsql.serviceframework.baseweb.*
+tech.moheng.*
+tech.molecules.*
+tech.msop.*
+tech.navicore.*
+tech.neander.*
+tech.neokred.*
+tech.neokred.plus.*
+tech.nimbbl.*
+tech.nimbbl.sdk.*
+tech.nodex.*
+tech.ordinaryroad.*
+tech.ordinaryroad.bilibili.live.*
+tech.orkestra.*
+tech.oxymen.seaweedfs.*
+tech.pantheon.triemap.*
+tech.paranoidandroid.*
+tech.pardus.*
+tech.petrepopescu.logging.*
+tech.picnic.*
+tech.picnic.error-prone-support.*
+tech.picnic.jolo.*
+tech.picnic.reactive-support.*
+tech.polivakha.maven.*
+tech.powerjob.*
+tech.pronghorn.*
+tech.pylons.*
+tech.pylons.lib.*
+tech.pylons.recipetool.*
+tech.raaf.*
+tech.rebb.val.*
+tech.redroma.aroma.*
+tech.redroma.google.*
+tech.redroma.yelp.*
+tech.regiment.*
+tech.relaycorp.*
+tech.rocketwave.*
+tech.rsqn.*
+tech.rsqn.cdsl.*
+tech.rsqn.reflection-helpers.*
+tech.rsqn.simple-cluster-utilities.*
+tech.rsqn.streams.*
+tech.rsqn.useful-things.*
+tech.sarahgallitz.*
+tech.scanto.*
+tech.schoolhelper.*
+tech.scoundrel.*
+tech.scut.*
+tech.seltzer.*
+tech.sightseeing.*
+tech.simter.*
+tech.simter.id.*
+tech.simter.kv.*
+tech.simter.operation.*
+tech.simter.reactive.*
+tech.sirwellington.alchemy.*
+tech.sirwellington.decorice.*
+tech.skot.*
+tech.skot.app.*
+tech.skot.feature.*
+tech.skot.general.*
+tech.skot.libraries.sk-map.*
+tech.skot.libraries.sk-phone.*
+tech.skot.libraries.sk-scanner.*
+tech.skot.libraries.sk-security.*
+tech.skot.libraries.sk-tabbar.*
+tech.skot.libraries.sk-video.*
+tech.skot.library-contract.*
+tech.skot.library-viewlegacy.*
+tech.skot.library.*
+tech.skot.model.*
+tech.skot.modelcontract.*
+tech.skot.starter.*
+tech.skot.tools.*
+tech.skot.viewcontract.*
+tech.skot.viewlegacy.*
+tech.skot.viewmodel.*
+tech.sobin.*
+tech.sollabs.*
+tech.sourced.*
+tech.sparse.*
+tech.spiro.*
+tech.sqlclub.*
+tech.storezhang.*
+tech.stormfox.*
+tech.streamsoft.*
+tech.sud.mgp.*
+tech.tablesaw.*
+tech.testnx.cah.*
+tech.thdev.*
+tech.toparvion.*
+tech.touchbiz.*
+tech.touchbiz.ai.*
+tech.touchbiz.starter.*
+tech.tuister.*
+tech.ugma.customcomponents.*
+tech.units.*
+tech.uom.*
+tech.uom.domain.*
+tech.uom.impl.*
+tech.uom.lib.*
+tech.utsmankece.*
+tech.valinaa.boot.*
+tech.vbu.kvnr.*
+tech.veedo.plugins.*
+tech.wetech.mybatis.*
+tech.xiaoxian.*
+tech.xiaoxian.aliyun.*
+tech.xiaoxian.wework.*
+tech.xigam.*
+tech.xirius.*
+tech.xixing.sync.*
+tech.xujian.*
+tech.ydb.*
+tech.ydb.auth.*
+tech.ydb.test.*
+tech.yixiyun.framework.*
+tech.ynfy.*
+tech.ytsaurus.*
+tech.ytsaurus.spark.*
+tech.zccc.*
+tech.zool.*
+technology.dice.open.*
+technology.integration.amazonservices.mws.*
+technology.semi.weaviate.*
+technology.tabula.*
+technology.transceptor.*
+technology.yiss.kotlin.*
+technology.zeroalpha.security.*
+tel.panfilov.maven.*
+tel.schich.*
+tel.schich.kognigy.*
+textarea.*
+tf.bug.*
+tf.tofu.*
+th.co.geniustree.*
+th.co.geniustree.springdata.jpa.*
+th.co.rabbit.*
+th.co.sic.module.*
+th.in.lordgift.*
+th.or.nectec.*
+thaiopensource.*
+tiffrenderer.*
+tjdo.*
+tk.booky.*
+tk.devrt.*
+tk.fishfish.*
+tk.foundationdriven.*
+tk.hongkailiu.*
+tk.hongkailiu.test-java.*
+tk.hongkailiu.test-scala.*
+tk.hongkailiu.test.*
+tk.jamun.*
+tk.jamun.elements.*
+tk.jamun.ui.*
+tk.jamunx.ui.*
+tk.jfree.summer.*
+tk.jomp16.*
+tk.k2zinger.*
+tk.labyrinth.*
+tk.labyrinth.jaap.*
+tk.labyrinth.pandora.*
+tk.memin.*
+tk.mybatis.*
+tk.mygod.*
+tk.ngrok4j.*
+tk.nrktkt.*
+tk.okou.*
+tk.plogitech.*
+tk.pratanumandal.*
+tk.qcsoft.angelos.*
+tk.skuro.*
+tk.skuro.alfresco.*
+tk.skuro.spring.surf.clojure.*
+tk.sneps.utils.*
+tk.trebolsoft.athena.*
+tk.yaxin.*
+tk.zhzephi.*
+tk.zielony.*
+tl.lin.*
+tmporb.*
+to.etc.domui.*
+to.idemo.*
+to.lova.flow.*
+to.lova.humanize.*
+to.lova.jaxrs.*
+to.lova.peers.*
+to.sparks.*
+to.then.*
+tokyo.baseballyama.*
+tokyo.northside.*
+tokyo.peya.lib.*
+tomcat.*
+tonic.*
+tools.aqua.*
+tools.bespoken.*
+tools.bestquality.*
+tools.caroline.*
+tools.cipher.*
+tools.devnull.*
+tools.devnull.kodo.*
+tools.dynamia.*
+tools.dynamia.chartjs.*
+tools.dynamia.modules.*
+tools.dynamia.reports.*
+tools.dynamia.themes.*
+tools.dynamia.zk.addons.*
+tools.fastlane.*
+tools.hone.android.*
+tools.hyperdrive.build-setup.*
+tools.hyperdrive.subspace.*
+tools.kaja.*
+tools.mdsd.*
+tools.nuv.*
+tools.profiler.*
+tools.samt.*
+tools.trident.apps.*
+tools.vitruv.*
+tools.xor.*
+top.aeizzz.*
+top.aexp.*
+top.agno.*
+top.agno.gnosis.*
+top.alertcode.*
+top.alexgaoyh.*
+top.anagke.*
+top.andoudou.*
+top.angelina-bot.*
+top.applocalize.plugin.*
+top.appx.*
+top.appx.tmaven.*
+top.appx.zutil.*
+top.arkstack.*
+top.bayberry.*
+top.bayberry.springboot.stater.*
+top.beanshell.*
+top.bekit.*
+top.bettercode.wechat.*
+top.bjbt-dialup.*
+top.bluesword.*
+top.brightk.*
+top.canyie.pine.*
+top.changelife.*
+top.chaser.*
+top.chaser.framework.*
+top.cheesetree.btx.common.*
+top.cheesetree.btx.framework.*
+top.cheesetree.btx.framework.database.*
+top.cheesetree.btx.framework.security.*
+top.cheesetree.btx.project.*
+top.cheesetree.btx.project.archetype.*
+top.cheesetree.btx.project.scheduler.*
+top.chenat.*
+top.chenyanjin.*
+top.chukongxiang.*
+top.clearplume.*
+top.cloudli.*
+top.code2life.*
+top.codef.*
+top.codewood.wx.*
+top.codings.*
+top.colman.embeddedfirestore.*
+top.colman.simplecpfvalidator.*
+top.colter.*
+top.colter.skiko.*
+top.coos.*
+top.cptl.*
+top.crossoverjie.opensource.*
+top.csaf.*
+top.dataframe.*
+top.dcenter.*
+top.devforma.*
+top.devgo.*
+top.dianay.*
+top.dlovet.wanandroid.*
+top.dogtcc.*
+top.dogtcc.database.*
+top.dogtcc.database.spring.*
+top.dogtcc.intercept.*
+top.dogtcc.message.*
+top.dogtcc.serialize.*
+top.doufei.appupdate.*
+top.e404.*
+top.easyboot.core.*
+top.eocs.*
+top.ezadmin.*
+top.fangwenmagician.*
+top.fanua.doctor.*
+top.fastsql.*
+top.focess.*
+top.fullj.*
+top.fullj.font.*
+top.fzqblog.*
+top.gabin.*
+top.gink.*
+top.goodz.*
+top.gotoeasy.*
+top.greatfeng.plugin.*
+top.guokaicn.*
+top.heiha.huntun.*
+top.hendrixshen.magiclib.*
+top.hequehua.*
+top.heue.log.*
+top.heue.utils.*
+top.hisoft.log.*
+top.hisoft.swagger.security.*
+top.hmtools.*
+top.hnyufushan.*
+top.hserver.*
+top.iails.*
+top.ibase4j.*
+top.infra.*
+top.infra.cloud-ready.*
+top.infra.maven.*
+top.infra.maven.wagon.*
+top.isopen.commons.*
+top.isopen.commons.springboot.*
+top.iteratefast.*
+top.jasonkayzk.*
+top.javagame.*
+top.javap.aurora.*
+top.javap.hermes.*
+top.javatool.*
+top.javatool.fileuplod.*
+top.jfunc.common.*
+top.jfunc.cron.*
+top.jfunc.dfs.*
+top.jfunc.json.*
+top.jfunc.network.*
+top.jfunc.report.*
+top.jfunc.validation.*
+top.jfunc.websocket.*
+top.jfunc.weixin.*
+top.jiangqiang.crawler.*
+top.jiaojinxin.*
+top.jlpan.*
+top.jshanet.scorpio.*
+top.jyannis.*
+top.kikt.*
+top.kirbyhao.*
+top.kiswich.*
+top.klw8.alita.*
+top.klw8.alita.dubbodoc.*
+top.kmar.game.*
+top.ko8e24.*
+top.kpromise.*
+top.lctr.*
+top.leafage.*
+top.legendscloud.*
+top.lieder.*
+top.limbang.*
+top.lingkang.*
+top.lishuoboy.*
+top.liu9695.networkmonitor.*
+top.liujingyanghui.*
+top.liyf.*
+top.logbug.sni.*
+top.logbug.wordreport.*
+top.lrshuai.encryption.*
+top.lshaci.*
+top.luanyu.*
+top.lvtao.*
+top.lww0511.*
+top.magicpotato.*
+top.mangues.*
+top.mankin.*
+top.marchand.archetype.*
+top.marchand.cli.*
+top.marchand.cp.*
+top.marchand.java.env.*
+top.marchand.java.utils.*
+top.marchand.maven.*
+top.marchand.oxygen.*
+top.marchand.xml.*
+top.marchand.xml.ext-funct.*
+top.marchand.xml.libraries.*
+top.marchand.xml.maven.*
+top.marchand.xml.saxon.extension.*
+top.meethigher.*
+top.memfactory.*
+top.microiot.*
+top.microworld.*
+top.mindse.*
+top.minepay.*
+top.minwk.*
+top.miraijavaeasy.*
+top.mrxiaom.*
+top.mstudy.*
+top.naivete.framework.*
+top.naivete.framework.schedule.*
+top.netkit.*
+top.netkit.starter.*
+top.newleaf.*
+top.nkdark.*
+top.onceio.*
+top.oneyoung.*
+top.opensmile.*
+top.openyuan.*
+top.ourfor.*
+top.plong.*
+top.plutoppppp.*
+top.populus.*
+top.potens.*
+top.potens.jnet.*
+top.qinbaowei.*
+top.qingxing.*
+top.rabbiter.*
+top.rainrem.*
+top.rdongyue.*
+top.redscorpion.*
+top.redscorpion.api.*
+top.redscorpion.boot.*
+top.redscorpion.generator.*
+top.redscorpion.means.*
+top.remember5.*
+top.remliyx.dbeasy.*
+top.rizon.*
+top.roothk.message.*
+top.rwocj.*
+top.sanguohf.egg.*
+top.sdzhiot.*
+top.seddd.*
+top.senseiliu.*
+top.shareall.*
+top.shjibi.*
+top.softnepo.*
+top.spoofer.*
+top.spring-data-jpa.*
+top.ssrsdev.*
+top.starsea.*
+top.sulpures.*
+top.summerboot.*
+top.tangyh.basic.*
+top.tanmw.*
+top.thinkin.*
+top.thinkin.kitdb.*
+top.todev.ding.*
+top.todev.tool.*
+top.totalo.*
+top.trumandu.*
+top.ug666.*
+top.verytouch.vkit.*
+top.verytouch.vkit.samples.*
+top.vihacker.*
+top.wboost.*
+top.wdcc.*
+top.wdsf.*
+top.webdevelop.gull.*
+top.weihuazhou.*
+top.wsure.*
+top.wu2020.*
+top.wuyongshi.*
+top.xcore.*
+top.xcphoenix.*
+top.xiajibagao.*
+top.xiqiu.*
+top.xserver.*
+top.xskr.*
+top.xtcoder.*
+top.xtijie.rcondevframework.*
+top.xuegao-tzx.*
+top.xystudio.apishield.*
+top.xzxsrq.*
+top.yatt.dfargx.*
+top.yatt.lightcall.*
+top.yonyong.*
+top.yoohome.*
+top.youlanqiang.*
+top.youlanqiang.alphajson.*
+top.yqingyu.*
+top.yumbo.excel.*
+top.yumbo.music.*
+top.yuzhyn.*
+top.zackyoung.*
+top.zaiyang.satoken.jwt.*
+top.zeimao77.*
+top.zenyoung.*
+top.zgod.sqlupdatecheck.*
+top.zhogjianhao.*
+top.zhouxiaoxiang.*
+top.zhuangjinxin.*
+top.zhubaiju.*
+top.zopx.*
+top.zrbcool.*
+top.zuoyu.mybatis.*
+top.zz6628.*
+top.zzspace.zzlock.*
+toplink.essentials.*
+torque.*
+tr.com.arcelik.*
+tr.com.infumia.*
+tr.com.inventiv.*
+tr.com.inventiv.multipaysdk.*
+tr.com.lucidcode.*
+tr.com.mantis.keycloak.*
+tr.com.mobilex.*
+tr.com.obss.sdlc.archetype.*
+tr.com.obss.sdlc.pom.*
+tr.com.terrayazilim.commons.*
+tr.com.terrayazilim.core.*
+tr.com.terrayazilim.geometry.*
+tr.com.terrayazilim.gjson.*
+tr.com.terrayazilim.json.*
+tr.com.terrayazilim.kafkas.mq.chat.*
+tr.com.terrayazilim.kartal.*
+tr.com.terrayazilim.leaflet.jsf.*
+tr.com.terrayazilim.logging.*
+tr.com.terrayazilim.nt.api.*
+tr.com.terrayazilim.nt.client.*
+tr.com.terrayazilim.tms.*
+tr.com.terrayazilim.umay.*
+tr.com.terrayazilim.vts.client.*
+tr.com.tokenpay.*
+tr.com.turkcellteknoloji.turkcellupdater.*
+traer.physics.*
+trail-taglib.*
+tranql.*
+travel.izi.*
+travel.izi.api.*
+travel.liteapi.*
+travel.wink.*
+trove.*
+trust.nccgroup.*
+turbine.*
+tv.blademaker.*
+tv.bodil.*
+tv.brid.sdk.*
+tv.cntt.*
+tv.hd3g.*
+tv.hd3g.commons.*
+tv.hd3g.mvnplugin.*
+tv.kazu.*
+tv.loilo.pdf.*
+tv.loilo.promise.*
+tv.lycam.*
+tv.mycujoo.*
+tv.mycujoo.mcls.*
+tv.mycujoo.mls.*
+tv.wunderbox.*
+tw.cheyingwu.*
+tw.com.ecpay.*
+tw.com.ehanlin.*
+tw.com.lig.*
+tw.com.mitake.*
+tw.com.oneup.www.*
+tw.com.softleader.data.*
+tw.com.softleader.data.jakarta.*
+tw.edu.ntu.csie.*
+tw.edu.sju.ee.eea.*
+tw.edu.sju.ee.eea.commons.*
+tw.edu.sju.ee.eea.jni.*
+tw.hyl.common.*
+tw.kewang.*
+tw.lifehackers.*
+tw.purple.*
+tw.teddysoft.ezddd.*
+tw.teddysoft.ezspec.*
+tw.teddysoft.ucontract.*
+tw.yukina.notion.sdk.*
+tyrex.*
+tz.co.asoft.*
+tz.co.asoft.applikation.*
+tz.co.asoft.deploy.*
+tz.co.asoft.library.*
+ua.brander.core.*
+ua.co.gravy.archetype.*
+ua.co.gravy.util.*
+ua.co.k.*
+ua.co.ur6lad.*
+ua.com.crosp.solutions.library.*
+ua.com.gfalcon.*
+ua.com.lavi.*
+ua.com.lavi.imagehash.*
+ua.com.lavi.ktor-resilient.*
+ua.gradsoft.*
+ua.in.dej.*
+ua.mobius.media.*
+ua.mobius.media.client.*
+ua.mobius.media.codecs.*
+ua.mobius.media.controls.*
+ua.mobius.media.hardware.*
+ua.mobius.media.io.*
+ua.mobius.media.resources.*
+ua.net.nlp.*
+ua.net.tokar.*
+ua.org.sands.*
+ua.pl.mik.*
+ua.pp.fland.web.*
+ua.pp.ihorzak.*
+ua.pp.msk.gradle.*
+ua.pp.msk.maven.*
+ua.profitsoft.social.*
+ua.t3hnar.io.*
+uaihebert.com.*
+ubique.*
+ug.co.intelworld.*
+ug.sparkpl.*
+uispec4j.*
+uk.ac.abdn.*
+uk.ac.bolton.*
+uk.ac.cam.automation.*
+uk.ac.cam.ch.opsin.*
+uk.ac.cam.ch.wwmm.*
+uk.ac.cam.ch.wwmm.oscar.*
+uk.ac.cam.cl.dtg.teaching.*
+uk.ac.cam.cl.dtg.web.*
+uk.ac.ceh.*
+uk.ac.ceh.components.*
+uk.ac.ceh.gateway.*
+uk.ac.diamond.*
+uk.ac.ebi.beam.*
+uk.ac.ebi.brain.*
+uk.ac.ebi.ddi.*
+uk.ac.ebi.ddi.api.readers.*
+uk.ac.ebi.ddi.arrayexpress.*
+uk.ac.ebi.ddi.expressionatlas.*
+uk.ac.ebi.ddi.maven.*
+uk.ac.ebi.ddi.social.*
+uk.ac.ebi.ddi.task.*
+uk.ac.ebi.ena.*
+uk.ac.ebi.ena.sequence.*
+uk.ac.ebi.ena.sra.*
+uk.ac.ebi.ena.taxonomy.*
+uk.ac.ebi.fg.annotare2.*
+uk.ac.ebi.gxa.*
+uk.ac.ebi.interpro.scan.*
+uk.ac.ebi.mydas.*
+uk.ac.ebi.smsd.*
+uk.ac.ebi.tsc.aap.client.*
+uk.ac.ebi.uniprot.*
+uk.ac.ed.cyphsem.*
+uk.ac.ed.ph.asciimath.*
+uk.ac.ed.ph.jacomax.*
+uk.ac.gate.*
+uk.ac.gate.libraries.*
+uk.ac.gate.mimir.*
+uk.ac.gate.plugins.*
+uk.ac.gla.dcs.terrierteam.*
+uk.ac.horizon.artcodes.*
+uk.ac.liv.pgb.*
+uk.ac.mmu.tdmlab.journalism.*
+uk.ac.mmu.tdmlab.uima.*
+uk.ac.nactem.*
+uk.ac.nactem.argo.*
+uk.ac.nactem.argo.components.*
+uk.ac.nactem.argo.typesystems.*
+uk.ac.nactem.tools.*
+uk.ac.nactem.uima.*
+uk.ac.ncl.intbio.*
+uk.ac.open.kmi.iserve.*
+uk.ac.open.kmi.msm4j.*
+uk.ac.open.kmi.test-collections.*
+uk.ac.ox.ctl.*
+uk.ac.ox.it.canvas.*
+uk.ac.ox.it.lti.*
+uk.ac.ox.it.ords.*
+uk.ac.ox.micron.*
+uk.ac.rdg.resc.*
+uk.ac.shef.dcs.*
+uk.ac.starlink.*
+uk.ac.sussex.gdsc.*
+uk.ac.uea.cmp.spectre.*
+uk.ac.wellcome.*
+uk.adbsalam.snapit.*
+uk.bandev.*
+uk.bl.wa.bitwiser.*
+uk.bl.wa.discovery.*
+uk.bl.wa.memento.*
+uk.bl.wa.sentimentalj.*
+uk.bl.wa.warc-explorer.*
+uk.bl.wa.whois.*
+uk.bot-by.*
+uk.bot-by.3wa.*
+uk.bot-by.ip-address.*
+uk.bot-by.maven-plugin.*
+uk.camsw.*
+uk.camsw.rx.*
+uk.camsw.smc.*
+uk.co.4ng.*
+uk.co.a1dutch.*
+uk.co.a1dutch.zipper.*
+uk.co.adaptivelogic.*
+uk.co.alexbroadbent.*
+uk.co.andrewreed.*
+uk.co.androidalliance.*
+uk.co.appministry.*
+uk.co.armedpineapple.innoextract.*
+uk.co.automatictester.*
+uk.co.autotrader.*
+uk.co.baconi.*
+uk.co.baconi.secure.*
+uk.co.baconi.substeps.*
+uk.co.barbuzz.*
+uk.co.binarytemple.*
+uk.co.bithatch.*
+uk.co.blackpepper.*
+uk.co.blackpepper.bowman.*
+uk.co.blackpepper.common.*
+uk.co.blackpepper.support.*
+uk.co.bluedust.*
+uk.co.boundedbuffer.*
+uk.co.breandanh.public.*
+uk.co.brightec.kbarcode.*
+uk.co.brunella.qof.*
+uk.co.bssd.*
+uk.co.buildergenerator.*
+uk.co.caeldev.*
+uk.co.callhandling.*
+uk.co.caprica.*
+uk.co.caprica.thrift.tools.*
+uk.co.chrisjenx.*
+uk.co.chrisjenx.calligraphy.*
+uk.co.chrisjenx.kupnp.*
+uk.co.claritysoftware.*
+uk.co.codera.*
+uk.co.codezen.*
+uk.co.coen.*
+uk.co.compendiumdev.*
+uk.co.crystalmark.*
+uk.co.datumedge.*
+uk.co.deanwild.*
+uk.co.deliverymind.*
+uk.co.deloittedigital.dropwizard.*
+uk.co.deloittedigital.opensource.*
+uk.co.develop4.*
+uk.co.developmentanddinosaurs.*
+uk.co.developmentanddinosaurs.games.dinner.*
+uk.co.divisiblebyzero.tv.*
+uk.co.divisiblebyzero.wordpress.*
+uk.co.drunkendwarf.*
+uk.co.eazycollect.eazysdk.*
+uk.co.electronstudio.jaylib.*
+uk.co.epsilontechnologies.*
+uk.co.evoco.*
+uk.co.faydark.*
+uk.co.firstzero.*
+uk.co.flamingpenguin.jewelcli.*
+uk.co.foonkiemonkey.*
+uk.co.froot.maven.enforcer.*
+uk.co.g7vrd.*
+uk.co.gcwilliams.*
+uk.co.gdickinson.*
+uk.co.gdmrdigital.iiif.image.*
+uk.co.gkola.*
+uk.co.grahamcox.spring-cli.*
+uk.co.gresearch.datafusion.*
+uk.co.gresearch.dgraph.*
+uk.co.gresearch.siembol.*
+uk.co.gresearch.spark.*
+uk.co.hmtt.*
+uk.co.iankent.*
+uk.co.infodataserv.*
+uk.co.innoltd.*
+uk.co.iterator.*
+uk.co.jakebreen.*
+uk.co.jakelee.*
+uk.co.javahelp.fitnesse.*
+uk.co.jemos.maven.plugins.*
+uk.co.jemos.podam.*
+uk.co.jemos.protomak.*
+uk.co.jemos.testing.bedede.*
+uk.co.jhc.*
+uk.co.jmsoft.*
+uk.co.jmsoft.savehandler.*
+uk.co.jordanterry.*
+uk.co.josephearl.foundry.*
+uk.co.jpawlak.*
+uk.co.jpereira.*
+uk.co.justinformatics.*
+uk.co.kiwisoft.*
+uk.co.lucasweb.*
+uk.co.malleusconsulting.magnolia.dependencies.extended.*
+uk.co.malleusconsulting.magnolia.ui.api.availability.*
+uk.co.malleusconsulting.magnolia.ui.form.*
+uk.co.markg.archetypes.*
+uk.co.matbooth.*
+uk.co.matbooth.flatpak.*
+uk.co.matbooth.tycho.extras.*
+uk.co.mgbramwell.geofire.*
+uk.co.modular-it.*
+uk.co.mwtestconsultancy.*
+uk.co.nemstix.*
+uk.co.nichesolutions.*
+uk.co.nichesolutions.logging.log4j.*
+uk.co.nichesolutions.presto.*
+uk.co.odinconsultants.*
+uk.co.odinconsultants.features.*
+uk.co.oldnicksoftware.*
+uk.co.omega-prime.*
+uk.co.openkappa.*
+uk.co.opsb.*
+uk.co.optimisticpanda.*
+uk.co.pacmanvghosts.*
+uk.co.panaxiom.*
+uk.co.paulbenn.*
+uk.co.paulbenn.exilib.*
+uk.co.praguematica.*
+uk.co.probablyfine.*
+uk.co.qorr.*
+uk.co.randomcoding.*
+uk.co.real-logic.*
+uk.co.rgordon.*
+uk.co.ribot.*
+uk.co.ribot.assertj-rx.*
+uk.co.samuelwall.*
+uk.co.seanotoole.*
+uk.co.shastra.hydra.*
+uk.co.slimjimsoftware.*
+uk.co.sltodd.*
+uk.co.smr.*
+uk.co.solong.*
+uk.co.spicule.*
+uk.co.spudsoft.*
+uk.co.stfo.*
+uk.co.suitablysquishy.qspin-engine.*
+uk.co.synbiochem.*
+uk.co.szmg.grafana.*
+uk.co.techblue.*
+uk.co.testforce.services.*
+uk.co.thebadgerset.*
+uk.co.ticklethepanda.*
+uk.co.tnix.exponoticlient.*
+uk.co.tootle.qa.*
+uk.co.trenddevs.*
+uk.co.turingatemyhamster.*
+uk.co.unclealex.*
+uk.co.visalia.brightpearl.*
+uk.co.vurt.hakken.*
+uk.co.wansdykehouse.*
+uk.co.waterrower.*
+uk.co.webamoeba.mockito.collections.*
+uk.co.webamoeba.slf4j.*
+uk.co.xfactory-librarians.*
+uk.codenest.*
+uk.cogfin.*
+uk.com.robust-it.*
+uk.dahai.open.*
+uk.dansiviter.cdi-repos.*
+uk.dansiviter.jule.*
+uk.dansiviter.juli.*
+uk.dioxic.faker4j.*
+uk.dioxic.mgenerate.*
+uk.elementarysoftware.*
+uk.gibby.*
+uk.gov.account.*
+uk.gov.dstl.*
+uk.gov.dstl.baleen.*
+uk.gov.dstl.geo.*
+uk.gov.dstl.machinetranslation.*
+uk.gov.dwp.crypto.*
+uk.gov.dwp.logging.*
+uk.gov.dwp.pdf.*
+uk.gov.dwp.regex.*
+uk.gov.dwp.tls.*
+uk.gov.gchq.data-gen.*
+uk.gov.gchq.eventlogging.*
+uk.gov.gchq.gaffer.*
+uk.gov.gchq.koryphe.*
+uk.gov.gchq.palisade.*
+uk.gov.gchq.stroom.auth.*
+uk.gov.gchq.stroom.expression.*
+uk.gov.gchq.stroom.hadoop.common.*
+uk.gov.gchq.stroom.hadoop.hdfs.*
+uk.gov.gchq.stroom.proxy.*
+uk.gov.gchq.stroom.query.*
+uk.gov.gchq.stroom.stats.*
+uk.gov.gchq.stroom.testdata.*
+uk.gov.hmrc.*
+uk.gov.ida.*
+uk.gov.justice.service.hmpps.*
+uk.gov.justice.service.laa-crime.*
+uk.gov.nationalarchives.*
+uk.gov.nationalarchives.oci.*
+uk.gov.nationalarchives.pdi.*
+uk.gov.nationalarchives.pronom.*
+uk.gov.nationalarchives.thirdparty.dev.fpinbo.*
+uk.gov.nationalarchives.thirdparty.netbeans.*
+uk.gov.nca.*
+uk.gov.nca.graph.*
+uk.gov.service.notify.*
+uk.gov.service.payments.*
+uk.kludje.*
+uk.laxd.*
+uk.ltd.getahead.*
+uk.m0nom.*
+uk.markhornsby.*
+uk.me.berndporr.*
+uk.me.candle.*
+uk.me.candle.twine.*
+uk.me.ferrier.nic.*
+uk.me.g4dpz.*
+uk.me.m0rjc.*
+uk.me.mjt.*
+uk.me.tom-fitzhenry.findbugs-guice.*
+uk.megaslice.*
+uk.modl.*
+uk.nhs.ciao.*
+uk.nhs.interoperability.*
+uk.nominet.*
+uk.num.*
+uk.oczadly.karl.*
+uk.offtopica.*
+uk.org.adamretter.maven.*
+uk.org.adamretter.shadoop.*
+uk.org.binky.*
+uk.org.devthings.*
+uk.org.facetus.*
+uk.org.feedthecoffers.*
+uk.org.freedonia.*
+uk.org.fyodor.*
+uk.org.lidalia.*
+uk.org.okapibarcode.*
+uk.org.ponder.*
+uk.org.ponder.pure-poms.*
+uk.org.ponder.rsf.*
+uk.org.ponder.rsfsamples.*
+uk.org.ponder.rsfutil.*
+uk.org.ponder.sakairsf.*
+uk.org.potes.java8.*
+uk.org.raje.maven.plugins.*
+uk.org.retep.*
+uk.org.retep.doclet.*
+uk.org.retep.microkernel.*
+uk.org.retep.microkernel.integrations.*
+uk.org.retep.microkernel.launcher.*
+uk.org.retep.microkernel.launcher.darwin.*
+uk.org.retep.microkernel.launcher.linux.*
+uk.org.retep.microkernel.launcher.sunos.*
+uk.org.retep.microkernel.launcher.unix.*
+uk.org.retep.microkernel.launcher.windows.*
+uk.org.retep.microkernel.web.*
+uk.org.retep.site.*
+uk.org.retep.templateEngine.*
+uk.org.retep.third-party.*
+uk.org.retep.third-party.docbkx-tools.*
+uk.org.retep.tools.*
+uk.org.retep.tools.dev.*
+uk.org.retep.tools.docbook.*
+uk.org.retep.tools.maven.*
+uk.org.retep.xmpp.*
+uk.org.retep.xmpp.client.*
+uk.org.retep.xmpp.net.*
+uk.org.retep.xmpp.protocol.*
+uk.org.retep.xmpp.server.*
+uk.org.retep.xmpp.test.*
+uk.org.retep.xmpp.xmpp.*
+uk.org.rivernile.android.fetchutils.*
+uk.org.rivernile.edinburghbustrackerapi.*
+uk.org.russet.*
+uk.org.subtrack.*
+uk.org.subtrack.imaging.*
+uk.org.thehickses.*
+uk.org.webcompere.*
+uk.os.search.*
+uk.os.vt.*
+uk.pigpioj.*
+uk.recurse.*
+uk.recurse.bitwrapper.*
+uk.sky.*
+uk.sponte.automation.*
+uk.staygrounded.*
+uk.theretiredprogrammer.*
+uk.theretiredprogrammer.nbpcglibrary.*
+uk.theretiredprogrammer.rpiembeddedlibrary.*
+uk.uuid.slf4j.*
+uk.vitalcode.*
+uk.wardm.*
+uk.yetanother.*
+uno.anahata.*
+uno.cod.battle.*
+uno.informatics.common.*
+uno.perk.*
+urbanophile.*
+urlrewrite.*
+us.abstracta.*
+us.abstracta.jmeter.*
+us.akunevich.protectotron.*
+us.akunevich.protectotron.core.*
+us.akunevich.protectotron.watcher.*
+us.ascendtech.*
+us.blanshard.stubout.*
+us.bpsm.*
+us.bryon.*
+us.careydevelopment.ecosystem.*
+us.careydevelopment.model.*
+us.careydevelopment.model.api.*
+us.careydevelopment.util.*
+us.careydevelopment.util.bot.*
+us.careydevelopment.web.*
+us.codecraft.*
+us.cuatoi.s34j.*
+us.dchbk.*
+us.dustinj.timezonemap.*
+us.eharning.atomun.*
+us.fatehi.*
+us.figt.*
+us.hebi.glue.*
+us.hebi.launchers.*
+us.hebi.matlab.*
+us.hebi.matlab.mat.*
+us.hebi.quickbuf.*
+us.hebi.robobuf.*
+us.hebi.sass.*
+us.hexcoder.*
+us.hornerscorners.hungrycaterpillar.*
+us.hornerscorners.lollipop-router.*
+us.hornerscorners.lollipoprouter.*
+us.hornerscorners.mojo.*
+us.hornerscorners.vista.*
+us.ihmc.*
+us.ihmc.motionnode.us.ihmc.*
+us.ilmark.deta.things.*
+us.irdev.bedrock.*
+us.jakeabel.*
+us.jimschubert.*
+us.joshuatreesoftware.*
+us.jsy.*
+us.jsy.test.*
+us.klette.*
+us.levk.*
+us.logico-philosophic.*
+us.monoid.web.*
+us.nikkii.embedhttp.*
+us.originally.dfs.*
+us.oyanglul.*
+us.parr.*
+us.racem.*
+us.raudi.*
+us.raudi.pushraven.*
+us.rothmichaels.*
+us.rothmichaels.lib.*
+us.rothmichaels.parents.*
+us.shreeram.applications.*
+us.smilecoin.*
+us.spiral.*
+us.springett.*
+us.swcraft.springframework.*
+us.vchain.*
+us.wearabouts.*
+us.zoom.uitoolkit.*
+us.zoom.videosdk.*
+uy.kerri.representations.*
+uy.klutter.*
+uy.kohesive.chillambda.*
+uy.kohesive.cuarentena.*
+uy.kohesive.elasticsearch.*
+uy.kohesive.injekt.*
+uy.kohesive.keplin.*
+uy.kohesive.klutter.*
+uy.kohesive.kovert.*
+uy.kohesive.solr.*
+uy.kohesive.vertx.*
+uz.scala.*
+vc.inreach.angellist.*
+vc.inreach.aws.*
+vc.v8.*
+vdoclet.*
+velocity-anakia.*
+velocity-dvsl.*
+velocity-tools.*
+velocity.*
+video.api.*
+video.bug.*
+video.pano.*
+village.*
+vip.apicloud.*
+vip.appcity.*
+vip.archine.*
+vip.breakpoint.*
+vip.btool.*
+vip.efactory.*
+vip.gadfly.*
+vip.gameclub.*
+vip.ifmm.*
+vip.ings.*
+vip.isass.*
+vip.justlive.*
+vip.kqkd.*
+vip.lematech.*
+vip.mate.*
+vip.penint.sensitive.word.*
+vip.penint.simple.pay.*
+vip.toby.rpc.*
+vip.tool-box.commons.*
+vip.vtool.jcq.*
+vip.wangjc.*
+vip.weplane.*
+vip.wuweijie.camel.*
+vip.xiaomaoxiaoke.*
+vip.xiaonuo.nacos.*
+vip.xjdai.*
+vip.xunmo.*
+vip.yazilim.*
+vip.ylove.*
+vip.yoxiang.*
+vip.zywork.*
+vip.zywork.wechat.*
+vision.id.*
+vision.id.antd-slinky.*
+vn.7team.*
+vn.com.extremevn.*
+vn.edu.vnu.jvntext.jvntextpro.*
+vn.gapowork.android.*
+vn.gapowork.kienmaven.*
+vn.gapowork.richtext.*
+vn.netacom.*
+vn.netlink.*
+vn.onesoft.falcon.*
+vn.sohatv.*
+vn.tiki.ab.*
+vn.tiki.noadapter.*
+vn.tiki.noadapter2.*
+vn.tiki.widgets.*
+vn.viettelmaps.vtmsdk.*
+vu.nl.iref.*
+wadi.*
+wang.bannong.*
+wang.going.*
+wang.harlon.plugin.*
+wang.harlon.plugin.monkey.*
+wang.harlon.quickjs.*
+wang.itwangww.*
+wang.jiejin.*
+wang.joye.*
+wang.leal.ahel.*
+wang.leq.*
+wang.moshu.*
+wang.mty.*
+wang.ramboll.*
+wang.sunkey.*
+wang.sunnly.*
+wang.yeting.*
+webmacro.*
+website.automate.*
+website.automate.jenkins.*
+website.automate.teamcity.*
+website.dachuan.migration.*
+website.magyar.*
+webtest.*
+weixinkeji.vip.*
+werken-xpath.*
+werkflow.*
+werkz.*
+westhawk.*
+wf.bitcoin.*
+which.*
+wicket.*
+wiki.capsule.*
+wiki.depasquale.*
+wiki.ganhua.*
+wiki.hadoop.*
+wiki.hadoop.dstream.*
+wiki.kennisfabriek.tools.*
+wiki.lbj.*
+wiki.primo.generator.*
+wiki.thin.*
+wiki.xsx.*
+win.delin.*
+win.doyto.*
+win.doyto.query.*
+win.hupubao.*
+win.oscene.*
+win.sa4zet.*
+win.xcorpio.*
+win.zqxu.*
+win.zqxu.jxunits.*
+win.zqxu.shiro.*
+woodstox.*
+work.bottle.plugin.*
+work.curioustools.*
+work.eddiejamsession.*
+work.eddiejamsession.avro.*
+work.framework.*
+work.gaigeshen.*
+work.iwacloud.*
+work.jeong.murry.jsend.*
+work.jeong.murry.ktor.features.*
+work.keane.*
+work.labradors.cos.*
+work.lince.*
+work.lingling.dagtask.*
+work.liziyun.*
+work.luohao.*
+work.martins.simon.*
+work.ready.*
+work.seals.*
+work.shart.*
+work.thisisasite.*
+work.trons.library.*
+work.wangjw.*
+works.hacker.*
+works.ideabank.*
+works.lmz.common.*
+works.lmz.composite.*
+works.lmz.controlpanel.*
+works.lmz.javascript.*
+works.lmz.jawr.*
+works.lmz.jobs.*
+works.lmz.logging.*
+works.lmz.plugins.*
+works.lmz.stencil.*
+works.lmz.syllabus.*
+works.lmz.tiles.*
+works.lmz.util.*
+works.lmz.web.*
+works.maatwerk.*
+works.nuka.*
+works.scala.*
+works.worace.*
+world.convex.*
+world.data.*
+world.komq.*
+world.mappable.android.*
+world.ntdi.nrcore.*
+world.weibiansanjue.maven.*
+wrapper.*
+ws-commons-java5.*
+ws-commons-util.*
+ws-commons.*
+ws-scout.*
+ws.ament.hammock.*
+ws.antonov.config.*
+ws.antonov.gradle.plugins.*
+ws.argo.*
+ws.argo.commandline.*
+ws.argo.common.*
+ws.argo.plugin.*
+ws.argo.probe.*
+ws.argo.responder.*
+ws.argo.responder.plugins.*
+ws.argo.wireline.*
+ws.bors.*
+ws.dashing.*
+ws.doerr.projects.emailtemplates.*
+ws.l10n.*
+ws.ladder.*
+ws.leap.kert.*
+ws.nzen.format.eno.*
+ws.nzen.format.maven.*
+ws.nzen.tracking.*
+ws.osiris.*
+ws.palladian.*
+ws.prager.camel.*
+ws.schild.*
+ws.securesocial.*
+ws.slink.*
+ws.slink.thirdparty.*
+ws.suid.*
+ws.unfiltered.*
+ws.vinta.*
+ws.wamp.jawampa.*
+wsdl4j.*
+wsrf.*
+wss4j.*
+wstx.*
+wtf.emulator.*
+wtf.emulator.gradle.*
+wtf.g4s8.*
+wtf.g4s8.oot.*
+wtf.logs.nicobot.*
+wtf.metio.devcontainer.*
+wtf.metio.javapoet.*
+wtf.metio.maven.*
+wtf.metio.maven.boms.*
+wtf.metio.maven.parents.*
+wtf.metio.memoization.*
+wtf.metio.reguloj.*
+wtf.metio.storage-units.*
+wtf.metio.yosql.*
+wtf.metio.yosql.codegen.*
+wtf.metio.yosql.dao.*
+wtf.metio.yosql.internals.*
+wtf.metio.yosql.logging.*
+wtf.metio.yosql.models.*
+wtf.metio.yosql.testing.*
+wtf.metio.yosql.tooling.*
+wtf.nucker.*
+wtf.s1.ezlog.*
+wtf.s1.ptr.*
+wtf.s1.pudge.*
+wtf.s1.ui.*
+wurfl.*
+wutka.*
+xalan.*
+xbean.*
+xdoclet-plugins.*
+xdoclet.*
+xerces.*
+xercesjarv.*
+xfire-root.*
+xfire.*
+xin.allonsy.*
+xin.altitude.*
+xin.altitude.cms.*
+xin.altitude.cms.code.*
+xin.altitude.cms.common.*
+xin.altitude.cms.excel.*
+xin.altitude.cms.framework.*
+xin.altitude.cms.job.*
+xin.altitude.cms.monitor.*
+xin.altitude.cms.system.*
+xin.altitude.cms.ui.*
+xin.altitude.code.*
+xin.altitude.code.local.*
+xin.altitude.common.*
+xin.altitude.hutool.*
+xin.alum.*
+xin.bluesky.*
+xin.dayukeji.*
+xin.jiangqiang.*
+xin.lingchao.*
+xin.manong.*
+xin.nic.*
+xin.vanilla.rcon.*
+xin.wjtree.qmq.*
+xin.xihc.*
+xin.yuki.*
+xin.yukino.*
+xin.zhuyao.httputil.*
+xjavadoc.*
+xml-apis.*
+xml-resolver.*
+xml-security.*
+xmlbeans.*
+xmldb.*
+xmlenc.*
+xmlmind.*
+xmlpull.*
+xmlrpc-helma.*
+xmlrpc.*
+xmlunit.*
+xmlwise.*
+xmlwriter.*
+xom.*
+xpp3.*
+xsddoc.*
+xsdlib.*
+xstream.*
+xtc.*
+xtiff-jai.*
+xxl.*
+xyz.aoei.*
+xyz.appinform.*
+xyz.aptx-4869.*
+xyz.ariwaranosai.*
+xyz.baldeep.*
+xyz.brandonfl.*
+xyz.calvinwilliams.*
+xyz.canardoux.*
+xyz.capybara.*
+xyz.casperkoning.*
+xyz.chaobei.*
+xyz.codemeans.aliyun4j.*
+xyz.codemeans.mybatis.*
+xyz.codemeans.protobuf4j.*
+xyz.codemeans.shopify4j.*
+xyz.codemeans.tensorflow4j.*
+xyz.codezoo.*
+xyz.cofe.*
+xyz.cp74.*
+xyz.cronixzero.sapota.*
+xyz.cssxsh.*
+xyz.cssxsh.baidu.*
+xyz.cssxsh.meme-helper.*
+xyz.cssxsh.mirai.*
+xyz.cssxsh.mirai.plugin.*
+xyz.cssxsh.osu.*
+xyz.cssxsh.pixiv.*
+xyz.danoz.*
+xyz.davidsimon.*
+xyz.deftu.coffeecord.*
+xyz.deftu.deftils.*
+xyz.deftu.eventbus.*
+xyz.deftu.fd.*
+xyz.deftu.filedownloader.*
+xyz.deftu.jrest.*
+xyz.deftu.quicksocket.*
+xyz.deltaevo.*
+xyz.dev-zes.*
+xyz.devfortress.functional.pebbles.*
+xyz.devfortress.splot.*
+xyz.doikki.*
+xyz.doikki.android.dkplayer.*
+xyz.doikki.android.widget.*
+xyz.dong6662.jap.spring.boot.*
+xyz.dowenliu.etcd.*
+xyz.downgoon.*
+xyz.driver.*
+xyz.dunjiao.cloud.*
+xyz.dynxsty.*
+xyz.easyboot.*
+xyz.entangled.*
+xyz.erupt.*
+xyz.euclia.*
+xyz.fabiano.*
+xyz.felh.*
+xyz.florentforest.*
+xyz.four-road-titans.*
+xyz.funjava.functional.*
+xyz.funnone.*
+xyz.gabear.*
+xyz.gaussframework.*
+xyz.gianlu.librespot.*
+xyz.gianlu.mdnsjava.*
+xyz.gianlu.zeroconf.*
+xyz.goioc.*
+xyz.grasscutters.*
+xyz.greatapp.*
+xyz.groundx.caver.*
+xyz.gunanyi.*
+xyz.haff.*
+xyz.haff.mekachis.*
+xyz.hcworld.gotool.*
+xyz.hcworld.nir.*
+xyz.hellothomas.*
+xyz.icanfly.websocket.*
+xyz.ielis.hyperutil.*
+xyz.ilias.gtop.*
+xyz.imzyx.open.*
+xyz.iotcode.iadmin.*
+xyz.itbang.*
+xyz.jetdrone.*
+xyz.jieee.*
+xyz.jinyuxin.*
+xyz.jmburns.*
+xyz.jorgecastro.*
+xyz.jpenilla.*
+xyz.jsinterop.*
+xyz.juandiii.*
+xyz.juicebox.*
+xyz.junerver.anjicaptcha.*
+xyz.junerver.asmtracker.*
+xyz.junerver.fileselector.*
+xyz.junerver.nohttp.*
+xyz.junerver.okgo.*
+xyz.junerver.ssktx.*
+xyz.junerver.test.*
+xyz.junerver.utils.*
+xyz.justblink.*
+xyz.kail.framework.*
+xyz.kamyar.*
+xyz.karthik.*
+xyz.knn3.ktransformer.*
+xyz.kotlinw.*
+xyz.lamergameryt.*
+xyz.lazertechbuilds.*
+xyz.leibrother.*
+xyz.lexteam.*
+xyz.leyuna.*
+xyz.lglg.*
+xyz.lidaning.*
+xyz.lijunyi.*
+xyz.lljllj.fast.*
+xyz.luan.*
+xyz.luan.console.*
+xyz.luan.generator.*
+xyz.luan.geometry.*
+xyz.luan.spark.decorator.*
+xyz.luomu32.*
+xyz.lxie.*
+xyz.maow.*
+xyz.mattyb.*
+xyz.mcxross.ksui.*
+xyz.metahash.bsc.*
+xyz.metakeep.sdk.*
+xyz.migoo.*
+xyz.migoo.springboot.*
+xyz.mkotb.*
+xyz.molzhao.*
+xyz.morphia.morphia.*
+xyz.msws.*
+xyz.my-app.*
+xyz.mydev.*
+xyz.nickr.*
+xyz.nickr.telegram.*
+xyz.noark.*
+xyz.opcal.build.*
+xyz.opcal.cloud.*
+xyz.opcal.tools.*
+xyz.opcal.xena.*
+xyz.ottr.lutra.*
+xyz.parkly.*
+xyz.pavelkorolev.danger.detekt.*
+xyz.pinaki.android.*
+xyz.pinaki.androidcamera.*
+xyz.poeschl.*
+xyz.proadap.aliang.*
+xyz.proteanbear.*
+xyz.quaver.*
+xyz.r2turntrue.*
+xyz.ramotar.catjam.*
+xyz.redrain.*
+xyz.renrcl.*
+xyz.ressor.*
+xyz.rk0cc.jogu.*
+xyz.rk0cc.josev.*
+xyz.rk0cc.willpub.*
+xyz.rogfam.*
+xyz.ronella.casual.*
+xyz.ronella.gosu.*
+xyz.ronella.logging.*
+xyz.runnerbe.*
+xyz.sahildave.*
+xyz.sanshan.*
+xyz.schwaab.*
+xyz.scootaloo.*
+xyz.seansun.*
+xyz.seleya.product.*
+xyz.sheswayhot.*
+xyz.shodown.*
+xyz.silencelurker.*
+xyz.srclab.annotations.*
+xyz.srclab.bom.*
+xyz.srclab.common.*
+xyz.srclab.dependencies.*
+xyz.srclab.spring.boot.*
+xyz.srclab.starter.*
+xyz.strongperched.*
+xyz.swatt.*
+xyz.talnakh.*
+xyz.tehbrian.*
+xyz.teja.retrofit2.*
+xyz.teogramm.*
+xyz.thepathfinder.*
+xyz.tneciv.*
+xyz.tozymc.*
+xyz.tozymc.api.*
+xyz.tozymc.spigot.*
+xyz.truenight.dynamic.*
+xyz.truenight.latte.*
+xyz.truenight.rxinapps.*
+xyz.truenight.support.*
+xyz.truenight.utils.*
+xyz.tynn.astring.*
+xyz.tynn.coana.*
+xyz.ukrainskiys.*
+xyz.unifycraft.gradle.*
+xyz.unifycraft.gradle.multiversion-root.*
+xyz.unifycraft.gradle.multiversion.*
+xyz.unifycraft.gradle.snippets.blossom.*
+xyz.unifycraft.gradle.snippets.configure.*
+xyz.unifycraft.gradle.snippets.java.*
+xyz.unifycraft.gradle.snippets.loom.*
+xyz.unifycraft.gradle.snippets.publishing.*
+xyz.unifycraft.gradle.snippets.releases.*
+xyz.unifycraft.gradle.snippets.repo.*
+xyz.unifycraft.gradle.snippets.resources.*
+xyz.unifycraft.gradle.snippets.shadow.*
+xyz.unifycraft.gradle.tools.*
+xyz.unifycraft.gradle.tools.blossom.*
+xyz.unifycraft.gradle.tools.configure.*
+xyz.unifycraft.gradle.tools.dokka.*
+xyz.unifycraft.gradle.tools.java.*
+xyz.unifycraft.gradle.tools.kotlin.*
+xyz.unifycraft.gradle.tools.loom.*
+xyz.unifycraft.gradle.tools.publishing.*
+xyz.unifycraft.gradle.tools.releases.*
+xyz.unifycraft.gradle.tools.repo.*
+xyz.unifycraft.gradle.tools.resources.*
+xyz.unifycraft.gradle.tools.shadow.*
+xyz.upperlevel.command.spigot.*
+xyz.upperlevel.commandapi.*
+xyz.upperlevel.spigot.anvilgui.*
+xyz.upperlevel.spigot.book.*
+xyz.upperlevel.spigot.command.*
+xyz.upperlevel.spigot.gui.*
+xyz.urbanmatrix.mavlink.*
+xyz.vfhhu.androidlib.*
+xyz.vinesh.*
+xyz.vinesh.creditcardview.*
+xyz.vopen.cartier.*
+xyz.vopen.framework.*
+xyz.vopen.microservices.*
+xyz.vopen.tiffany.*
+xyz.wasabicodes.*
+xyz.wc1950.*
+xyz.weechang.*
+xyz.wiedenhoeft.*
+xyz.xenondevs.*
+xyz.xenondevs.particle.*
+xyz.xiamang.*
+xyz.xiezc.*
+xyz.xpcoder.common.retrofit2.*
+xyz.xpcoder.commons.*
+xyz.xszq.*
+xyz.xuminghai.*
+xyz.zeozheng.*
+xyz.zeroonebn.*
+xyz.zhangbohan.*
+yan.*
+ymsg.*
+yom.*
+za.co.absa.*
+za.co.absa.cobrix.*
+za.co.absa.commons.*
+za.co.absa.enceladus.*
+za.co.absa.fa-db.*
+za.co.absa.hermes.*
+za.co.absa.hyperdrive.*
+za.co.absa.jacoco.*
+za.co.absa.pramen.*
+za.co.absa.shaded.*
+za.co.absa.spline.*
+za.co.absa.spline.agent.spark.*
+za.co.absa.spline.ui.*
+za.co.absa.utils.*
+za.co.bbd.*
+za.co.clock24.*
+za.co.commspace.*
+za.co.entelect.*
+za.co.grindrodbank.*
+za.co.jumpingbean.jpaunit.*
+za.co.knonchalant.candogram.*
+za.co.knowles.pokewhat.*
+za.co.manticore.*
+za.co.monadic.*
+za.co.no9.*
+zone.dragon.*
+zone.dragon.baharclerode.*
+zone.dragon.dropwizard.*
+zone.dragon.maven.plugin.*
+zone.dragon.reflection.*
+zone.fryd.sdk.*
+zone.gryphon.*
+zone.gryphon.do.*
+zone.gryphon.dropwizard.*
+zone.gryphon.github.*
+zone.gryphon.ignore.*
+zone.gryphon.jordan.*
+zone.gryphon.maven.*
+zone.gryphon.maven.plugins.*
+zone.gryphon.telegram.*
+zone.lamprey.*
+zone.nilo.*
+zone.refactor.*
+zone.refactor.spring.*
+zone.refactor.text.*
+zone.src.sheaf.*
+zone.stefan.dev.*
+zone.wmj.*
+zw.co.paynow.*