-
Notifications
You must be signed in to change notification settings - Fork 734
Commit
This commit does not belong to any branch on this repository, and may belong to a fork outside of the repository.
Merge branch 'bump_star_build' of https://github.com/nf-core/modules …
…into bump_star_build
- Loading branch information
Showing
76 changed files
with
3,076 additions
and
1,103 deletions.
There are no files selected for viewing
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| Original file line number | Diff line number | Diff line change |
|---|---|---|
|
|
@@ -2,4 +2,4 @@ channels: | |
| - conda-forge | ||
| - bioconda | ||
| dependencies: | ||
| - bioconda::das_tool=1.1.6 | ||
| - bioconda::das_tool=1.1.7 | ||
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| Original file line number | Diff line number | Diff line change |
|---|---|---|
| @@ -0,0 +1,177 @@ | ||
| nextflow_process { | ||
|
|
||
| name "Test Process DASTOOL_DASTOOL" | ||
| script "../main.nf" | ||
| process "DASTOOL_DASTOOL" | ||
|
|
||
| tag "modules" | ||
| tag "modules_nfcore" | ||
| tag "dastool" | ||
| tag "dastool/dastool" | ||
| tag "dastool/fastatocontig2bin" | ||
| tag "metabat2/metabat2" | ||
| tag "metabat2/jgisummarizebamcontigdepths" | ||
| tag "prodigal" | ||
|
|
||
| setup { | ||
| run("METABAT2_JGISUMMARIZEBAMCONTIGDEPTHS") { | ||
| script "../../../metabat2/jgisummarizebamcontigdepths/main.nf" | ||
| process { | ||
| """ | ||
| input[0] = [ | ||
| [ id:'test', single_end:false ], // meta map | ||
| file(params.modules_testdata_base_path + "genomics/prokaryotes/bacteroides_fragilis/illumina/bam/test1.sorted.bam", checkIfExists: true), | ||
| file(params.modules_testdata_base_path + "genomics/prokaryotes/bacteroides_fragilis/illumina/bam/test1.sorted.bam.bai", checkIfExists: true), | ||
| ] | ||
| """ | ||
| } | ||
| } | ||
| run("METABAT2_METABAT2") { | ||
| script "../../../metabat2/metabat2/main.nf" | ||
| process { | ||
| """ | ||
| input[0] = Channel.of([ | ||
| [ id:'test', single_end:false ], | ||
| file(params.modules_testdata_base_path + "genomics/prokaryotes/bacteroides_fragilis/genome/genome.fna.gz", checkIfExists: true) | ||
| ]).join(METABAT2_JGISUMMARIZEBAMCONTIGDEPTHS.out.depth) | ||
| """ | ||
| } | ||
| } | ||
| run("DASTOOL_FASTATOCONTIG2BIN") { | ||
| script "../../fastatocontig2bin/main.nf" | ||
| process { | ||
| """ | ||
| input[0] = METABAT2_METABAT2.out.fasta.collect() | ||
| input[1] = "fa" | ||
| """ | ||
| } | ||
| } | ||
| run("PRODIGAL") { | ||
| script "../../../prodigal/main.nf" | ||
| process { | ||
| """ | ||
| input[0] = Channel.of([ | ||
| [ id:'test', single_end:false ], | ||
| file(params.modules_testdata_base_path + "genomics/prokaryotes/bacteroides_fragilis/genome/genome.fna.gz", checkIfExists: true) | ||
| ]) | ||
| input[1] = "gff" | ||
| """ | ||
| } | ||
| } | ||
| } | ||
|
|
||
| test("dastool dastool - bacteroides fragilis - noproteins") { | ||
|
|
||
| config "./nextflow.config" | ||
|
|
||
| when { | ||
| params { | ||
| module_args = '--write_bins --write_bin_evals' | ||
| } | ||
| process { | ||
| """ | ||
| input[0] = Channel.of([ | ||
| [ id:'test', single_end:false ], | ||
| file(params.modules_testdata_base_path + "genomics/prokaryotes/bacteroides_fragilis/genome/genome.fna.gz", checkIfExists: true) | ||
| ]).join(DASTOOL_FASTATOCONTIG2BIN.out.fastatocontig2bin) | ||
| .map { meta, contigs, c2b -> [ meta, contigs, c2b, [] ]} | ||
| input[1] = [] | ||
| """ | ||
| } | ||
| } | ||
|
|
||
| then { | ||
| assertAll( | ||
| { assert process.success }, | ||
| { assert path(process.out.log.get(0).get(1)).text.contains("Dereplicating, aggregating, and scoring bins") }, | ||
| { assert path(process.out.fasta_proteins.get(0).get(1)).text.contains("MKIGIITICKVNNYGAELQAFATQKKLEQMGHNAEIINYLYYKDWHFKDTPLSQPFVPLD") }, | ||
| { assert snapshot( | ||
| process.out.summary, | ||
| process.out.contig2bin, | ||
| process.out.eval, | ||
| process.out.bins, | ||
| process.out.pdfs, | ||
| process.out.candidates_faa, | ||
| process.out.fasta_archaea_scg, | ||
| process.out.fasta_bacteria_scg, | ||
| process.out.b6, | ||
| process.out.seqlength, | ||
| process.out.versions | ||
| ).match() } | ||
| ) | ||
| } | ||
|
|
||
| } | ||
|
|
||
| test("dastool dastool - bacteroides fragilis - proteins") { | ||
|
|
||
| config "./nextflow.config" | ||
|
|
||
| when { | ||
| params { | ||
| module_args = '--write_bins --write_bin_evals' | ||
| } | ||
| process { | ||
| """ | ||
| input[0] = Channel.of([ | ||
| [ id:'test', single_end:false ], | ||
| file(params.modules_testdata_base_path + "genomics/prokaryotes/bacteroides_fragilis/genome/genome.fna.gz", checkIfExists: true) | ||
| ]) | ||
| .join(DASTOOL_FASTATOCONTIG2BIN.out.fastatocontig2bin) | ||
| .join(PRODIGAL.out.amino_acid_fasta) | ||
| input[1] = [] | ||
| """ | ||
| } | ||
| } | ||
|
|
||
| then { | ||
| assertAll( | ||
| { assert process.success }, | ||
| { assert path(process.out.log.get(0).get(1)).text.contains("Dereplicating, aggregating, and scoring bins") }, | ||
| { assert snapshot( | ||
| process.out.summary, | ||
| process.out.contig2bin, | ||
| process.out.eval, | ||
| process.out.bins, | ||
| process.out.pdfs, | ||
| process.out.fasta_proteins, | ||
| process.out.candidates_faa, | ||
| process.out.fasta_archaea_scg, | ||
| process.out.fasta_bacteria_scg, | ||
| process.out.b6, | ||
| process.out.seqlength, | ||
| process.out.versions | ||
| ).match() } | ||
| ) | ||
| } | ||
|
|
||
| } | ||
|
|
||
| test("dastool dastool - bacteroides fragilis - stub") { | ||
|
|
||
| options "-stub" | ||
|
|
||
| when { | ||
| process { | ||
| """ | ||
| input[0] = Channel.of([ | ||
| [ id:'test', single_end:false ], | ||
| file(params.modules_testdata_base_path + "genomics/prokaryotes/bacteroides_fragilis/genome/genome.fna.gz", checkIfExists: true) | ||
| ]) | ||
| .join(DASTOOL_FASTATOCONTIG2BIN.out.fastatocontig2bin) | ||
| .join(PRODIGAL.out.amino_acid_fasta) | ||
| input[1] = [] | ||
| """ | ||
| } | ||
| } | ||
|
|
||
| then { | ||
| assertAll( | ||
| { assert process.success }, | ||
| { assert snapshot(process.out).match() } | ||
| ) | ||
| } | ||
|
|
||
| } | ||
| } | ||
|
|
Oops, something went wrong.