From 9ac9e3a073c66e81f4de9c42a15aeb17c871c6dc Mon Sep 17 00:00:00 2001 From: Yaroslav Zborovsky Date: Thu, 1 Jul 2021 10:33:09 +0300 Subject: [PATCH] Update dependencies --- config.go | 2 +- coverage.txt | 32 +- go.mod | 18 +- go.sum | 67 +- .../universal-translator/.gitignore | 3 +- .../universal-translator/.travis.yml | 27 + .../universal-translator/README.md | 15 +- .../go-playground/universal-translator/go.mod | 5 + .../go-playground/universal-translator/go.sum | 4 + .../go-playground/validator/v10}/.gitignore | 3 +- .../go-playground/validator/v10}/LICENSE | 0 .../go-playground/validator/v10}/Makefile | 6 +- .../go-playground/validator/v10}/README.md | 174 +- .../go-playground/validator/v10}/baked_in.go | 585 ++- .../go-playground/validator/v10}/cache.go | 0 .../validator/v10/country_codes.go | 162 + .../go-playground/validator/v10}/doc.go | 290 +- .../go-playground/validator/v10}/errors.go | 33 +- .../validator/v10}/field_level.go | 46 +- .../go-playground/validator/v10/go.mod | 12 + .../go-playground/validator/v10/go.sum | 33 + .../go-playground/validator/v10}/logo.png | Bin .../go-playground/validator/v10}/regexes.go | 20 +- .../validator/v10}/struct_level.go | 0 .../validator/v10}/translations.go | 0 .../go-playground/validator/v10}/util.go | 41 +- .../go-playground/validator/v10}/validator.go | 8 +- .../validator/v10}/validator_instance.go | 18 +- .../testify/assert/assertion_compare.go | 172 +- .../testify/assert/assertion_format.go | 97 + .../testify/assert/assertion_forward.go | 194 + .../testify/assert/assertion_order.go | 81 + .../stretchr/testify/assert/assertions.go | 83 +- .../stretchr/testify/require/require.go | 248 ++ .../testify/require/require_forward.go | 194 + vendor/go.uber.org/atomic/.codecov.yml | 4 + vendor/go.uber.org/atomic/.gitignore | 3 + vendor/go.uber.org/atomic/.travis.yml | 27 - vendor/go.uber.org/atomic/CHANGELOG.md | 18 + vendor/go.uber.org/atomic/Makefile | 52 +- vendor/go.uber.org/atomic/README.md | 4 +- vendor/go.uber.org/atomic/atomic.go | 356 -- vendor/go.uber.org/atomic/bool.go | 81 + .../{multierr/go113.go => atomic/bool_ext.go} | 49 +- vendor/go.uber.org/atomic/doc.go | 23 + vendor/go.uber.org/atomic/duration.go | 82 + vendor/go.uber.org/atomic/duration_ext.go | 40 + vendor/go.uber.org/atomic/error.go | 48 +- vendor/go.uber.org/atomic/error_ext.go | 39 + vendor/go.uber.org/atomic/float64.go | 76 + vendor/go.uber.org/atomic/float64_ext.go | 47 + vendor/go.uber.org/atomic/gen.go | 27 + vendor/go.uber.org/atomic/go.mod | 2 - vendor/go.uber.org/atomic/go.sum | 14 - vendor/go.uber.org/atomic/int32.go | 102 + vendor/go.uber.org/atomic/int64.go | 102 + vendor/go.uber.org/atomic/nocmp.go | 35 + vendor/go.uber.org/atomic/string.go | 41 +- vendor/go.uber.org/atomic/string_ext.go | 43 + vendor/go.uber.org/atomic/uint32.go | 102 + vendor/go.uber.org/atomic/uint64.go | 102 + vendor/go.uber.org/atomic/uintptr.go | 102 + vendor/go.uber.org/atomic/unsafe_pointer.go | 58 + vendor/go.uber.org/atomic/value.go | 31 + vendor/go.uber.org/multierr/.travis.yml | 29 - vendor/go.uber.org/multierr/CHANGELOG.md | 12 + vendor/go.uber.org/multierr/LICENSE.txt | 2 +- vendor/go.uber.org/multierr/Makefile | 10 +- vendor/go.uber.org/multierr/README.md | 8 +- vendor/go.uber.org/multierr/error.go | 208 +- vendor/go.uber.org/multierr/go.mod | 11 +- vendor/go.uber.org/multierr/go.sum | 47 +- vendor/go.uber.org/zap/.travis.yml | 23 - vendor/go.uber.org/zap/CHANGELOG.md | 60 + vendor/go.uber.org/zap/CONTRIBUTING.md | 6 - vendor/go.uber.org/zap/FAQ.md | 8 + vendor/go.uber.org/zap/Makefile | 16 +- vendor/go.uber.org/zap/README.md | 8 +- vendor/go.uber.org/zap/buffer/buffer.go | 18 + vendor/go.uber.org/zap/field.go | 10 + vendor/go.uber.org/zap/go.mod | 13 +- vendor/go.uber.org/zap/go.sum | 52 +- vendor/go.uber.org/zap/http_handler.go | 99 +- vendor/go.uber.org/zap/logger.go | 18 +- vendor/go.uber.org/zap/options.go | 8 + vendor/go.uber.org/zap/sugar.go | 31 +- .../zap/zapcore/buffered_write_syncer.go | 188 + vendor/go.uber.org/zap/zapcore/clock.go | 50 + .../zap/zapcore/console_encoder.go | 2 +- vendor/go.uber.org/zap/zapcore/entry.go | 4 +- vendor/go.uber.org/zap/zapcore/error.go | 19 +- vendor/go.uber.org/zap/zapcore/field.go | 8 +- .../go.uber.org/zap/zapcore/write_syncer.go | 3 +- vendor/golang.org/x/crypto/AUTHORS | 3 + vendor/golang.org/x/crypto/CONTRIBUTORS | 3 + vendor/golang.org/x/crypto/LICENSE | 27 + vendor/golang.org/x/crypto/PATENTS | 22 + vendor/golang.org/x/crypto/sha3/doc.go | 66 + vendor/golang.org/x/crypto/sha3/hashes.go | 97 + .../x/crypto/sha3/hashes_generic.go | 27 + vendor/golang.org/x/crypto/sha3/keccakf.go | 412 ++ .../golang.org/x/crypto/sha3/keccakf_amd64.go | 13 + .../golang.org/x/crypto/sha3/keccakf_amd64.s | 390 ++ vendor/golang.org/x/crypto/sha3/register.go | 18 + vendor/golang.org/x/crypto/sha3/sha3.go | 193 + vendor/golang.org/x/crypto/sha3/sha3_s390x.go | 284 ++ vendor/golang.org/x/crypto/sha3/sha3_s390x.s | 33 + vendor/golang.org/x/crypto/sha3/shake.go | 173 + .../golang.org/x/crypto/sha3/shake_generic.go | 19 + vendor/golang.org/x/crypto/sha3/xor.go | 23 + .../golang.org/x/crypto/sha3/xor_generic.go | 28 + .../golang.org/x/crypto/sha3/xor_unaligned.go | 76 + vendor/golang.org/x/sys/cpu/asm_aix_ppc64.s | 17 + vendor/golang.org/x/sys/cpu/byteorder.go | 60 + vendor/golang.org/x/sys/cpu/cpu.go | 162 + vendor/golang.org/x/sys/cpu/cpu_aix_ppc64.go | 34 + vendor/golang.org/x/sys/cpu/cpu_arm.go | 40 + vendor/golang.org/x/sys/cpu/cpu_gc_s390x.go | 21 + vendor/golang.org/x/sys/cpu/cpu_gc_x86.go | 16 + vendor/golang.org/x/sys/cpu/cpu_gccgo.c | 43 + vendor/golang.org/x/sys/cpu/cpu_gccgo.go | 26 + .../golang.org/x/sys/cpu/cpu_gccgo_s390x.go | 22 + vendor/golang.org/x/sys/cpu/cpu_linux.go | 59 + vendor/golang.org/x/sys/cpu/cpu_linux_arm.go | 39 + .../golang.org/x/sys/cpu/cpu_linux_arm64.go | 67 + .../golang.org/x/sys/cpu/cpu_linux_ppc64x.go | 33 + .../golang.org/x/sys/cpu/cpu_linux_s390x.go | 161 + vendor/golang.org/x/sys/cpu/cpu_mips64x.go | 11 + vendor/golang.org/x/sys/cpu/cpu_mipsx.go | 11 + .../golang.org/x/sys/cpu/cpu_other_arm64.go | 11 + vendor/golang.org/x/sys/cpu/cpu_s390x.s | 57 + vendor/golang.org/x/sys/cpu/cpu_wasm.go | 15 + vendor/golang.org/x/sys/cpu/cpu_x86.go | 59 + vendor/golang.org/x/sys/cpu/cpu_x86.s | 27 + .../x/sys/cpu/syscall_aix_ppc64_gc.go | 36 + vendor/golang.org/x/text/AUTHORS | 3 + vendor/golang.org/x/text/CONTRIBUTORS | 3 + vendor/golang.org/x/text/LICENSE | 27 + vendor/golang.org/x/text/PATENTS | 22 + .../x/text/internal/language/common.go | 16 + .../x/text/internal/language/compact.go | 29 + .../text/internal/language/compact/compact.go | 61 + .../internal/language/compact/language.go | 260 ++ .../text/internal/language/compact/parents.go | 120 + .../text/internal/language/compact/tables.go | 1015 +++++ .../x/text/internal/language/compact/tags.go | 91 + .../x/text/internal/language/compose.go | 167 + .../x/text/internal/language/coverage.go | 28 + .../x/text/internal/language/language.go | 596 +++ .../x/text/internal/language/lookup.go | 412 ++ .../x/text/internal/language/match.go | 226 ++ .../x/text/internal/language/parse.go | 594 +++ .../x/text/internal/language/tables.go | 3431 +++++++++++++++++ .../x/text/internal/language/tags.go | 48 + vendor/golang.org/x/text/internal/tag/tag.go | 100 + vendor/golang.org/x/text/language/coverage.go | 187 + vendor/golang.org/x/text/language/doc.go | 102 + vendor/golang.org/x/text/language/go1_1.go | 38 + vendor/golang.org/x/text/language/go1_2.go | 11 + vendor/golang.org/x/text/language/language.go | 601 +++ vendor/golang.org/x/text/language/match.go | 735 ++++ vendor/golang.org/x/text/language/parse.go | 228 ++ vendor/golang.org/x/text/language/tables.go | 298 ++ vendor/golang.org/x/text/language/tags.go | 145 + vendor/gopkg.in/yaml.v3/.travis.yml | 16 - vendor/gopkg.in/yaml.v3/apic.go | 1 + vendor/gopkg.in/yaml.v3/decode.go | 65 +- vendor/gopkg.in/yaml.v3/emitterc.go | 58 +- vendor/gopkg.in/yaml.v3/encode.go | 30 +- vendor/gopkg.in/yaml.v3/parserc.go | 48 +- vendor/gopkg.in/yaml.v3/scannerc.go | 49 +- vendor/gopkg.in/yaml.v3/yaml.go | 40 +- vendor/gopkg.in/yaml.v3/yamlh.go | 2 + vendor/modules.txt | 37 +- 174 files changed, 17103 insertions(+), 1125 deletions(-) create mode 100644 vendor/github.com/go-playground/universal-translator/.travis.yml create mode 100644 vendor/github.com/go-playground/universal-translator/go.mod create mode 100644 vendor/github.com/go-playground/universal-translator/go.sum rename vendor/{gopkg.in/go-playground/validator.v9 => github.com/go-playground/validator/v10}/.gitignore (94%) rename vendor/{gopkg.in/go-playground/validator.v9 => github.com/go-playground/validator/v10}/LICENSE (100%) rename vendor/{gopkg.in/go-playground/validator.v9 => github.com/go-playground/validator/v10}/Makefile (77%) rename vendor/{gopkg.in/go-playground/validator.v9 => github.com/go-playground/validator/v10}/README.md (68%) rename vendor/{gopkg.in/go-playground/validator.v9 => github.com/go-playground/validator/v10}/baked_in.go (75%) rename vendor/{gopkg.in/go-playground/validator.v9 => github.com/go-playground/validator/v10}/cache.go (100%) create mode 100644 vendor/github.com/go-playground/validator/v10/country_codes.go rename vendor/{gopkg.in/go-playground/validator.v9 => github.com/go-playground/validator/v10}/doc.go (79%) rename vendor/{gopkg.in/go-playground/validator.v9 => github.com/go-playground/validator/v10}/errors.go (87%) rename vendor/{gopkg.in/go-playground/validator.v9 => github.com/go-playground/validator/v10}/field_level.go (56%) create mode 100644 vendor/github.com/go-playground/validator/v10/go.mod create mode 100644 vendor/github.com/go-playground/validator/v10/go.sum rename vendor/{gopkg.in/go-playground/validator.v9 => github.com/go-playground/validator/v10}/logo.png (100%) rename vendor/{gopkg.in/go-playground/validator.v9 => github.com/go-playground/validator/v10}/regexes.go (84%) rename vendor/{gopkg.in/go-playground/validator.v9 => github.com/go-playground/validator/v10}/struct_level.go (100%) rename vendor/{gopkg.in/go-playground/validator.v9 => github.com/go-playground/validator/v10}/translations.go (100%) rename vendor/{gopkg.in/go-playground/validator.v9 => github.com/go-playground/validator/v10}/util.go (86%) rename vendor/{gopkg.in/go-playground/validator.v9 => github.com/go-playground/validator/v10}/validator.go (98%) rename vendor/{gopkg.in/go-playground/validator.v9 => github.com/go-playground/validator/v10}/validator_instance.go (96%) create mode 100644 vendor/github.com/stretchr/testify/assert/assertion_order.go delete mode 100644 vendor/go.uber.org/atomic/.travis.yml delete mode 100644 vendor/go.uber.org/atomic/atomic.go create mode 100644 vendor/go.uber.org/atomic/bool.go rename vendor/go.uber.org/{multierr/go113.go => atomic/bool_ext.go} (58%) create mode 100644 vendor/go.uber.org/atomic/doc.go create mode 100644 vendor/go.uber.org/atomic/duration.go create mode 100644 vendor/go.uber.org/atomic/duration_ext.go create mode 100644 vendor/go.uber.org/atomic/error_ext.go create mode 100644 vendor/go.uber.org/atomic/float64.go create mode 100644 vendor/go.uber.org/atomic/float64_ext.go create mode 100644 vendor/go.uber.org/atomic/gen.go create mode 100644 vendor/go.uber.org/atomic/int32.go create mode 100644 vendor/go.uber.org/atomic/int64.go create mode 100644 vendor/go.uber.org/atomic/nocmp.go create mode 100644 vendor/go.uber.org/atomic/string_ext.go create mode 100644 vendor/go.uber.org/atomic/uint32.go create mode 100644 vendor/go.uber.org/atomic/uint64.go create mode 100644 vendor/go.uber.org/atomic/uintptr.go create mode 100644 vendor/go.uber.org/atomic/unsafe_pointer.go create mode 100644 vendor/go.uber.org/atomic/value.go delete mode 100644 vendor/go.uber.org/multierr/.travis.yml delete mode 100644 vendor/go.uber.org/zap/.travis.yml create mode 100644 vendor/go.uber.org/zap/zapcore/buffered_write_syncer.go create mode 100644 vendor/go.uber.org/zap/zapcore/clock.go create mode 100644 vendor/golang.org/x/crypto/AUTHORS create mode 100644 vendor/golang.org/x/crypto/CONTRIBUTORS create mode 100644 vendor/golang.org/x/crypto/LICENSE create mode 100644 vendor/golang.org/x/crypto/PATENTS create mode 100644 vendor/golang.org/x/crypto/sha3/doc.go create mode 100644 vendor/golang.org/x/crypto/sha3/hashes.go create mode 100644 vendor/golang.org/x/crypto/sha3/hashes_generic.go create mode 100644 vendor/golang.org/x/crypto/sha3/keccakf.go create mode 100644 vendor/golang.org/x/crypto/sha3/keccakf_amd64.go create mode 100644 vendor/golang.org/x/crypto/sha3/keccakf_amd64.s create mode 100644 vendor/golang.org/x/crypto/sha3/register.go create mode 100644 vendor/golang.org/x/crypto/sha3/sha3.go create mode 100644 vendor/golang.org/x/crypto/sha3/sha3_s390x.go create mode 100644 vendor/golang.org/x/crypto/sha3/sha3_s390x.s create mode 100644 vendor/golang.org/x/crypto/sha3/shake.go create mode 100644 vendor/golang.org/x/crypto/sha3/shake_generic.go create mode 100644 vendor/golang.org/x/crypto/sha3/xor.go create mode 100644 vendor/golang.org/x/crypto/sha3/xor_generic.go create mode 100644 vendor/golang.org/x/crypto/sha3/xor_unaligned.go create mode 100644 vendor/golang.org/x/sys/cpu/asm_aix_ppc64.s create mode 100644 vendor/golang.org/x/sys/cpu/byteorder.go create mode 100644 vendor/golang.org/x/sys/cpu/cpu.go create mode 100644 vendor/golang.org/x/sys/cpu/cpu_aix_ppc64.go create mode 100644 vendor/golang.org/x/sys/cpu/cpu_arm.go create mode 100644 vendor/golang.org/x/sys/cpu/cpu_gc_s390x.go create mode 100644 vendor/golang.org/x/sys/cpu/cpu_gc_x86.go create mode 100644 vendor/golang.org/x/sys/cpu/cpu_gccgo.c create mode 100644 vendor/golang.org/x/sys/cpu/cpu_gccgo.go create mode 100644 vendor/golang.org/x/sys/cpu/cpu_gccgo_s390x.go create mode 100644 vendor/golang.org/x/sys/cpu/cpu_linux.go create mode 100644 vendor/golang.org/x/sys/cpu/cpu_linux_arm.go create mode 100644 vendor/golang.org/x/sys/cpu/cpu_linux_arm64.go create mode 100644 vendor/golang.org/x/sys/cpu/cpu_linux_ppc64x.go create mode 100644 vendor/golang.org/x/sys/cpu/cpu_linux_s390x.go create mode 100644 vendor/golang.org/x/sys/cpu/cpu_mips64x.go create mode 100644 vendor/golang.org/x/sys/cpu/cpu_mipsx.go create mode 100644 vendor/golang.org/x/sys/cpu/cpu_other_arm64.go create mode 100644 vendor/golang.org/x/sys/cpu/cpu_s390x.s create mode 100644 vendor/golang.org/x/sys/cpu/cpu_wasm.go create mode 100644 vendor/golang.org/x/sys/cpu/cpu_x86.go create mode 100644 vendor/golang.org/x/sys/cpu/cpu_x86.s create mode 100644 vendor/golang.org/x/sys/cpu/syscall_aix_ppc64_gc.go create mode 100644 vendor/golang.org/x/text/AUTHORS create mode 100644 vendor/golang.org/x/text/CONTRIBUTORS create mode 100644 vendor/golang.org/x/text/LICENSE create mode 100644 vendor/golang.org/x/text/PATENTS create mode 100644 vendor/golang.org/x/text/internal/language/common.go create mode 100644 vendor/golang.org/x/text/internal/language/compact.go create mode 100644 vendor/golang.org/x/text/internal/language/compact/compact.go create mode 100644 vendor/golang.org/x/text/internal/language/compact/language.go create mode 100644 vendor/golang.org/x/text/internal/language/compact/parents.go create mode 100644 vendor/golang.org/x/text/internal/language/compact/tables.go create mode 100644 vendor/golang.org/x/text/internal/language/compact/tags.go create mode 100644 vendor/golang.org/x/text/internal/language/compose.go create mode 100644 vendor/golang.org/x/text/internal/language/coverage.go create mode 100644 vendor/golang.org/x/text/internal/language/language.go create mode 100644 vendor/golang.org/x/text/internal/language/lookup.go create mode 100644 vendor/golang.org/x/text/internal/language/match.go create mode 100644 vendor/golang.org/x/text/internal/language/parse.go create mode 100644 vendor/golang.org/x/text/internal/language/tables.go create mode 100644 vendor/golang.org/x/text/internal/language/tags.go create mode 100644 vendor/golang.org/x/text/internal/tag/tag.go create mode 100644 vendor/golang.org/x/text/language/coverage.go create mode 100644 vendor/golang.org/x/text/language/doc.go create mode 100644 vendor/golang.org/x/text/language/go1_1.go create mode 100644 vendor/golang.org/x/text/language/go1_2.go create mode 100644 vendor/golang.org/x/text/language/language.go create mode 100644 vendor/golang.org/x/text/language/match.go create mode 100644 vendor/golang.org/x/text/language/parse.go create mode 100644 vendor/golang.org/x/text/language/tables.go create mode 100644 vendor/golang.org/x/text/language/tags.go delete mode 100644 vendor/gopkg.in/yaml.v3/.travis.yml diff --git a/config.go b/config.go index 949e075..0ee716d 100644 --- a/config.go +++ b/config.go @@ -2,7 +2,7 @@ package svc import ( "github.com/caarlos0/env" - "gopkg.in/go-playground/validator.v9" + "github.com/go-playground/validator/v10" ) // LoadFromEnv parses environment variables into a given struct and validates diff --git a/coverage.txt b/coverage.txt index cd5972c..7bf2e05 100644 --- a/coverage.txt +++ b/coverage.txt @@ -11,7 +11,7 @@ github.com/voi-oss/svc/http.go:46.34,48.71 2 0 github.com/voi-oss/svc/http.go:51.2,51.12 1 0 github.com/voi-oss/svc/http.go:48.71,50.3 1 0 github.com/voi-oss/svc/http.go:55.40,57.2 1 0 -github.com/voi-oss/svc/logger.go:13.102,28.2 5 5 +github.com/voi-oss/svc/logger.go:13.102,28.2 5 19 github.com/voi-oss/svc/logger.go:32.30,33.28 1 0 github.com/voi-oss/svc/logger.go:33.28,41.59 2 0 github.com/voi-oss/svc/logger.go:45.3,46.42 1 0 @@ -22,17 +22,17 @@ github.com/voi-oss/svc/logger.go:51.5,52.15 2 0 github.com/voi-oss/svc/logger.go:48.19,50.6 1 0 github.com/voi-oss/svc/logger.go:59.66,60.28 1 0 github.com/voi-oss/svc/logger.go:60.28,62.3 1 0 -github.com/voi-oss/svc/logger.go:67.55,68.28 1 4 -github.com/voi-oss/svc/logger.go:68.28,76.3 4 4 -github.com/voi-oss/svc/logger.go:81.54,82.28 1 0 -github.com/voi-oss/svc/logger.go:82.28,90.3 4 0 -github.com/voi-oss/svc/logger.go:95.72,96.28 1 0 -github.com/voi-oss/svc/logger.go:96.28,106.3 5 0 -github.com/voi-oss/svc/logger.go:111.76,112.28 1 0 -github.com/voi-oss/svc/logger.go:112.28,120.3 4 0 -github.com/voi-oss/svc/logger.go:123.75,125.16 2 5 -github.com/voi-oss/svc/logger.go:128.2,129.16 2 5 -github.com/voi-oss/svc/logger.go:133.2,138.12 5 5 +github.com/voi-oss/svc/logger.go:67.55,68.28 1 13 +github.com/voi-oss/svc/logger.go:68.28,76.3 4 13 +github.com/voi-oss/svc/logger.go:81.54,82.28 1 2 +github.com/voi-oss/svc/logger.go:82.28,90.3 4 2 +github.com/voi-oss/svc/logger.go:95.72,96.28 1 2 +github.com/voi-oss/svc/logger.go:96.28,106.3 5 2 +github.com/voi-oss/svc/logger.go:111.76,112.28 1 2 +github.com/voi-oss/svc/logger.go:112.28,120.3 4 2 +github.com/voi-oss/svc/logger.go:123.75,125.16 2 19 +github.com/voi-oss/svc/logger.go:128.2,129.16 2 19 +github.com/voi-oss/svc/logger.go:133.2,138.12 5 19 github.com/voi-oss/svc/logger.go:125.16,127.3 1 0 github.com/voi-oss/svc/logger.go:129.16,131.3 1 0 github.com/voi-oss/svc/options.go:19.56,20.28 1 0 @@ -66,11 +66,11 @@ github.com/voi-oss/svc/options.go:136.41,138.7 1 0 github.com/voi-oss/svc/options.go:141.21,144.19 3 0 github.com/voi-oss/svc/options.go:148.5,150.22 3 0 github.com/voi-oss/svc/options.go:144.19,147.6 2 0 -github.com/voi-oss/svc/svc.go:54.62,70.51 2 4 -github.com/voi-oss/svc/svc.go:74.2,78.25 3 4 -github.com/voi-oss/svc/svc.go:84.2,84.15 1 4 +github.com/voi-oss/svc/svc.go:54.62,70.51 2 11 +github.com/voi-oss/svc/svc.go:74.2,78.25 3 11 +github.com/voi-oss/svc/svc.go:84.2,84.15 1 11 github.com/voi-oss/svc/svc.go:70.51,72.3 1 0 -github.com/voi-oss/svc/svc.go:78.25,79.30 1 0 +github.com/voi-oss/svc/svc.go:78.25,79.30 1 8 github.com/voi-oss/svc/svc.go:79.30,81.4 1 0 github.com/voi-oss/svc/svc.go:89.48,90.42 1 5 github.com/voi-oss/svc/svc.go:93.2,93.32 1 5 diff --git a/go.mod b/go.mod index 04c966d..5d4d362 100644 --- a/go.mod +++ b/go.mod @@ -1,19 +1,15 @@ module github.com/voi-oss/svc +go 1.15 + require ( github.com/blendle/zapdriver v1.3.1 github.com/caarlos0/env v3.5.0+incompatible - github.com/go-playground/locales v0.13.0 // indirect - github.com/go-playground/universal-translator v0.16.0 // indirect + github.com/go-playground/validator/v10 v10.5.0 github.com/google/go-cmp v0.3.1 // indirect - github.com/kr/pretty v0.1.0 // indirect - github.com/leodido/go-urn v1.2.0 // indirect github.com/prometheus/client_golang v1.2.1 - github.com/stretchr/testify v1.6.1 - go.uber.org/zap v1.16.0 - gopkg.in/check.v1 v1.0.0-20180628173108-788fd7840127 // indirect - gopkg.in/go-playground/assert.v1 v1.2.1 // indirect - gopkg.in/go-playground/validator.v9 v9.30.0 + github.com/stretchr/testify v1.7.0 + go.uber.org/atomic v1.8.0 // indirect + go.uber.org/multierr v1.7.0 // indirect + go.uber.org/zap v1.18.1 ) - -go 1.15 diff --git a/go.sum b/go.sum index e586bcb..f79ac43 100644 --- a/go.sum +++ b/go.sum @@ -1,8 +1,9 @@ -github.com/BurntSushi/toml v0.3.1/go.mod h1:xHWCNGjB5oqiDr8zfno3MHue2Ht5sIBksp03qcyfWMU= github.com/alecthomas/template v0.0.0-20160405071501-a0175ee3bccc/go.mod h1:LOuyumcjzFXgccqObfd/Ljyb9UuFJ6TxHnclSeseNhc= github.com/alecthomas/template v0.0.0-20190718012654-fb15b899a751/go.mod h1:LOuyumcjzFXgccqObfd/Ljyb9UuFJ6TxHnclSeseNhc= github.com/alecthomas/units v0.0.0-20151022065526-2efee857e7cf/go.mod h1:ybxpYRFXyAe+OPACYpWeL0wqObRcbAqCMya13uyzqw0= github.com/alecthomas/units v0.0.0-20190717042225-c3de453c63f4/go.mod h1:ybxpYRFXyAe+OPACYpWeL0wqObRcbAqCMya13uyzqw0= +github.com/benbjohnson/clock v1.1.0 h1:Q92kusRqC1XV2MjkWETPvjJVqKetz1OzxZB7mHJLju8= +github.com/benbjohnson/clock v1.1.0/go.mod h1:J11/hYXuz8f4ySSvYwY0FKfm+ezbsZBKZxNJlLklBHA= github.com/beorn7/perks v0.0.0-20180321164747-3a771d992973/go.mod h1:Dwedo/Wpr24TaqPxmxbtue+5NUziq4I4S80YR8gNf3Q= github.com/beorn7/perks v1.0.0/go.mod h1:KWe93zE9D1o94FZ5RNwFwVgaQK1VOXiVxmqh+CedLV8= github.com/beorn7/perks v1.0.1 h1:VlbKKnNfV8bJzeqoa4cOKqO6bYr3WgKZxO8Z16+hsOM= @@ -20,10 +21,14 @@ github.com/go-kit/kit v0.8.0/go.mod h1:xBxKIO96dXMWWy0MnWVtmwkA9/13aqxPnvrjFYMA2 github.com/go-kit/kit v0.9.0/go.mod h1:xBxKIO96dXMWWy0MnWVtmwkA9/13aqxPnvrjFYMA2as= github.com/go-logfmt/logfmt v0.3.0/go.mod h1:Qt1PoO58o5twSAckw1HlFXLmHsOX5/0LbT9GBnD5lWE= github.com/go-logfmt/logfmt v0.4.0/go.mod h1:3RMwSq7FuexP4Kalkev3ejPJsZTpXXBr9+V4qmtdjCk= +github.com/go-playground/assert/v2 v2.0.1 h1:MsBgLAaY856+nPRTKrp3/OZK38U/wa0CcBYNjji3q3A= +github.com/go-playground/assert/v2 v2.0.1/go.mod h1:VDjEfimB/XKnb+ZQfWdccd7VUvScMdVu0Titje2rxJ4= github.com/go-playground/locales v0.13.0 h1:HyWk6mgj5qFqCT5fjGBuRArbVDfE4hi8+e8ceBS/t7Q= github.com/go-playground/locales v0.13.0/go.mod h1:taPMhCMXrRLJO55olJkUXHZBHCxTMfnGwq/HNwmWNS8= -github.com/go-playground/universal-translator v0.16.0 h1:X++omBR/4cE2MNg91AoC3rmGrCjJ8eAeUP/K/EKx4DM= -github.com/go-playground/universal-translator v0.16.0/go.mod h1:1AnU7NaIRDWWzGEKwgtJRd2xk99HeFyHw3yid4rvQIY= +github.com/go-playground/universal-translator v0.17.0 h1:icxd5fm+REJzpZx7ZfpaD876Lmtgy7VtROAbHHXk8no= +github.com/go-playground/universal-translator v0.17.0/go.mod h1:UkSxE5sNxxRwHyU+Scu5vgOQjsIJAF8j9muTVoKLVtA= +github.com/go-playground/validator/v10 v10.5.0 h1:X9rflw/KmpACwT8zdrm1upefpvdy6ur8d1kWyq6sg3E= +github.com/go-playground/validator/v10 v10.5.0/go.mod h1:xm76BBt941f7yWdGnI2DVPFFg1UK3YY04qifoXU3lOk= github.com/go-stack/stack v1.8.0/go.mod h1:v0f6uXyyMGvRgIKkXu+yp6POWl0qKG85gN/melR3HDY= github.com/gogo/protobuf v1.1.1/go.mod h1:r8qH/GZQm5c6nD/R0oafs1akxWv10x8SbQlK7atdtwQ= github.com/golang/protobuf v1.2.0/go.mod h1:6lQm79b+lXiMfvg/cZm0SGofjICqVBUtrP5yJMmIC1U= @@ -34,12 +39,9 @@ github.com/google/go-cmp v0.3.0/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMyw github.com/google/go-cmp v0.3.1 h1:Xye71clBPdm5HgqGwUkwhbynsUJZhDbS20FvLhQ2izg= github.com/google/go-cmp v0.3.1/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMywk6iLU= github.com/google/gofuzz v1.0.0/go.mod h1:dBl0BpW6vV/+mYPU4Po3pmUjxk6FQPldtuIdl/M65Eg= -github.com/google/renameio v0.1.0/go.mod h1:KWCgfxg9yswjAJkECMjeO8J8rahYeXnNhOm40UhjYkI= github.com/json-iterator/go v1.1.6/go.mod h1:+SdeFBvtyEkXs7REEP0seUULqWtbJapLOCVDaaPEHmU= -github.com/json-iterator/go v1.1.7 h1:KfgG9LzI+pYjr4xvmz/5H4FXjokeP+rlHLhv3iH62Fo= github.com/json-iterator/go v1.1.7/go.mod h1:KdQUCv79m/52Kvf8AW2vK1V8akMuk1QjK/uOdHXbAo4= github.com/julienschmidt/httprouter v1.2.0/go.mod h1:SYymIcj16QtmaHHD7aYtjjsJG7VTCxuUUipMqKk8s4w= -github.com/kisielk/gotool v1.0.0/go.mod h1:XhKaO+MFFWcvkIS/tQcRk01m1F5IRFswLeQ+oQHNcck= github.com/konsorten/go-windows-terminal-sequences v1.0.1/go.mod h1:T0+1ngSBFLxvqU3pZ+m/2kptfBszLMUkC4ZK/EgS/cQ= github.com/kr/logfmt v0.0.0-20140226030751-b84e30acd515/go.mod h1:+0opPa2QZZtGFBFZlji/RkVcI2GknAs/DXo4wKdlNEc= github.com/kr/pretty v0.1.0 h1:L/CwN0zerZDmRFUapSPitk6f+Q3+0za1rQkzVuMiMFI= @@ -52,10 +54,8 @@ github.com/leodido/go-urn v1.2.0/go.mod h1:+8+nEpDfqqsY+g338gtMEUOtuK+4dEMhiQEgx github.com/matttproud/golang_protobuf_extensions v1.0.1 h1:4hp9jkHxhMHkqkrB3Ix0jegS5sx/RkqARlsWZ6pIwiU= github.com/matttproud/golang_protobuf_extensions v1.0.1/go.mod h1:D8He9yQNgCq6Z5Ld7szi9bcBfOoFv/3dc6xSMkL2PC0= github.com/modern-go/concurrent v0.0.0-20180228061459-e0a39a4cb421/go.mod h1:6dJC0mAP4ikYIbvyc7fijjWJddQyLn8Ig3JB5CqoB9Q= -github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd h1:TRLaZ9cD/w8PVh93nsPXa1VrQ6jlwL5oN8l14QlcNfg= github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd/go.mod h1:6dJC0mAP4ikYIbvyc7fijjWJddQyLn8Ig3JB5CqoB9Q= github.com/modern-go/reflect2 v0.0.0-20180701023420-4b7aa43c6742/go.mod h1:bx2lNnkwVCuqBIxFjflWJWanXIb3RllmbCylyMrvgv0= -github.com/modern-go/reflect2 v1.0.1 h1:9f412s+6RmYXLWZSEzVVgPGK7C2PphHj5RJrvfx9AWI= github.com/modern-go/reflect2 v1.0.1/go.mod h1:bx2lNnkwVCuqBIxFjflWJWanXIb3RllmbCylyMrvgv0= github.com/mwitkow/go-conntrack v0.0.0-20161129095857-cc309e4a2223/go.mod h1:qRWi+5nqEBWmkhHvq77mSJWrCKwh8bxhgT7d/eI7P4U= github.com/pkg/errors v0.8.0/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= @@ -78,37 +78,34 @@ github.com/prometheus/procfs v0.0.0-20181005140218-185b4288413d/go.mod h1:c3At6R github.com/prometheus/procfs v0.0.2/go.mod h1:TjEm7ze935MbeOT/UhFTIMYKhuLP4wbCsTZCD3I8kEA= github.com/prometheus/procfs v0.0.5 h1:3+auTFlqw+ZaQYJARz6ArODtkaIwtvBTx3N2NehQlL8= github.com/prometheus/procfs v0.0.5/go.mod h1:4A/X28fw3Fc593LaREMrKMqOKvUAntwMDaekg4FpcdQ= -github.com/rogpeppe/go-internal v1.3.0/go.mod h1:M8bDsm7K2OlrFYOpmOWEs/qY81heoFRclV5y23lUDJ4= github.com/sirupsen/logrus v1.2.0/go.mod h1:LxeOpSwHxABJmUn/MG1IvRgCAasNZTLOkJPxbbu5VWo= github.com/sirupsen/logrus v1.4.2/go.mod h1:tLMulIdttU9McNUspp0xgXVQah82FyeX6MwdIuYE2rE= github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= github.com/stretchr/objx v0.1.1/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= github.com/stretchr/testify v1.2.2/go.mod h1:a8OnRcib4nhh0OaRAV+Yts87kKdq0PP7pXfy6kDkUVs= github.com/stretchr/testify v1.3.0/go.mod h1:M5WIy9Dh21IEIfnGCwXGc5bZfKNJtfHm1UVUgZn+9EI= -github.com/stretchr/testify v1.4.0 h1:2E4SXV/wtOkTonXsotYi4li6zVWxYlZuYNCXe9XRJyk= github.com/stretchr/testify v1.4.0/go.mod h1:j7eGeouHqKxXV5pUuKE4zz7dFj8WfuZ+81PSLYec5m4= -github.com/stretchr/testify v1.6.1 h1:hDPOHmpOpP40lSULcqw7IrRb/u7w6RpDC9399XyoNd0= -github.com/stretchr/testify v1.6.1/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg= -go.uber.org/atomic v1.4.0 h1:cxzIVoETapQEqDhQu3QfnvXAV4AlzcvUCxkVUFw3+EU= +github.com/stretchr/testify v1.7.0 h1:nwc3DEeHmmLAfoZucVR881uASk0Mfjw8xYJ99tb5CcY= +github.com/stretchr/testify v1.7.0/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg= go.uber.org/atomic v1.4.0/go.mod h1:gD2HeocX3+yG+ygLZcrzQJaqmWj9AIm7n08wl/qW/PE= -go.uber.org/atomic v1.6.0 h1:Ezj3JGmsOnG1MoRWQkPBsKLe9DwWD9QeXzTRzzldNVk= -go.uber.org/atomic v1.6.0/go.mod h1:sABNBOSYdrvTF6hTgEIbc7YasKWGhgEQZyfxyTvoXHQ= +go.uber.org/atomic v1.7.0/go.mod h1:fEN4uk6kAWBTFdckzkM89CLk9XfWZrxpCo0nPH17wJc= +go.uber.org/atomic v1.8.0 h1:CUhrE4N1rqSE6FM9ecihEjRkLQu8cDfgDyoOs83mEY4= +go.uber.org/atomic v1.8.0/go.mod h1:fEN4uk6kAWBTFdckzkM89CLk9XfWZrxpCo0nPH17wJc= +go.uber.org/goleak v1.1.10 h1:z+mqJhf6ss6BSfSM671tgKyZBFPTTJM+HLxnhPC3wu0= +go.uber.org/goleak v1.1.10/go.mod h1:8a7PlsEVH3e/a/GLqe5IIrQx6GzcnRmZEufDUTk4A7A= go.uber.org/multierr v1.1.0/go.mod h1:wR5kodmAFQ0UK8QlbwjlSNy0Z68gJhDJUG5sjR94q/0= -go.uber.org/multierr v1.2.0 h1:6I+W7f5VwC5SV9dNrZ3qXrDB9mD0dyGOi/ZJmYw03T4= -go.uber.org/multierr v1.2.0/go.mod h1:wR5kodmAFQ0UK8QlbwjlSNy0Z68gJhDJUG5sjR94q/0= -go.uber.org/multierr v1.5.0 h1:KCa4XfM8CWFCpxXRGok+Q0SS/0XBhMDbHHGABQLvD2A= -go.uber.org/multierr v1.5.0/go.mod h1:FeouvMocqHpRaaGuG9EjoKcStLC43Zu/fmqdUMPcKYU= -go.uber.org/tools v0.0.0-20190618225709-2cfd321de3ee/go.mod h1:vJERXedbb3MVM5f9Ejo0C68/HhF8uaILCdgjnY+goOA= +go.uber.org/multierr v1.6.0/go.mod h1:cdWPpRnG4AhwMwsgIHip0KRBQjJy5kYEpYjJxpXp9iU= +go.uber.org/multierr v1.7.0 h1:zaiO/rmgFjbmCXdSYJWQcdvOCsthmdaHfr3Gm2Kx4Ec= +go.uber.org/multierr v1.7.0/go.mod h1:7EAYxJLBy9rStEaz58O2t4Uvip6FSURkq8/ppBp95ak= go.uber.org/zap v1.10.0/go.mod h1:vwi/ZaCAaUcBkycHslxD9B2zi4UTXhF60s6SWpuDF0Q= -go.uber.org/zap v1.11.0 h1:gSmpCfs+R47a4yQPAI4xJ0IPDLTRGXskm6UelqNXpqE= -go.uber.org/zap v1.11.0/go.mod h1:vwi/ZaCAaUcBkycHslxD9B2zi4UTXhF60s6SWpuDF0Q= -go.uber.org/zap v1.16.0 h1:uFRZXykJGK9lLY4HtgSw44DnIcAM+kRBP7x5m+NpAOM= -go.uber.org/zap v1.16.0/go.mod h1:MA8QOfq0BHJwdXa996Y4dYkAqRKB8/1K1QMMZVaNZjQ= +go.uber.org/zap v1.18.1 h1:CSUJ2mjFszzEWt4CdKISEuChVIXGBn3lAPwkRGyVrc4= +go.uber.org/zap v1.18.1/go.mod h1:xg/QME4nWcxGxrpdeYfq7UvYrLh66cuVKdrbD1XF/NI= golang.org/x/crypto v0.0.0-20180904163835-0709b304e793/go.mod h1:6SG95UA2DQfeDnfUPMdvaQW0Q7yPrPDi9nlGo2tz2b4= golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w= -golang.org/x/crypto v0.0.0-20190510104115-cbcb75029529/go.mod h1:yigFU9vqHzYiE8UmvKecakEJjdnWj3jj499lnFckfCI= +golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9 h1:psW17arqaxU48Z5kZ0CQnkZWQJsqcURM6tKiBApRjXI= +golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto= +golang.org/x/lint v0.0.0-20190930215403-16217165b5de h1:5hukYrvBGR8/eNkX5mdUezrA6JiaEZDtJb9Ei+1LlBs= golang.org/x/lint v0.0.0-20190930215403-16217165b5de/go.mod h1:6SW0HCj/g11FgYtHlgUYUwCkIfeOF89ocIRzGO/8vkc= -golang.org/x/mod v0.0.0-20190513183733-4bf6d317e70e/go.mod h1:mXi4GBBbnImb6dmsKGUJ2LatrhH/nqhxcFungHvyanc= golang.org/x/net v0.0.0-20181114220301-adae6a3d119a/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/net v0.0.0-20190311183353-d8887717615a/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg= golang.org/x/net v0.0.0-20190404232315-eb5bcb51f2a3/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg= @@ -125,25 +122,21 @@ golang.org/x/sys v0.0.0-20190422165155-953cdadca894/go.mod h1:h1NjWce9XRLGQEsW7w golang.org/x/sys v0.0.0-20191010194322-b09406accb47 h1:/XfQ9z7ib8eEJX2hdgFTZJ/ntt0swNk5oYBziWeTCvY= golang.org/x/sys v0.0.0-20191010194322-b09406accb47/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= +golang.org/x/text v0.3.2 h1:tW2bmiBqwgJj/UpqtC8EpXEZVYOwU0yG4iWbprSVAcs= golang.org/x/text v0.3.2/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= golang.org/x/tools v0.0.0-20190311212946-11955173bddd/go.mod h1:LCzVGOaR6xXOjkQ3onu1FJEFr0SW1gC7cKk1uF8kGRs= -golang.org/x/tools v0.0.0-20190621195816-6e04913cbbac/go.mod h1:/rFqwRUd4F7ZHNgwSSTFct+R/Kf4OFW1sUzUTQQTgfc= -golang.org/x/tools v0.0.0-20191029041327-9cc4af7d6b2c/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo= -golang.org/x/tools v0.0.0-20191029190741-b9c20aec41a5/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo= +golang.org/x/tools v0.0.0-20191108193012-7d206e10da11 h1:Yq9t9jnGoR+dBuitxdo9l6Q7xh/zOyNnYUtDKaQ3x0E= +golang.org/x/tools v0.0.0-20191108193012-7d206e10da11/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo= golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= gopkg.in/alecthomas/kingpin.v2 v2.2.6/go.mod h1:FMv+mEhP44yOT+4EoQTLFTRgOQ1FBLkstjWtayDeSgw= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/check.v1 v1.0.0-20180628173108-788fd7840127 h1:qIbj1fsPNlZgppZ+VLlY7N33q108Sa+fhmuc+sWQYwY= gopkg.in/check.v1 v1.0.0-20180628173108-788fd7840127/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= -gopkg.in/errgo.v2 v2.1.0/go.mod h1:hNsd1EY+bozCKY1Ytp96fpM3vjJbqLJn88ws8XvfDNI= -gopkg.in/go-playground/assert.v1 v1.2.1 h1:xoYuJVE7KT85PYWrN730RguIQO0ePzVRfFMXadIrXTM= -gopkg.in/go-playground/assert.v1 v1.2.1/go.mod h1:9RXL0bg/zibRAgZUYszZSwO/z8Y/a8bDuhia5mkpMnE= -gopkg.in/go-playground/validator.v9 v9.30.0 h1:Wk0Z37oBmKj9/n+tPyBHZmeL19LaCoK3Qq48VwYENss= -gopkg.in/go-playground/validator.v9 v9.30.0/go.mod h1:+c9/zcJMFNgbLvly1L1V+PpxWdVbfP1avr/N00E2vyQ= gopkg.in/yaml.v2 v2.2.1/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= -gopkg.in/yaml.v2 v2.2.2 h1:ZCJp+EgiOT7lHqUV2J862kp8Qj64Jo6az82+3Td9dZw= gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= -gopkg.in/yaml.v3 v3.0.0-20200313102051-9f266ea9e77c h1:dUUwHk2QECo/6vqA44rthZ8ie2QXMNeKRTHCNY2nXvo= +gopkg.in/yaml.v2 v2.2.8 h1:obN1ZagJSUGI0Ek/LBmuj4SNLPfIny3KsKFopxRdj10= +gopkg.in/yaml.v2 v2.2.8/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= gopkg.in/yaml.v3 v3.0.0-20200313102051-9f266ea9e77c/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= -honnef.co/go/tools v0.0.1-2019.2.3/go.mod h1:a3bituU0lyd329TUQxRnasdCoJDkEUEAqEt0JzvZhAg= +gopkg.in/yaml.v3 v3.0.0-20210107192922-496545a6307b h1:h8qDotaEPuJATrMmW04NCwg7v22aHH28wwpauUhK9Oo= +gopkg.in/yaml.v3 v3.0.0-20210107192922-496545a6307b/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= diff --git a/vendor/github.com/go-playground/universal-translator/.gitignore b/vendor/github.com/go-playground/universal-translator/.gitignore index 2661785..bc4e07f 100644 --- a/vendor/github.com/go-playground/universal-translator/.gitignore +++ b/vendor/github.com/go-playground/universal-translator/.gitignore @@ -21,4 +21,5 @@ _testmain.go *.exe *.test -*.prof \ No newline at end of file +*.prof +*.coverprofile \ No newline at end of file diff --git a/vendor/github.com/go-playground/universal-translator/.travis.yml b/vendor/github.com/go-playground/universal-translator/.travis.yml new file mode 100644 index 0000000..39b8b92 --- /dev/null +++ b/vendor/github.com/go-playground/universal-translator/.travis.yml @@ -0,0 +1,27 @@ +language: go +go: + - 1.13.4 + - tip +matrix: + allow_failures: + - go: tip + +notifications: + email: + recipients: dean.karn@gmail.com + on_success: change + on_failure: always + +before_install: + - go install github.com/mattn/goveralls + +# Only clone the most recent commit. +git: + depth: 1 + +script: + - go test -v -race -covermode=atomic -coverprofile=coverage.coverprofile ./... + +after_success: | + [ $TRAVIS_GO_VERSION = 1.13.4 ] && + goveralls -coverprofile=coverage.coverprofile -service travis-ci -repotoken $COVERALLS_TOKEN \ No newline at end of file diff --git a/vendor/github.com/go-playground/universal-translator/README.md b/vendor/github.com/go-playground/universal-translator/README.md index 24aef15..071f33a 100644 --- a/vendor/github.com/go-playground/universal-translator/README.md +++ b/vendor/github.com/go-playground/universal-translator/README.md @@ -1,7 +1,6 @@ ## universal-translator - -![Project status](https://img.shields.io/badge/version-0.16.0-green.svg) -[![Build Status](https://semaphoreci.com/api/v1/joeybloggs/universal-translator/branches/master/badge.svg)](https://semaphoreci.com/joeybloggs/universal-translator) +![Project status](https://img.shields.io/badge/version-0.17.0-green.svg) +[![Build Status](https://travis-ci.org/go-playground/universal-translator.svg?branch=master)](https://travis-ci.org/go-playground/universal-translator) [![Coverage Status](https://coveralls.io/repos/github/go-playground/universal-translator/badge.svg)](https://coveralls.io/github/go-playground/universal-translator) [![Go Report Card](https://goreportcard.com/badge/github.com/go-playground/universal-translator)](https://goreportcard.com/report/github.com/go-playground/universal-translator) [![GoDoc](https://godoc.org/github.com/go-playground/universal-translator?status.svg)](https://godoc.org/github.com/go-playground/universal-translator) @@ -46,9 +45,9 @@ Please see https://godoc.org/github.com/go-playground/universal-translator for u ##### Examples: -- [Basic](https://github.com/go-playground/universal-translator/tree/master/examples/basic) -- [Full - no files](https://github.com/go-playground/universal-translator/tree/master/examples/full-no-files) -- [Full - with files](https://github.com/go-playground/universal-translator/tree/master/examples/full-with-files) +- [Basic](https://github.com/go-playground/universal-translator/tree/master/_examples/basic) +- [Full - no files](https://github.com/go-playground/universal-translator/tree/master/_examples/full-no-files) +- [Full - with files](https://github.com/go-playground/universal-translator/tree/master/_examples/full-with-files) File formatting -------------- @@ -57,10 +56,10 @@ they are only separated for easy viewing. ##### Examples: -- [Formats](https://github.com/go-playground/universal-translator/tree/master/examples/file-formats) +- [Formats](https://github.com/go-playground/universal-translator/tree/master/_examples/file-formats) ##### Basic Makeup -NOTE: not all fields are needed for all translation types, see [examples](https://github.com/go-playground/universal-translator/tree/master/examples/file-formats) +NOTE: not all fields are needed for all translation types, see [examples](https://github.com/go-playground/universal-translator/tree/master/_examples/file-formats) ```json { "locale": "en", diff --git a/vendor/github.com/go-playground/universal-translator/go.mod b/vendor/github.com/go-playground/universal-translator/go.mod new file mode 100644 index 0000000..8079590 --- /dev/null +++ b/vendor/github.com/go-playground/universal-translator/go.mod @@ -0,0 +1,5 @@ +module github.com/go-playground/universal-translator + +go 1.13 + +require github.com/go-playground/locales v0.13.0 diff --git a/vendor/github.com/go-playground/universal-translator/go.sum b/vendor/github.com/go-playground/universal-translator/go.sum new file mode 100644 index 0000000..cbbf324 --- /dev/null +++ b/vendor/github.com/go-playground/universal-translator/go.sum @@ -0,0 +1,4 @@ +github.com/go-playground/locales v0.13.0 h1:HyWk6mgj5qFqCT5fjGBuRArbVDfE4hi8+e8ceBS/t7Q= +github.com/go-playground/locales v0.13.0/go.mod h1:taPMhCMXrRLJO55olJkUXHZBHCxTMfnGwq/HNwmWNS8= +golang.org/x/text v0.3.2/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= +golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= diff --git a/vendor/gopkg.in/go-playground/validator.v9/.gitignore b/vendor/github.com/go-playground/validator/v10/.gitignore similarity index 94% rename from vendor/gopkg.in/go-playground/validator.v9/.gitignore rename to vendor/github.com/go-playground/validator/v10/.gitignore index 792ca00..6e43fac 100644 --- a/vendor/gopkg.in/go-playground/validator.v9/.gitignore +++ b/vendor/github.com/go-playground/validator/v10/.gitignore @@ -6,6 +6,7 @@ # Folders _obj _test +bin # Architecture specific extensions/prefixes *.[568vq] @@ -26,4 +27,4 @@ _testmain.go *.out *.txt cover.html -README.html \ No newline at end of file +README.html diff --git a/vendor/gopkg.in/go-playground/validator.v9/LICENSE b/vendor/github.com/go-playground/validator/v10/LICENSE similarity index 100% rename from vendor/gopkg.in/go-playground/validator.v9/LICENSE rename to vendor/github.com/go-playground/validator/v10/LICENSE diff --git a/vendor/gopkg.in/go-playground/validator.v9/Makefile b/vendor/github.com/go-playground/validator/v10/Makefile similarity index 77% rename from vendor/gopkg.in/go-playground/validator.v9/Makefile rename to vendor/github.com/go-playground/validator/v10/Makefile index b912cae..19c91ed 100644 --- a/vendor/gopkg.in/go-playground/validator.v9/Makefile +++ b/vendor/github.com/go-playground/validator/v10/Makefile @@ -1,13 +1,13 @@ -GOCMD=go +GOCMD=GO111MODULE=on go linters-install: @golangci-lint --version >/dev/null 2>&1 || { \ echo "installing linting tools..."; \ - curl -sfL https://raw.githubusercontent.com/golangci/golangci-lint/master/install.sh| sh -s v1.19.1; \ + curl -sfL https://raw.githubusercontent.com/golangci/golangci-lint/master/install.sh| sh -s v1.21.0; \ } lint: linters-install - golangci-lint run + $(PWD)/bin/golangci-lint run test: $(GOCMD) test -cover -race ./... diff --git a/vendor/gopkg.in/go-playground/validator.v9/README.md b/vendor/github.com/go-playground/validator/v10/README.md similarity index 68% rename from vendor/gopkg.in/go-playground/validator.v9/README.md rename to vendor/github.com/go-playground/validator/v10/README.md index 24318de..2ba36d7 100644 --- a/vendor/gopkg.in/go-playground/validator.v9/README.md +++ b/vendor/github.com/go-playground/validator/v10/README.md @@ -1,37 +1,37 @@ Package validator ================ [![Join the chat at https://gitter.im/go-playground/validator](https://badges.gitter.im/Join%20Chat.svg)](https://gitter.im/go-playground/validator?utm_source=badge&utm_medium=badge&utm_campaign=pr-badge&utm_content=badge) -![Project status](https://img.shields.io/badge/version-9.30.0-green.svg) -[![Build Status](https://semaphoreci.com/api/v1/joeybloggs/validator/branches/v9/badge.svg)](https://semaphoreci.com/joeybloggs/validator) -[![Coverage Status](https://coveralls.io/repos/go-playground/validator/badge.svg?branch=v9&service=github)](https://coveralls.io/github/go-playground/validator?branch=v9) +![Project status](https://img.shields.io/badge/version-10.5.0-green.svg) +[![Build Status](https://travis-ci.org/go-playground/validator.svg?branch=master)](https://travis-ci.org/go-playground/validator) +[![Coverage Status](https://coveralls.io/repos/go-playground/validator/badge.svg?branch=master&service=github)](https://coveralls.io/github/go-playground/validator?branch=master) [![Go Report Card](https://goreportcard.com/badge/github.com/go-playground/validator)](https://goreportcard.com/report/github.com/go-playground/validator) -[![GoDoc](https://godoc.org/gopkg.in/go-playground/validator.v9?status.svg)](https://godoc.org/gopkg.in/go-playground/validator.v9) +[![GoDoc](https://godoc.org/github.com/go-playground/validator?status.svg)](https://pkg.go.dev/github.com/go-playground/validator/v10) ![License](https://img.shields.io/dub/l/vibe-d.svg) Package validator implements value validations for structs and individual fields based on tags. It has the following **unique** features: -- Cross Field and Cross Struct validations by using validation tags or custom validators. +- Cross Field and Cross Struct validations by using validation tags or custom validators. - Slice, Array and Map diving, which allows any or all levels of a multidimensional field to be validated. -- Ability to dive into both map keys and values for validation +- Ability to dive into both map keys and values for validation - Handles type interface by determining it's underlying type prior to validation. - Handles custom field types such as sql driver Valuer see [Valuer](https://golang.org/src/database/sql/driver/types.go?s=1210:1293#L29) - Alias validation tags, which allows for mapping of several validations to a single tag for easier defining of validations on structs - Extraction of custom defined Field Name e.g. can specify to extract the JSON name while validating and have it available in the resulting FieldError - Customizable i18n aware error messages. -- Default validator for the [gin](https://github.com/gin-gonic/gin) web framework; upgrading from v8 to v9 in gin see [here](https://github.com/go-playground/validator/tree/v9/_examples/gin-upgrading-overriding) +- Default validator for the [gin](https://github.com/gin-gonic/gin) web framework; upgrading from v8 to v9 in gin see [here](https://github.com/go-playground/validator/tree/master/_examples/gin-upgrading-overriding) Installation ------------ Use go get. - go get gopkg.in/go-playground/validator.v9 + go get github.com/go-playground/validator Then import the validator package into your own code. - import "gopkg.in/go-playground/validator.v9" + import "github.com/go-playground/validator" Error Return Value ------- @@ -53,17 +53,163 @@ validationErrors := err.(validator.ValidationErrors) Usage and documentation ------ -Please see http://godoc.org/gopkg.in/go-playground/validator.v9 for detailed usage docs. +Please see https://pkg.go.dev/github.com/go-playground/validator/v10 for detailed usage docs. ##### Examples: -- [Simple](https://github.com/go-playground/validator/blob/v9/_examples/simple/main.go) -- [Custom Field Types](https://github.com/go-playground/validator/blob/v9/_examples/custom/main.go) -- [Struct Level](https://github.com/go-playground/validator/blob/v9/_examples/struct-level/main.go) -- [Translations & Custom Errors](https://github.com/go-playground/validator/blob/v9/_examples/translations/main.go) +- [Simple](https://github.com/go-playground/validator/blob/master/_examples/simple/main.go) +- [Custom Field Types](https://github.com/go-playground/validator/blob/master/_examples/custom/main.go) +- [Struct Level](https://github.com/go-playground/validator/blob/master/_examples/struct-level/main.go) +- [Translations & Custom Errors](https://github.com/go-playground/validator/blob/master/_examples/translations/main.go) - [Gin upgrade and/or override validator](https://github.com/go-playground/validator/tree/v9/_examples/gin-upgrading-overriding) - [wash - an example application putting it all together](https://github.com/bluesuncorp/wash) +Baked-in Validations +------ + +### Fields: + +| Tag | Description | +| - | - | +| eqcsfield | Field Equals Another Field (relative)| +| eqfield | Field Equals Another Field | +| fieldcontains | NOT DOCUMENTED IN doc.go | +| fieldexcludes | NOT DOCUMENTED IN doc.go | +| gtcsfield | Field Greater Than Another Relative Field | +| gtecsfield | Field Greater Than or Equal To Another Relative Field | +| gtefield | Field Greater Than or Equal To Another Field | +| gtfield | Field Greater Than Another Field | +| ltcsfield | Less Than Another Relative Field | +| ltecsfield | Less Than or Equal To Another Relative Field | +| ltefield | Less Than or Equal To Another Field | +| ltfield | Less Than Another Field | +| necsfield | Field Does Not Equal Another Field (relative) | +| nefield | Field Does Not Equal Another Field | + +### Network: + +| Tag | Description | +| - | - | +| cidr | Classless Inter-Domain Routing CIDR | +| cidrv4 | Classless Inter-Domain Routing CIDRv4 | +| cidrv6 | Classless Inter-Domain Routing CIDRv6 | +| datauri | Data URL | +| fqdn | Full Qualified Domain Name (FQDN) | +| hostname | Hostname RFC 952 | +| hostname_port | HostPort | +| hostname_rfc1123 | Hostname RFC 1123 | +| ip | Internet Protocol Address IP | +| ip4_addr | Internet Protocol Address IPv4 | +| ip6_addr |Internet Protocol Address IPv6 | +| ip_addr | Internet Protocol Address IP | +| ipv4 | Internet Protocol Address IPv4 | +| ipv6 | Internet Protocol Address IPv6 | +| mac | Media Access Control Address MAC | +| tcp4_addr | Transmission Control Protocol Address TCPv4 | +| tcp6_addr | Transmission Control Protocol Address TCPv6 | +| tcp_addr | Transmission Control Protocol Address TCP | +| udp4_addr | User Datagram Protocol Address UDPv4 | +| udp6_addr | User Datagram Protocol Address UDPv6 | +| udp_addr | User Datagram Protocol Address UDP | +| unix_addr | Unix domain socket end point Address | +| uri | URI String | +| url | URL String | +| url_encoded | URL Encoded | +| urn_rfc2141 | Urn RFC 2141 String | + +### Strings: + +| Tag | Description | +| - | - | +| alpha | Alpha Only | +| alphanum | Alphanumeric | +| alphanumunicode | Alphanumeric Unicode | +| alphaunicode | Alpha Unicode | +| ascii | ASCII | +| contains | Contains | +| containsany | Contains Any | +| containsrune | Contains Rune | +| endswith | Ends With | +| lowercase | Lowercase | +| multibyte | Multi-Byte Characters | +| number | NOT DOCUMENTED IN doc.go | +| numeric | Numeric | +| printascii | Printable ASCII | +| startswith | Starts With | +| uppercase | Uppercase | + +### Format: +| Tag | Description | +| - | - | +| base64 | Base64 String | +| base64url | Base64URL String | +| btc_addr | Bitcoin Address | +| btc_addr_bech32 | Bitcoin Bech32 Address (segwit) | +| datetime | Datetime | +| e164 | e164 formatted phone number | +| email | E-mail String +| eth_addr | Ethereum Address | +| hexadecimal | Hexadecimal String | +| hexcolor | Hexcolor String | +| hsl | HSL String | +| hsla | HSLA String | +| html | HTML Tags | +| html_encoded | HTML Encoded | +| isbn | International Standard Book Number | +| isbn10 | International Standard Book Number 10 | +| isbn13 | International Standard Book Number 13 | +| json | JSON | +| latitude | Latitude | +| longitude | Longitude | +| rgb | RGB String | +| rgba | RGBA String | +| ssn | Social Security Number SSN | +| uuid | Universally Unique Identifier UUID | +| uuid3 | Universally Unique Identifier UUID v3 | +| uuid3_rfc4122 | Universally Unique Identifier UUID v3 RFC4122 | +| uuid4 | Universally Unique Identifier UUID v4 | +| uuid4_rfc4122 | Universally Unique Identifier UUID v4 RFC4122 | +| uuid5 | Universally Unique Identifier UUID v5 | +| uuid5_rfc4122 | Universally Unique Identifier UUID v5 RFC4122 | +| uuid_rfc4122 | Universally Unique Identifier UUID RFC4122 | + +### Comparisons: +| Tag | Description | +| - | - | +| eq | Equals | +| gt | Greater than| +| gte |Greater than or equal | +| lt | Less Than | +| lte | Less Than or Equal | +| ne | Not Equal | + +### Other: +| Tag | Description | +| - | - | +| dir | Directory | +| endswith | Ends With | +| excludes | Excludes | +| excludesall | Excludes All | +| excludesrune | Excludes Rune | +| file | File path | +| isdefault | Is Default | +| len | Length | +| max | Maximum | +| min | Minimum | +| oneof | One Of | +| required | Required | +| required_if | Required If | +| required_unless | Required Unless | +| required_with | Required With | +| required_with_all | Required With All | +| required_without | Required Without | +| required_without_all | Required Without All | +| excluded_with | Excluded With | +| excluded_with_all | Excluded With All | +| excluded_without | Excluded Without | +| excluded_without_all | Excluded Without All | +| unique | Unique | + Benchmarks ------ ###### Run on MacBook Pro (15-inch, 2017) go version go1.10.2 darwin/amd64 diff --git a/vendor/gopkg.in/go-playground/validator.v9/baked_in.go b/vendor/github.com/go-playground/validator/v10/baked_in.go similarity index 75% rename from vendor/gopkg.in/go-playground/validator.v9/baked_in.go rename to vendor/github.com/go-playground/validator/v10/baked_in.go index 95d613c..dd25705 100644 --- a/vendor/gopkg.in/go-playground/validator.v9/baked_in.go +++ b/vendor/github.com/go-playground/validator/v10/baked_in.go @@ -4,6 +4,8 @@ import ( "bytes" "context" "crypto/sha256" + "encoding/hex" + "encoding/json" "fmt" "net" "net/url" @@ -15,6 +17,9 @@ import ( "time" "unicode/utf8" + "golang.org/x/crypto/sha3" + "golang.org/x/text/language" + urn "github.com/leodido/go-urn" ) @@ -55,116 +60,136 @@ var ( // defines a common or complex set of validation(s) to simplify // adding validation to structs. bakedInAliases = map[string]string{ - "iscolor": "hexcolor|rgb|rgba|hsl|hsla", + "iscolor": "hexcolor|rgb|rgba|hsl|hsla", + "country_code": "iso3166_1_alpha2|iso3166_1_alpha3|iso3166_1_alpha_numeric", } // BakedInValidators is the default map of ValidationFunc // you can add, remove or even replace items to suite your needs, // or even disregard and use your own map if so desired. bakedInValidators = map[string]Func{ - "required": hasValue, - "required_with": requiredWith, - "required_with_all": requiredWithAll, - "required_without": requiredWithout, - "required_without_all": requiredWithoutAll, - "isdefault": isDefault, - "len": hasLengthOf, - "min": hasMinOf, - "max": hasMaxOf, - "eq": isEq, - "ne": isNe, - "lt": isLt, - "lte": isLte, - "gt": isGt, - "gte": isGte, - "eqfield": isEqField, - "eqcsfield": isEqCrossStructField, - "necsfield": isNeCrossStructField, - "gtcsfield": isGtCrossStructField, - "gtecsfield": isGteCrossStructField, - "ltcsfield": isLtCrossStructField, - "ltecsfield": isLteCrossStructField, - "nefield": isNeField, - "gtefield": isGteField, - "gtfield": isGtField, - "ltefield": isLteField, - "ltfield": isLtField, - "fieldcontains": fieldContains, - "fieldexcludes": fieldExcludes, - "alpha": isAlpha, - "alphanum": isAlphanum, - "alphaunicode": isAlphaUnicode, - "alphanumunicode": isAlphanumUnicode, - "numeric": isNumeric, - "number": isNumber, - "hexadecimal": isHexadecimal, - "hexcolor": isHEXColor, - "rgb": isRGB, - "rgba": isRGBA, - "hsl": isHSL, - "hsla": isHSLA, - "email": isEmail, - "url": isURL, - "uri": isURI, - "urn_rfc2141": isUrnRFC2141, // RFC 2141 - "file": isFile, - "base64": isBase64, - "base64url": isBase64URL, - "contains": contains, - "containsany": containsAny, - "containsrune": containsRune, - "excludes": excludes, - "excludesall": excludesAll, - "excludesrune": excludesRune, - "startswith": startsWith, - "endswith": endsWith, - "isbn": isISBN, - "isbn10": isISBN10, - "isbn13": isISBN13, - "eth_addr": isEthereumAddress, - "btc_addr": isBitcoinAddress, - "btc_addr_bech32": isBitcoinBech32Address, - "uuid": isUUID, - "uuid3": isUUID3, - "uuid4": isUUID4, - "uuid5": isUUID5, - "uuid_rfc4122": isUUIDRFC4122, - "uuid3_rfc4122": isUUID3RFC4122, - "uuid4_rfc4122": isUUID4RFC4122, - "uuid5_rfc4122": isUUID5RFC4122, - "ascii": isASCII, - "printascii": isPrintableASCII, - "multibyte": hasMultiByteCharacter, - "datauri": isDataURI, - "latitude": isLatitude, - "longitude": isLongitude, - "ssn": isSSN, - "ipv4": isIPv4, - "ipv6": isIPv6, - "ip": isIP, - "cidrv4": isCIDRv4, - "cidrv6": isCIDRv6, - "cidr": isCIDR, - "tcp4_addr": isTCP4AddrResolvable, - "tcp6_addr": isTCP6AddrResolvable, - "tcp_addr": isTCPAddrResolvable, - "udp4_addr": isUDP4AddrResolvable, - "udp6_addr": isUDP6AddrResolvable, - "udp_addr": isUDPAddrResolvable, - "ip4_addr": isIP4AddrResolvable, - "ip6_addr": isIP6AddrResolvable, - "ip_addr": isIPAddrResolvable, - "unix_addr": isUnixAddrResolvable, - "mac": isMAC, - "hostname": isHostnameRFC952, // RFC 952 - "hostname_rfc1123": isHostnameRFC1123, // RFC 1123 - "fqdn": isFQDN, - "unique": isUnique, - "oneof": isOneOf, - "html": isHTML, - "html_encoded": isHTMLEncoded, - "url_encoded": isURLEncoded, - "dir": isDir, + "required": hasValue, + "required_if": requiredIf, + "required_unless": requiredUnless, + "required_with": requiredWith, + "required_with_all": requiredWithAll, + "required_without": requiredWithout, + "required_without_all": requiredWithoutAll, + "excluded_with": excludedWith, + "excluded_with_all": excludedWithAll, + "excluded_without": excludedWithout, + "excluded_without_all": excludedWithoutAll, + "isdefault": isDefault, + "len": hasLengthOf, + "min": hasMinOf, + "max": hasMaxOf, + "eq": isEq, + "ne": isNe, + "lt": isLt, + "lte": isLte, + "gt": isGt, + "gte": isGte, + "eqfield": isEqField, + "eqcsfield": isEqCrossStructField, + "necsfield": isNeCrossStructField, + "gtcsfield": isGtCrossStructField, + "gtecsfield": isGteCrossStructField, + "ltcsfield": isLtCrossStructField, + "ltecsfield": isLteCrossStructField, + "nefield": isNeField, + "gtefield": isGteField, + "gtfield": isGtField, + "ltefield": isLteField, + "ltfield": isLtField, + "fieldcontains": fieldContains, + "fieldexcludes": fieldExcludes, + "alpha": isAlpha, + "alphanum": isAlphanum, + "alphaunicode": isAlphaUnicode, + "alphanumunicode": isAlphanumUnicode, + "numeric": isNumeric, + "number": isNumber, + "hexadecimal": isHexadecimal, + "hexcolor": isHEXColor, + "rgb": isRGB, + "rgba": isRGBA, + "hsl": isHSL, + "hsla": isHSLA, + "e164": isE164, + "email": isEmail, + "url": isURL, + "uri": isURI, + "urn_rfc2141": isUrnRFC2141, // RFC 2141 + "file": isFile, + "base64": isBase64, + "base64url": isBase64URL, + "contains": contains, + "containsany": containsAny, + "containsrune": containsRune, + "excludes": excludes, + "excludesall": excludesAll, + "excludesrune": excludesRune, + "startswith": startsWith, + "endswith": endsWith, + "startsnotwith": startsNotWith, + "endsnotwith": endsNotWith, + "isbn": isISBN, + "isbn10": isISBN10, + "isbn13": isISBN13, + "eth_addr": isEthereumAddress, + "btc_addr": isBitcoinAddress, + "btc_addr_bech32": isBitcoinBech32Address, + "uuid": isUUID, + "uuid3": isUUID3, + "uuid4": isUUID4, + "uuid5": isUUID5, + "uuid_rfc4122": isUUIDRFC4122, + "uuid3_rfc4122": isUUID3RFC4122, + "uuid4_rfc4122": isUUID4RFC4122, + "uuid5_rfc4122": isUUID5RFC4122, + "ascii": isASCII, + "printascii": isPrintableASCII, + "multibyte": hasMultiByteCharacter, + "datauri": isDataURI, + "latitude": isLatitude, + "longitude": isLongitude, + "ssn": isSSN, + "ipv4": isIPv4, + "ipv6": isIPv6, + "ip": isIP, + "cidrv4": isCIDRv4, + "cidrv6": isCIDRv6, + "cidr": isCIDR, + "tcp4_addr": isTCP4AddrResolvable, + "tcp6_addr": isTCP6AddrResolvable, + "tcp_addr": isTCPAddrResolvable, + "udp4_addr": isUDP4AddrResolvable, + "udp6_addr": isUDP6AddrResolvable, + "udp_addr": isUDPAddrResolvable, + "ip4_addr": isIP4AddrResolvable, + "ip6_addr": isIP6AddrResolvable, + "ip_addr": isIPAddrResolvable, + "unix_addr": isUnixAddrResolvable, + "mac": isMAC, + "hostname": isHostnameRFC952, // RFC 952 + "hostname_rfc1123": isHostnameRFC1123, // RFC 1123 + "fqdn": isFQDN, + "unique": isUnique, + "oneof": isOneOf, + "html": isHTML, + "html_encoded": isHTMLEncoded, + "url_encoded": isURLEncoded, + "dir": isDir, + "json": isJSON, + "hostname_port": isHostnamePort, + "lowercase": isLowercase, + "uppercase": isUppercase, + "datetime": isDatetime, + "timezone": isTimeZone, + "iso3166_1_alpha2": isIso3166Alpha2, + "iso3166_1_alpha3": isIso3166Alpha3, + "iso3166_1_alpha_numeric": isIso3166AlphaNumeric, + "bcp47_language_tag": isBCP47LanguageTag, } ) @@ -177,7 +202,10 @@ func parseOneOfParam2(s string) []string { oneofValsCacheRWLock.RUnlock() if !ok { oneofValsCacheRWLock.Lock() - vals = strings.Fields(s) + vals = splitParamsRegex.FindAllString(s, -1) + for i := 0; i < len(vals); i++ { + vals[i] = strings.Replace(vals[i], "'", "", -1) + } oneofValsCache[s] = vals oneofValsCacheRWLock.Unlock() } @@ -224,14 +252,38 @@ func isOneOf(fl FieldLevel) bool { func isUnique(fl FieldLevel) bool { field := fl.Field() + param := fl.Param() v := reflect.ValueOf(struct{}{}) switch field.Kind() { case reflect.Slice, reflect.Array: - m := reflect.MakeMap(reflect.MapOf(field.Type().Elem(), v.Type())) + elem := field.Type().Elem() + if elem.Kind() == reflect.Ptr { + elem = elem.Elem() + } + + if param == "" { + m := reflect.MakeMap(reflect.MapOf(elem, v.Type())) + for i := 0; i < field.Len(); i++ { + m.SetMapIndex(reflect.Indirect(field.Index(i)), v) + } + return field.Len() == m.Len() + } + + sf, ok := elem.FieldByName(param) + if !ok { + panic(fmt.Sprintf("Bad field name %s", param)) + } + + sfTyp := sf.Type + if sfTyp.Kind() == reflect.Ptr { + sfTyp = sfTyp.Elem() + } + + m := reflect.MakeMap(reflect.MapOf(sfTyp, v.Type())) for i := 0; i < field.Len(); i++ { - m.SetMapIndex(field.Index(i), v) + m.SetMapIndex(reflect.Indirect(reflect.Indirect(field.Index(i)).FieldByName(param)), v) } return field.Len() == m.Len() case reflect.Map: @@ -489,7 +541,7 @@ func isISBN10(fl FieldLevel) bool { return checksum%11 == 0 } -// IsEthereumAddress is the validation function for validating if the field's value is a valid ethereum address based currently only on the format +// IsEthereumAddress is the validation function for validating if the field's value is a valid Ethereum address. func isEthereumAddress(fl FieldLevel) bool { address := fl.Field().String() @@ -501,7 +553,21 @@ func isEthereumAddress(fl FieldLevel) bool { return true } - // checksum validation is blocked by https://github.com/golang/crypto/pull/28 + // Checksum validation. Reference: https://github.com/ethereum/EIPs/blob/master/EIPS/eip-55.md + address = address[2:] // Skip "0x" prefix. + h := sha3.NewLegacyKeccak256() + // hash.Hash's io.Writer implementation says it never returns an error. https://golang.org/pkg/hash/#Hash + _, _ = h.Write([]byte(strings.ToLower(address))) + hash := hex.EncodeToString(h.Sum(nil)) + + for i := 0; i < len(address); i++ { + if address[i] <= '9' { // Skip 0-9 digits: they don't have upper/lower-case. + continue + } + if hash[i] > '7' && address[i] >= 'a' || hash[i] <= '7' && address[i] <= 'F' { + return false + } + } return true } @@ -666,6 +732,16 @@ func endsWith(fl FieldLevel) bool { return strings.HasSuffix(fl.Field().String(), fl.Param()) } +// StartsNotWith is the validation function for validating that the field's value does not start with the text specified within the param. +func startsNotWith(fl FieldLevel) bool { + return !startsWith(fl) +} + +// EndsNotWith is the validation function for validating that the field's value does not end with the text specified within the param. +func endsNotWith(fl FieldLevel) bool { + return !endsWith(fl) +} + // FieldContains is the validation function for validating if the current field's value contains the field specified by the param's value. func fieldContains(fl FieldLevel) bool { field := fl.Field() @@ -717,6 +793,9 @@ func isNeField(fl FieldLevel) bool { case reflect.Slice, reflect.Map, reflect.Array: return int64(field.Len()) != int64(currentField.Len()) + case reflect.Bool: + return field.Bool() != currentField.Bool() + case reflect.Struct: fieldType := field.Type() @@ -1093,7 +1172,7 @@ func isEq(fl FieldLevel) bool { return int64(field.Len()) == p case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: - p := asInt(param) + p := asIntFromType(field.Type(), param) return field.Int() == p @@ -1106,6 +1185,11 @@ func isEq(fl FieldLevel) bool { p := asFloat(param) return field.Float() == p + + case reflect.Bool: + p := asBool(param) + + return field.Bool() == p } panic(fmt.Sprintf("Bad field type %T", field.Interface())) @@ -1178,7 +1262,7 @@ func isURL(fl FieldLevel) bool { return false } - return err == nil + return true } panic(fmt.Sprintf("Bad field type %T", field.Interface())) @@ -1219,6 +1303,11 @@ func isFile(fl FieldLevel) bool { panic(fmt.Sprintf("Bad field type %T", field.Interface())) } +// IsE164 is the validation function for validating if the current field's value is a valid e.164 formatted phone number. +func isE164(fl FieldLevel) bool { + return e164Regex.MatchString(fl.Field().String()) +} + // IsEmail is the validation function for validating if the current field's value is a valid email address. func isEmail(fl FieldLevel) bool { return emailRegex.MatchString(fl.Field().String()) @@ -1316,11 +1405,11 @@ func hasValue(fl FieldLevel) bool { // requireCheckField is a func for check field kind func requireCheckFieldKind(fl FieldLevel, param string, defaultNotFoundValue bool) bool { field := fl.Field() - var ok bool kind := field.Kind() + var nullable, found bool if len(param) > 0 { - field, kind, ok = fl.GetStructFieldOKAdvanced(fl.Parent(), param) - if !ok { + field, kind, nullable, found = fl.GetStructFieldOKAdvanced2(fl.Parent(), param) + if !found { return defaultNotFoundValue } } @@ -1328,10 +1417,82 @@ func requireCheckFieldKind(fl FieldLevel, param string, defaultNotFoundValue boo case reflect.Invalid: return defaultNotFoundValue case reflect.Slice, reflect.Map, reflect.Ptr, reflect.Interface, reflect.Chan, reflect.Func: - return !field.IsNil() + return field.IsNil() default: - return field.IsValid() && field.Interface() != reflect.Zero(field.Type()).Interface() + if nullable && field.Interface() != nil { + return false + } + return field.IsValid() && field.Interface() == reflect.Zero(field.Type()).Interface() + } +} + +// requireCheckFieldValue is a func for check field value +func requireCheckFieldValue(fl FieldLevel, param string, value string, defaultNotFoundValue bool) bool { + field, kind, _, found := fl.GetStructFieldOKAdvanced2(fl.Parent(), param) + if !found { + return defaultNotFoundValue + } + + switch kind { + + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + return field.Int() == asInt(value) + + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + return field.Uint() == asUint(value) + + case reflect.Float32, reflect.Float64: + return field.Float() == asFloat(value) + + case reflect.Slice, reflect.Map, reflect.Array: + return int64(field.Len()) == asInt(value) + } + + // default reflect.String: + return field.String() == value +} + +// requiredIf is the validation function +// The field under validation must be present and not empty only if all the other specified fields are equal to the value following with the specified field. +func requiredIf(fl FieldLevel) bool { + params := parseOneOfParam2(fl.Param()) + if len(params)%2 != 0 { + panic(fmt.Sprintf("Bad param number for required_if %s", fl.FieldName())) + } + for i := 0; i < len(params); i += 2 { + if !requireCheckFieldValue(fl, params[i], params[i+1], false) { + return true + } + } + return hasValue(fl) +} + +// requiredUnless is the validation function +// The field under validation must be present and not empty only unless all the other specified fields are equal to the value following with the specified field. +func requiredUnless(fl FieldLevel) bool { + params := parseOneOfParam2(fl.Param()) + if len(params)%2 != 0 { + panic(fmt.Sprintf("Bad param number for required_unless %s", fl.FieldName())) + } + + for i := 0; i < len(params); i += 2 { + if requireCheckFieldValue(fl, params[i], params[i+1], false) { + return true + } + } + return hasValue(fl) +} + +// ExcludedWith is the validation function +// The field under validation must not be present or is empty if any of the other specified fields are present. +func excludedWith(fl FieldLevel) bool { + params := parseOneOfParam2(fl.Param()) + for _, param := range params { + if !requireCheckFieldKind(fl, param, true) { + return !hasValue(fl) + } } + return true } // RequiredWith is the validation function @@ -1339,35 +1500,65 @@ func requireCheckFieldKind(fl FieldLevel, param string, defaultNotFoundValue boo func requiredWith(fl FieldLevel) bool { params := parseOneOfParam2(fl.Param()) for _, param := range params { - if requireCheckFieldKind(fl, param, false) { + if !requireCheckFieldKind(fl, param, true) { return hasValue(fl) } } return true } +// ExcludedWithAll is the validation function +// The field under validation must not be present or is empty if all of the other specified fields are present. +func excludedWithAll(fl FieldLevel) bool { + params := parseOneOfParam2(fl.Param()) + for _, param := range params { + if requireCheckFieldKind(fl, param, true) { + return true + } + } + return !hasValue(fl) +} + // RequiredWithAll is the validation function // The field under validation must be present and not empty only if all of the other specified fields are present. func requiredWithAll(fl FieldLevel) bool { params := parseOneOfParam2(fl.Param()) for _, param := range params { - if !requireCheckFieldKind(fl, param, false) { + if requireCheckFieldKind(fl, param, true) { return true } } return hasValue(fl) } +// ExcludedWithout is the validation function +// The field under validation must not be present or is empty when any of the other specified fields are not present. +func excludedWithout(fl FieldLevel) bool { + if requireCheckFieldKind(fl, strings.TrimSpace(fl.Param()), true) { + return !hasValue(fl) + } + return true +} + // RequiredWithout is the validation function // The field under validation must be present and not empty only when any of the other specified fields are not present. func requiredWithout(fl FieldLevel) bool { + if requireCheckFieldKind(fl, strings.TrimSpace(fl.Param()), true) { + return hasValue(fl) + } + return true +} + +// ExcludedWithoutAll is the validation function +// The field under validation must not be present or is empty when all of the other specified fields are not present. +func excludedWithoutAll(fl FieldLevel) bool { params := parseOneOfParam2(fl.Param()) for _, param := range params { if !requireCheckFieldKind(fl, param, true) { - return hasValue(fl) + return true } } - return true + return !hasValue(fl) } // RequiredWithoutAll is the validation function @@ -1375,7 +1566,7 @@ func requiredWithout(fl FieldLevel) bool { func requiredWithoutAll(fl FieldLevel) bool { params := parseOneOfParam2(fl.Param()) for _, param := range params { - if requireCheckFieldKind(fl, param, true) { + if !requireCheckFieldKind(fl, param, true) { return true } } @@ -1495,7 +1686,7 @@ func isGte(fl FieldLevel) bool { return int64(field.Len()) >= p case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: - p := asInt(param) + p := asIntFromType(field.Type(), param) return field.Int() >= p @@ -1542,7 +1733,7 @@ func isGt(fl FieldLevel) bool { return int64(field.Len()) > p case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: - p := asInt(param) + p := asIntFromType(field.Type(), param) return field.Int() > p @@ -1585,7 +1776,7 @@ func hasLengthOf(fl FieldLevel) bool { return int64(field.Len()) == p case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: - p := asInt(param) + p := asIntFromType(field.Type(), param) return field.Int() == p @@ -1721,7 +1912,7 @@ func isLte(fl FieldLevel) bool { return int64(field.Len()) <= p case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: - p := asInt(param) + p := asIntFromType(field.Type(), param) return field.Int() <= p @@ -1768,7 +1959,7 @@ func isLt(fl FieldLevel) bool { return int64(field.Len()) < p case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: - p := asInt(param) + p := asIntFromType(field.Type(), param) return field.Int() < p @@ -1956,12 +2147,7 @@ func isFQDN(fl FieldLevel) bool { return false } - if val[len(val)-1] == '.' { - val = val[0 : len(val)-1] - } - - return strings.ContainsAny(val, ".") && - hostnameRegexRFC952.MatchString(val) + return fqdnRegexRFC1123.MatchString(val) } // IsDir is the validation function for validating if the current field's value is a valid directory. @@ -1979,3 +2165,138 @@ func isDir(fl FieldLevel) bool { panic(fmt.Sprintf("Bad field type %T", field.Interface())) } + +// isJSON is the validation function for validating if the current field's value is a valid json string. +func isJSON(fl FieldLevel) bool { + field := fl.Field() + + if field.Kind() == reflect.String { + val := field.String() + return json.Valid([]byte(val)) + } + + panic(fmt.Sprintf("Bad field type %T", field.Interface())) +} + +// isHostnamePort validates a : combination for fields typically used for socket address. +func isHostnamePort(fl FieldLevel) bool { + val := fl.Field().String() + host, port, err := net.SplitHostPort(val) + if err != nil { + return false + } + // Port must be a iny <= 65535. + if portNum, err := strconv.ParseInt(port, 10, 32); err != nil || portNum > 65535 || portNum < 1 { + return false + } + + // If host is specified, it should match a DNS name + if host != "" { + return hostnameRegexRFC1123.MatchString(host) + } + return true +} + +// isLowercase is the validation function for validating if the current field's value is a lowercase string. +func isLowercase(fl FieldLevel) bool { + field := fl.Field() + + if field.Kind() == reflect.String { + if field.String() == "" { + return false + } + return field.String() == strings.ToLower(field.String()) + } + + panic(fmt.Sprintf("Bad field type %T", field.Interface())) +} + +// isUppercase is the validation function for validating if the current field's value is an uppercase string. +func isUppercase(fl FieldLevel) bool { + field := fl.Field() + + if field.Kind() == reflect.String { + if field.String() == "" { + return false + } + return field.String() == strings.ToUpper(field.String()) + } + + panic(fmt.Sprintf("Bad field type %T", field.Interface())) +} + +// isDatetime is the validation function for validating if the current field's value is a valid datetime string. +func isDatetime(fl FieldLevel) bool { + field := fl.Field() + param := fl.Param() + + if field.Kind() == reflect.String { + _, err := time.Parse(param, field.String()) + + return err == nil + } + + panic(fmt.Sprintf("Bad field type %T", field.Interface())) +} + +// isTimeZone is the validation function for validating if the current field's value is a valid time zone string. +func isTimeZone(fl FieldLevel) bool { + field := fl.Field() + + if field.Kind() == reflect.String { + // empty value is converted to UTC by time.LoadLocation but disallow it as it is not a valid time zone name + if field.String() == "" { + return false + } + + // Local value is converted to the current system time zone by time.LoadLocation but disallow it as it is not a valid time zone name + if strings.ToLower(field.String()) == "local" { + return false + } + + _, err := time.LoadLocation(field.String()) + return err == nil + } + + panic(fmt.Sprintf("Bad field type %T", field.Interface())) +} + +// isIso3166Alpha2 is the validation function for validating if the current field's value is a valid iso3166-1 alpha-2 country code. +func isIso3166Alpha2(fl FieldLevel) bool { + val := fl.Field().String() + return iso3166_1_alpha2[val] +} + +// isIso3166Alpha2 is the validation function for validating if the current field's value is a valid iso3166-1 alpha-3 country code. +func isIso3166Alpha3(fl FieldLevel) bool { + val := fl.Field().String() + return iso3166_1_alpha3[val] +} + +// isIso3166Alpha2 is the validation function for validating if the current field's value is a valid iso3166-1 alpha-numeric country code. +func isIso3166AlphaNumeric(fl FieldLevel) bool { + field := fl.Field() + + var code int + switch field.Kind() { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + code = int(field.Int() % 1000) + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64: + code = int(field.Uint() % 1000) + default: + panic(fmt.Sprintf("Bad field type %T", field.Interface())) + } + return iso3166_1_alpha_numeric[code] +} + +// isBCP47LanguageTag is the validation function for validating if the current field's value is a valid BCP 47 language tag, as parsed by language.Parse +func isBCP47LanguageTag(fl FieldLevel) bool { + field := fl.Field() + + if field.Kind() == reflect.String { + _, err := language.Parse(field.String()) + return err == nil + } + + panic(fmt.Sprintf("Bad field type %T", field.Interface())) +} diff --git a/vendor/gopkg.in/go-playground/validator.v9/cache.go b/vendor/github.com/go-playground/validator/v10/cache.go similarity index 100% rename from vendor/gopkg.in/go-playground/validator.v9/cache.go rename to vendor/github.com/go-playground/validator/v10/cache.go diff --git a/vendor/github.com/go-playground/validator/v10/country_codes.go b/vendor/github.com/go-playground/validator/v10/country_codes.go new file mode 100644 index 0000000..ef81ead --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/country_codes.go @@ -0,0 +1,162 @@ +package validator + +var iso3166_1_alpha2 = map[string]bool{ + // see: https://www.iso.org/iso-3166-country-codes.html + "AF": true, "AX": true, "AL": true, "DZ": true, "AS": true, + "AD": true, "AO": true, "AI": true, "AQ": true, "AG": true, + "AR": true, "AM": true, "AW": true, "AU": true, "AT": true, + "AZ": true, "BS": true, "BH": true, "BD": true, "BB": true, + "BY": true, "BE": true, "BZ": true, "BJ": true, "BM": true, + "BT": true, "BO": true, "BQ": true, "BA": true, "BW": true, + "BV": true, "BR": true, "IO": true, "BN": true, "BG": true, + "BF": true, "BI": true, "KH": true, "CM": true, "CA": true, + "CV": true, "KY": true, "CF": true, "TD": true, "CL": true, + "CN": true, "CX": true, "CC": true, "CO": true, "KM": true, + "CG": true, "CD": true, "CK": true, "CR": true, "CI": true, + "HR": true, "CU": true, "CW": true, "CY": true, "CZ": true, + "DK": true, "DJ": true, "DM": true, "DO": true, "EC": true, + "EG": true, "SV": true, "GQ": true, "ER": true, "EE": true, + "ET": true, "FK": true, "FO": true, "FJ": true, "FI": true, + "FR": true, "GF": true, "PF": true, "TF": true, "GA": true, + "GM": true, "GE": true, "DE": true, "GH": true, "GI": true, + "GR": true, "GL": true, "GD": true, "GP": true, "GU": true, + "GT": true, "GG": true, "GN": true, "GW": true, "GY": true, + "HT": true, "HM": true, "VA": true, "HN": true, "HK": true, + "HU": true, "IS": true, "IN": true, "ID": true, "IR": true, + "IQ": true, "IE": true, "IM": true, "IL": true, "IT": true, + "JM": true, "JP": true, "JE": true, "JO": true, "KZ": true, + "KE": true, "KI": true, "KP": true, "KR": true, "KW": true, + "KG": true, "LA": true, "LV": true, "LB": true, "LS": true, + "LR": true, "LY": true, "LI": true, "LT": true, "LU": true, + "MO": true, "MK": true, "MG": true, "MW": true, "MY": true, + "MV": true, "ML": true, "MT": true, "MH": true, "MQ": true, + "MR": true, "MU": true, "YT": true, "MX": true, "FM": true, + "MD": true, "MC": true, "MN": true, "ME": true, "MS": true, + "MA": true, "MZ": true, "MM": true, "NA": true, "NR": true, + "NP": true, "NL": true, "NC": true, "NZ": true, "NI": true, + "NE": true, "NG": true, "NU": true, "NF": true, "MP": true, + "NO": true, "OM": true, "PK": true, "PW": true, "PS": true, + "PA": true, "PG": true, "PY": true, "PE": true, "PH": true, + "PN": true, "PL": true, "PT": true, "PR": true, "QA": true, + "RE": true, "RO": true, "RU": true, "RW": true, "BL": true, + "SH": true, "KN": true, "LC": true, "MF": true, "PM": true, + "VC": true, "WS": true, "SM": true, "ST": true, "SA": true, + "SN": true, "RS": true, "SC": true, "SL": true, "SG": true, + "SX": true, "SK": true, "SI": true, "SB": true, "SO": true, + "ZA": true, "GS": true, "SS": true, "ES": true, "LK": true, + "SD": true, "SR": true, "SJ": true, "SZ": true, "SE": true, + "CH": true, "SY": true, "TW": true, "TJ": true, "TZ": true, + "TH": true, "TL": true, "TG": true, "TK": true, "TO": true, + "TT": true, "TN": true, "TR": true, "TM": true, "TC": true, + "TV": true, "UG": true, "UA": true, "AE": true, "GB": true, + "US": true, "UM": true, "UY": true, "UZ": true, "VU": true, + "VE": true, "VN": true, "VG": true, "VI": true, "WF": true, + "EH": true, "YE": true, "ZM": true, "ZW": true, +} + +var iso3166_1_alpha3 = map[string]bool{ + // see: https://www.iso.org/iso-3166-country-codes.html + "AFG": true, "ALB": true, "DZA": true, "ASM": true, "AND": true, + "AGO": true, "AIA": true, "ATA": true, "ATG": true, "ARG": true, + "ARM": true, "ABW": true, "AUS": true, "AUT": true, "AZE": true, + "BHS": true, "BHR": true, "BGD": true, "BRB": true, "BLR": true, + "BEL": true, "BLZ": true, "BEN": true, "BMU": true, "BTN": true, + "BOL": true, "BES": true, "BIH": true, "BWA": true, "BVT": true, + "BRA": true, "IOT": true, "BRN": true, "BGR": true, "BFA": true, + "BDI": true, "CPV": true, "KHM": true, "CMR": true, "CAN": true, + "CYM": true, "CAF": true, "TCD": true, "CHL": true, "CHN": true, + "CXR": true, "CCK": true, "COL": true, "COM": true, "COD": true, + "COG": true, "COK": true, "CRI": true, "HRV": true, "CUB": true, + "CUW": true, "CYP": true, "CZE": true, "CIV": true, "DNK": true, + "DJI": true, "DMA": true, "DOM": true, "ECU": true, "EGY": true, + "SLV": true, "GNQ": true, "ERI": true, "EST": true, "SWZ": true, + "ETH": true, "FLK": true, "FRO": true, "FJI": true, "FIN": true, + "FRA": true, "GUF": true, "PYF": true, "ATF": true, "GAB": true, + "GMB": true, "GEO": true, "DEU": true, "GHA": true, "GIB": true, + "GRC": true, "GRL": true, "GRD": true, "GLP": true, "GUM": true, + "GTM": true, "GGY": true, "GIN": true, "GNB": true, "GUY": true, + "HTI": true, "HMD": true, "VAT": true, "HND": true, "HKG": true, + "HUN": true, "ISL": true, "IND": true, "IDN": true, "IRN": true, + "IRQ": true, "IRL": true, "IMN": true, "ISR": true, "ITA": true, + "JAM": true, "JPN": true, "JEY": true, "JOR": true, "KAZ": true, + "KEN": true, "KIR": true, "PRK": true, "KOR": true, "KWT": true, + "KGZ": true, "LAO": true, "LVA": true, "LBN": true, "LSO": true, + "LBR": true, "LBY": true, "LIE": true, "LTU": true, "LUX": true, + "MAC": true, "MDG": true, "MWI": true, "MYS": true, "MDV": true, + "MLI": true, "MLT": true, "MHL": true, "MTQ": true, "MRT": true, + "MUS": true, "MYT": true, "MEX": true, "FSM": true, "MDA": true, + "MCO": true, "MNG": true, "MNE": true, "MSR": true, "MAR": true, + "MOZ": true, "MMR": true, "NAM": true, "NRU": true, "NPL": true, + "NLD": true, "NCL": true, "NZL": true, "NIC": true, "NER": true, + "NGA": true, "NIU": true, "NFK": true, "MKD": true, "MNP": true, + "NOR": true, "OMN": true, "PAK": true, "PLW": true, "PSE": true, + "PAN": true, "PNG": true, "PRY": true, "PER": true, "PHL": true, + "PCN": true, "POL": true, "PRT": true, "PRI": true, "QAT": true, + "ROU": true, "RUS": true, "RWA": true, "REU": true, "BLM": true, + "SHN": true, "KNA": true, "LCA": true, "MAF": true, "SPM": true, + "VCT": true, "WSM": true, "SMR": true, "STP": true, "SAU": true, + "SEN": true, "SRB": true, "SYC": true, "SLE": true, "SGP": true, + "SXM": true, "SVK": true, "SVN": true, "SLB": true, "SOM": true, + "ZAF": true, "SGS": true, "SSD": true, "ESP": true, "LKA": true, + "SDN": true, "SUR": true, "SJM": true, "SWE": true, "CHE": true, + "SYR": true, "TWN": true, "TJK": true, "TZA": true, "THA": true, + "TLS": true, "TGO": true, "TKL": true, "TON": true, "TTO": true, + "TUN": true, "TUR": true, "TKM": true, "TCA": true, "TUV": true, + "UGA": true, "UKR": true, "ARE": true, "GBR": true, "UMI": true, + "USA": true, "URY": true, "UZB": true, "VUT": true, "VEN": true, + "VNM": true, "VGB": true, "VIR": true, "WLF": true, "ESH": true, + "YEM": true, "ZMB": true, "ZWE": true, "ALA": true, +} +var iso3166_1_alpha_numeric = map[int]bool{ + // see: https://www.iso.org/iso-3166-country-codes.html + 4: true, 8: true, 12: true, 16: true, 20: true, + 24: true, 660: true, 10: true, 28: true, 32: true, + 51: true, 533: true, 36: true, 40: true, 31: true, + 44: true, 48: true, 50: true, 52: true, 112: true, + 56: true, 84: true, 204: true, 60: true, 64: true, + 68: true, 535: true, 70: true, 72: true, 74: true, + 76: true, 86: true, 96: true, 100: true, 854: true, + 108: true, 132: true, 116: true, 120: true, 124: true, + 136: true, 140: true, 148: true, 152: true, 156: true, + 162: true, 166: true, 170: true, 174: true, 180: true, + 178: true, 184: true, 188: true, 191: true, 192: true, + 531: true, 196: true, 203: true, 384: true, 208: true, + 262: true, 212: true, 214: true, 218: true, 818: true, + 222: true, 226: true, 232: true, 233: true, 748: true, + 231: true, 238: true, 234: true, 242: true, 246: true, + 250: true, 254: true, 258: true, 260: true, 266: true, + 270: true, 268: true, 276: true, 288: true, 292: true, + 300: true, 304: true, 308: true, 312: true, 316: true, + 320: true, 831: true, 324: true, 624: true, 328: true, + 332: true, 334: true, 336: true, 340: true, 344: true, + 348: true, 352: true, 356: true, 360: true, 364: true, + 368: true, 372: true, 833: true, 376: true, 380: true, + 388: true, 392: true, 832: true, 400: true, 398: true, + 404: true, 296: true, 408: true, 410: true, 414: true, + 417: true, 418: true, 428: true, 422: true, 426: true, + 430: true, 434: true, 438: true, 440: true, 442: true, + 446: true, 450: true, 454: true, 458: true, 462: true, + 466: true, 470: true, 584: true, 474: true, 478: true, + 480: true, 175: true, 484: true, 583: true, 498: true, + 492: true, 496: true, 499: true, 500: true, 504: true, + 508: true, 104: true, 516: true, 520: true, 524: true, + 528: true, 540: true, 554: true, 558: true, 562: true, + 566: true, 570: true, 574: true, 807: true, 580: true, + 578: true, 512: true, 586: true, 585: true, 275: true, + 591: true, 598: true, 600: true, 604: true, 608: true, + 612: true, 616: true, 620: true, 630: true, 634: true, + 642: true, 643: true, 646: true, 638: true, 652: true, + 654: true, 659: true, 662: true, 663: true, 666: true, + 670: true, 882: true, 674: true, 678: true, 682: true, + 686: true, 688: true, 690: true, 694: true, 702: true, + 534: true, 703: true, 705: true, 90: true, 706: true, + 710: true, 239: true, 728: true, 724: true, 144: true, + 729: true, 740: true, 744: true, 752: true, 756: true, + 760: true, 158: true, 762: true, 834: true, 764: true, + 626: true, 768: true, 772: true, 776: true, 780: true, + 788: true, 792: true, 795: true, 796: true, 798: true, + 800: true, 804: true, 784: true, 826: true, 581: true, + 840: true, 858: true, 860: true, 548: true, 862: true, + 704: true, 92: true, 850: true, 876: true, 732: true, + 887: true, 894: true, 716: true, 248: true, +} diff --git a/vendor/gopkg.in/go-playground/validator.v9/doc.go b/vendor/github.com/go-playground/validator/v10/doc.go similarity index 79% rename from vendor/gopkg.in/go-playground/validator.v9/doc.go rename to vendor/github.com/go-playground/validator/v10/doc.go index e0396cb..207d987 100644 --- a/vendor/gopkg.in/go-playground/validator.v9/doc.go +++ b/vendor/github.com/go-playground/validator/v10/doc.go @@ -5,7 +5,7 @@ based on tags. It can also handle Cross-Field and Cross-Struct validation for nested structs and has the ability to dive into arrays and maps of any type. -see more examples https://github.com/go-playground/validator/tree/v9/_examples +see more examples https://github.com/go-playground/validator/tree/master/_examples Validation Functions Return Type error @@ -158,7 +158,7 @@ handy in ignoring embedded structs from being validated. (Usage: -) Or Operator This is the 'or' operator allowing multiple validators to be used and -accepted. (Usage: rbg|rgba) <-- this would allow either rgb or rgba +accepted. (Usage: rgb|rgba) <-- this would allow either rgb or rgba colors to be accepted. This can also be combined with 'and' for example ( Usage: omitempty,rgb|rgba) @@ -245,6 +245,40 @@ ensures the value is not nil. Usage: required +Required If + +The field under validation must be present and not empty only if all +the other specified fields are equal to the value following the specified +field. For strings ensures value is not "". For slices, maps, pointers, +interfaces, channels and functions ensures the value is not nil. + + Usage: required_if + +Examples: + + // require the field if the Field1 is equal to the parameter given: + Usage: required_if=Field1 foobar + + // require the field if the Field1 and Field2 is equal to the value respectively: + Usage: required_if=Field1 foo Field2 bar + +Required Unless + +The field under validation must be present and not empty unless all +the other specified fields are equal to the value following the specified +field. For strings ensures value is not "". For slices, maps, pointers, +interfaces, channels and functions ensures the value is not nil. + + Usage: required_unless + +Examples: + + // require the field unless the Field1 is equal to the parameter given: + Usage: required_unless=Field1 foobar + + // require the field unless the Field1 and Field2 is equal to the value respectively: + Usage: required_unless=Field1 foo Field2 bar + Required With The field under validation must be present and not empty only if any @@ -321,8 +355,17 @@ equal to the parameter given. For strings, it checks that the string length is exactly that number of characters. For slices, arrays, and maps, validates the number of items. +Example #1 + Usage: len=10 +Example #2 (time.Duration) + +For time.Duration, len will ensure that the value is equal to the duration given +in the parameter. + + Usage: len=1h30m + Maximum For numbers, max will ensure that the value is @@ -330,8 +373,17 @@ less than or equal to the parameter given. For strings, it checks that the string length is at most that number of characters. For slices, arrays, and maps, validates the number of items. +Example #1 + Usage: max=10 +Example #2 (time.Duration) + +For time.Duration, max will ensure that the value is less than or equal to the +duration given in the parameter. + + Usage: max=1h30m + Minimum For numbers, min will ensure that the value is @@ -339,32 +391,61 @@ greater or equal to the parameter given. For strings, it checks that the string length is at least that number of characters. For slices, arrays, and maps, validates the number of items. +Example #1 + Usage: min=10 +Example #2 (time.Duration) + +For time.Duration, min will ensure that the value is greater than or equal to +the duration given in the parameter. + + Usage: min=1h30m + Equals For strings & numbers, eq will ensure that the value is equal to the parameter given. For slices, arrays, and maps, validates the number of items. +Example #1 + Usage: eq=10 +Example #2 (time.Duration) + +For time.Duration, eq will ensure that the value is equal to the duration given +in the parameter. + + Usage: eq=1h30m + Not Equal For strings & numbers, ne will ensure that the value is not equal to the parameter given. For slices, arrays, and maps, validates the number of items. +Example #1 + Usage: ne=10 +Example #2 (time.Duration) + +For time.Duration, ne will ensure that the value is not equal to the duration +given in the parameter. + + Usage: ne=1h30m + One Of For strings, ints, and uints, oneof will ensure that the value is one of the values in the parameter. The parameter should be -a list of values separated by whitespace. Values may be -strings or numbers. +a list of values separated by whitespace. Values may be +strings or numbers. To match strings with spaces in them, include +the target string between single quotes. Usage: oneof=red green + oneof='red green' 'blue yellow' oneof=5 7 9 Greater Than @@ -384,11 +465,17 @@ For time.Time ensures the time value is greater than time.Now.UTC(). Usage: gt +Example #3 (time.Duration) + +For time.Duration, gt will ensure that the value is greater than the duration +given in the parameter. + + Usage: gt=1h30m + Greater Than or Equal Same as 'min' above. Kept both to make terminology with 'len' easier. - Example #1 Usage: gte=10 @@ -399,6 +486,13 @@ For time.Time ensures the time value is greater than or equal to time.Now.UTC(). Usage: gte +Example #3 (time.Duration) + +For time.Duration, gte will ensure that the value is greater than or equal to +the duration given in the parameter. + + Usage: gte=1h30m + Less Than For numbers, this will ensure that the value is less than the parameter given. @@ -410,10 +504,18 @@ Example #1 Usage: lt=10 Example #2 (time.Time) + For time.Time ensures the time value is less than time.Now.UTC(). Usage: lt +Example #3 (time.Duration) + +For time.Duration, lt will ensure that the value is less than the duration given +in the parameter. + + Usage: lt=1h30m + Less Than or Equal Same as 'max' above. Kept both to make terminology with 'len' easier. @@ -428,6 +530,13 @@ For time.Time ensures the time value is less than or equal to time.Now.UTC(). Usage: lte +Example #3 (time.Duration) + +For time.Duration, lte will ensure that the value is less than or equal to the +duration given in the parameter. + + Usage: lte=1h30m + Field Equals Another Field This will validate the field value against another fields value either within @@ -474,9 +583,9 @@ relative to the top level struct. Field Greater Than Another Field -Only valid for Numbers and time.Time types, this will validate the field value -against another fields value either within a struct or passed in field. -usage examples are for validation of a Start and End date: +Only valid for Numbers, time.Duration and time.Time types, this will validate +the field value against another fields value either within a struct or passed in +field. usage examples are for validation of a Start and End date: Example #1: @@ -488,7 +597,6 @@ Example #2: // Validating by field: validate.VarWithValue(start, end, "gtfield") - Field Greater Than Another Relative Field This does the same as gtfield except that it validates the field provided @@ -498,9 +606,9 @@ relative to the top level struct. Field Greater Than or Equal To Another Field -Only valid for Numbers and time.Time types, this will validate the field value -against another fields value either within a struct or passed in field. -usage examples are for validation of a Start and End date: +Only valid for Numbers, time.Duration and time.Time types, this will validate +the field value against another fields value either within a struct or passed in +field. usage examples are for validation of a Start and End date: Example #1: @@ -521,9 +629,9 @@ to the top level struct. Less Than Another Field -Only valid for Numbers and time.Time types, this will validate the field value -against another fields value either within a struct or passed in field. -usage examples are for validation of a Start and End date: +Only valid for Numbers, time.Duration and time.Time types, this will validate +the field value against another fields value either within a struct or passed in +field. usage examples are for validation of a Start and End date: Example #1: @@ -544,9 +652,9 @@ to the top level struct. Less Than or Equal To Another Field -Only valid for Numbers and time.Time types, this will validate the field value -against another fields value either within a struct or passed in field. -usage examples are for validation of a Start and End date: +Only valid for Numbers, time.Duration and time.Time types, this will validate +the field value against another fields value either within a struct or passed in +field. usage examples are for validation of a Start and End date: Example #1: @@ -585,9 +693,15 @@ Unique For arrays & slices, unique will ensure that there are no duplicates. For maps, unique will ensure that there are no duplicate values. +For slices of struct, unique will ensure that there are no duplicate values +in a field of the struct specified via a parameter. + // For arrays, slices, and maps: Usage: unique + // For slices of struct: + Usage: unique=field + Alpha Only This validates that a string value contains ASCII alpha characters only @@ -612,6 +726,13 @@ This validates that a string value contains unicode alphanumeric characters only Usage: alphanumunicode +Number + +This validates that a string value contains number values only. +For integers or float it returns true. + + Usage: number + Numeric This validates that a string value contains a basic numeric value. @@ -633,6 +754,18 @@ hashtag (#) Usage: hexcolor +Lowercase String + +This validates that a string value contains only lowercase characters. An empty string is not a valid lowercase string. + + Usage: lowercase + +Uppercase String + +This validates that a string value contains only uppercase characters. An empty string is not a valid uppercase string. + + Usage: uppercase + RGB String This validates that a string value contains a valid rgb color @@ -657,6 +790,13 @@ This validates that a string value contains a valid hsla color Usage: hsla +E.164 Phone Number String + +This validates that a string value contains a valid E.164 Phone number +https://en.wikipedia.org/wiki/E.164 (ex. +1123456789) + + Usage: e164 + E-mail String This validates that a string value contains a valid email @@ -665,6 +805,12 @@ does any email provider accept all possibilities. Usage: email +JSON String + +This validates that a string value is valid JSON + + Usage: json + File path This validates that a string value contains a valid file path and that @@ -733,8 +879,7 @@ Special thanks to Pieter Wuille for providng reference implementations. Ethereum Address This validates that a string value contains a valid ethereum address. -The format of the string is checked to ensure it matches the standard Ethereum address format -Full validation is blocked by https://github.com/golang/crypto/pull/28 +The format of the string is checked to ensure it matches the standard Ethereum address format. Usage: eth_addr @@ -788,6 +933,18 @@ This validates that a string value ends with the supplied string value Usage: endswith=goodbye +Does Not Start With + +This validates that a string value does not start with the supplied string value + + Usage: startsnotwith=hello + +Does Not End With + +This validates that a string value does not end with the supplied string value + + Usage: endsnotwith=goodbye + International Standard Book Number This validates that a string value contains a valid isbn10 or isbn13 value. @@ -1029,6 +1186,57 @@ This is done using os.Stat, which is a platform independent function. Usage: dir +HostPort + +This validates that a string value contains a valid DNS hostname and port that +can be used to valiate fields typically passed to sockets and connections. + + Usage: hostname_port + +Datetime + +This validates that a string value is a valid datetime based on the supplied datetime format. +Supplied format must match the official Go time format layout as documented in https://golang.org/pkg/time/ + + Usage: datetime=2006-01-02 + +Iso3166-1 alpha-2 + +This validates that a string value is a valid country code based on iso3166-1 alpha-2 standard. +see: https://www.iso.org/iso-3166-country-codes.html + + Usage: iso3166_1_alpha2 + +Iso3166-1 alpha-3 + +This validates that a string value is a valid country code based on iso3166-1 alpha-3 standard. +see: https://www.iso.org/iso-3166-country-codes.html + + Usage: iso3166_1_alpha3 + +Iso3166-1 alpha-numeric + +This validates that a string value is a valid country code based on iso3166-1 alpha-numeric standard. +see: https://www.iso.org/iso-3166-country-codes.html + + Usage: iso3166_1_alpha3 + +BCP 47 Language Tag + +This validates that a string value is a valid BCP 47 language tag, as parsed by language.Parse. +More information on https://pkg.go.dev/golang.org/x/text/language + + Usage: bcp47_language_tag + +TimeZone + +This validates that a string value is a valid time zone based on the time zone database present on the system. +Although empty value and Local value are allowed by time.LoadLocation golang function, they are not allowed by this validator. +More information on https://golang.org/pkg/time/#LoadLocation + + Usage: timezone + + Alias Validators and Tags NOTE: When returning an error, the tag returned in "FieldError" will be @@ -1040,6 +1248,8 @@ Here is a list of the current built in alias tags: "iscolor" alias is "hexcolor|rgb|rgba|hsl|hsla" (Usage: iscolor) + "country_code" + alias is "iso3166_1_alpha2|iso3166_1_alpha3|iso3166_1_alpha_numeric" (Usage: country_code) Validator notes: @@ -1058,27 +1268,14 @@ Validator notes: And the best reason, you can submit a pull request and we can keep on adding to the validation library of this package! -Panics - -This package panics when bad input is provided, this is by design, bad code like -that should not make it to production. - - type Test struct { - TestField string `validate:"nonexistantfunction=1"` - } - - t := &Test{ - TestField: "Test" - } - - validate.Struct(t) // this will panic - Non standard validators A collection of validation rules that are frequently needed but are more complex than the ones found in the baked in validators. -A non standard validator must be registered manually using any tag you like. -See below examples of registration and use. +A non standard validator must be registered manually like you would +with your own custom validation functions. + +Example of registration and use: type Test struct { TestField string `validate:"yourtag"` @@ -1089,7 +1286,9 @@ See below examples of registration and use. } validate := validator.New() - validate.RegisterValidation("yourtag", validations.ValidatorName) + validate.RegisterValidation("yourtag", validators.NotBlank) + +Here is a list of the current non standard validators: NotBlank This validates that the value is not blank or with length zero. @@ -1097,5 +1296,20 @@ See below examples of registration and use. ensures they don't have zero length. For others, a non empty value is required. Usage: notblank + +Panics + +This package panics when bad input is provided, this is by design, bad code like +that should not make it to production. + + type Test struct { + TestField string `validate:"nonexistantfunction=1"` + } + + t := &Test{ + TestField: "Test" + } + + validate.Struct(t) // this will panic */ package validator diff --git a/vendor/gopkg.in/go-playground/validator.v9/errors.go b/vendor/github.com/go-playground/validator/v10/errors.go similarity index 87% rename from vendor/gopkg.in/go-playground/validator.v9/errors.go rename to vendor/github.com/go-playground/validator/v10/errors.go index 46c24c9..f6e72da 100644 --- a/vendor/gopkg.in/go-playground/validator.v9/errors.go +++ b/vendor/github.com/go-playground/validator/v10/errors.go @@ -99,7 +99,7 @@ type FieldError interface { ActualTag() string // returns the namespace for the field error, with the tag - // name taking precedence over the fields actual name. + // name taking precedence over the field's actual name. // // eg. JSON name "User.fname" // @@ -109,29 +109,29 @@ type FieldError interface { // using validate.Field(...) as there is no way to extract it's name Namespace() string - // returns the namespace for the field error, with the fields + // returns the namespace for the field error, with the field's // actual name. // // eq. "User.FirstName" see Namespace for comparison // // NOTE: this field can be blank when validating a single primitive field - // using validate.Field(...) as there is no way to extract it's name + // using validate.Field(...) as there is no way to extract its name StructNamespace() string // returns the fields name with the tag name taking precedence over the - // fields actual name. + // field's actual name. // // eq. JSON name "fname" // see StructField for comparison Field() string - // returns the fields actual name from the struct, when able to determine. + // returns the field's actual name from the struct, when able to determine. // // eq. "FirstName" // see Field for comparison StructField() string - // returns the actual fields value in case needed for creating the error + // returns the actual field's value in case needed for creating the error // message Value() interface{} @@ -146,7 +146,7 @@ type FieldError interface { // Type returns the Field's reflect Type // - // // eg. time.Time's type is time.Time + // eg. time.Time's type is time.Time Type() reflect.Type // returns the FieldError's translated error @@ -155,6 +155,9 @@ type FieldError interface { // NOTE: if no registered translator can be found it returns the same as // calling fe.Error() Translate(ut ut.Translator) string + + // Error returns the FieldError's message + Error() string } // compile time interface checks @@ -190,19 +193,19 @@ func (fe *fieldError) ActualTag() string { } // Namespace returns the namespace for the field error, with the tag -// name taking precedence over the fields actual name. +// name taking precedence over the field's actual name. func (fe *fieldError) Namespace() string { return fe.ns } -// StructNamespace returns the namespace for the field error, with the fields +// StructNamespace returns the namespace for the field error, with the field's // actual name. func (fe *fieldError) StructNamespace() string { return fe.structNs } -// Field returns the fields name with the tag name taking precedence over the -// fields actual name. +// Field returns the field's name with the tag name taking precedence over the +// field's actual name. func (fe *fieldError) Field() string { return fe.ns[len(fe.ns)-int(fe.fieldLen):] @@ -218,13 +221,13 @@ func (fe *fieldError) Field() string { // return fld } -// returns the fields actual name from the struct, when able to determine. +// returns the field's actual name from the struct, when able to determine. func (fe *fieldError) StructField() string { // return fe.structField return fe.structNs[len(fe.structNs)-int(fe.structfieldLen):] } -// Value returns the actual fields value in case needed for creating the error +// Value returns the actual field's value in case needed for creating the error // message func (fe *fieldError) Value() interface{} { return fe.value @@ -254,8 +257,8 @@ func (fe *fieldError) Error() string { // Translate returns the FieldError's translated error // from the provided 'ut.Translator' and registered 'TranslationFunc' // -// NOTE: is not registered translation can be found it returns the same -// as calling fe.Error() +// NOTE: if no registered translation can be found, it returns the original +// untranslated error message. func (fe *fieldError) Translate(ut ut.Translator) string { m, ok := fe.v.transTagFunc[ut] diff --git a/vendor/gopkg.in/go-playground/validator.v9/field_level.go b/vendor/github.com/go-playground/validator/v10/field_level.go similarity index 56% rename from vendor/gopkg.in/go-playground/validator.v9/field_level.go rename to vendor/github.com/go-playground/validator/v10/field_level.go index 24bc134..f0e2a9a 100644 --- a/vendor/gopkg.in/go-playground/validator.v9/field_level.go +++ b/vendor/github.com/go-playground/validator/v10/field_level.go @@ -5,7 +5,6 @@ import "reflect" // FieldLevel contains all the information and helper functions // to validate a field type FieldLevel interface { - // returns the top level struct, if any Top() reflect.Value @@ -26,6 +25,9 @@ type FieldLevel interface { // returns param for validation against current field Param() string + // GetTag returns the current validations tag name + GetTag() string + // ExtractType gets the actual underlying type of field value. // It will dive into pointers, customTypes and return you the // underlying value and it's kind. @@ -37,11 +39,27 @@ type FieldLevel interface { // // NOTE: when not successful ok will be false, this can happen when a nested struct is nil and so the field // could not be retrieved because it didn't exist. + // + // Deprecated: Use GetStructFieldOK2() instead which also return if the value is nullable. GetStructFieldOK() (reflect.Value, reflect.Kind, bool) // GetStructFieldOKAdvanced is the same as GetStructFieldOK except that it accepts the parent struct to start looking for // the field and namespace allowing more extensibility for validators. + // + // Deprecated: Use GetStructFieldOKAdvanced2() instead which also return if the value is nullable. GetStructFieldOKAdvanced(val reflect.Value, namespace string) (reflect.Value, reflect.Kind, bool) + + // traverses the parent struct to retrieve a specific field denoted by the provided namespace + // in the param and returns the field, field kind, if it's a nullable type and whether is was successful in retrieving + // the field at all. + // + // NOTE: when not successful ok will be false, this can happen when a nested struct is nil and so the field + // could not be retrieved because it didn't exist. + GetStructFieldOK2() (reflect.Value, reflect.Kind, bool, bool) + + // GetStructFieldOKAdvanced is the same as GetStructFieldOK except that it accepts the parent struct to start looking for + // the field and namespace allowing more extensibility for validators. + GetStructFieldOKAdvanced2(val reflect.Value, namespace string) (reflect.Value, reflect.Kind, bool, bool) } var _ FieldLevel = new(validate) @@ -52,11 +70,16 @@ func (v *validate) Field() reflect.Value { } // FieldName returns the field's name with the tag -// name takeing precedence over the fields actual name. +// name taking precedence over the fields actual name. func (v *validate) FieldName() string { return v.cf.altName } +// GetTag returns the current validations tag name +func (v *validate) GetTag() string { + return v.ct.tag +} + // StructFieldName returns the struct field's name func (v *validate) StructFieldName() string { return v.cf.name @@ -68,12 +91,29 @@ func (v *validate) Param() string { } // GetStructFieldOK returns Param returns param for validation against current field +// +// Deprecated: Use GetStructFieldOK2() instead which also return if the value is nullable. func (v *validate) GetStructFieldOK() (reflect.Value, reflect.Kind, bool) { - return v.getStructFieldOKInternal(v.slflParent, v.ct.param) + current, kind, _, found := v.getStructFieldOKInternal(v.slflParent, v.ct.param) + return current, kind, found } // GetStructFieldOKAdvanced is the same as GetStructFieldOK except that it accepts the parent struct to start looking for // the field and namespace allowing more extensibility for validators. +// +// Deprecated: Use GetStructFieldOKAdvanced2() instead which also return if the value is nullable. func (v *validate) GetStructFieldOKAdvanced(val reflect.Value, namespace string) (reflect.Value, reflect.Kind, bool) { + current, kind, _, found := v.GetStructFieldOKAdvanced2(val, namespace) + return current, kind, found +} + +// GetStructFieldOK returns Param returns param for validation against current field +func (v *validate) GetStructFieldOK2() (reflect.Value, reflect.Kind, bool, bool) { + return v.getStructFieldOKInternal(v.slflParent, v.ct.param) +} + +// GetStructFieldOKAdvanced is the same as GetStructFieldOK except that it accepts the parent struct to start looking for +// the field and namespace allowing more extensibility for validators. +func (v *validate) GetStructFieldOKAdvanced2(val reflect.Value, namespace string) (reflect.Value, reflect.Kind, bool, bool) { return v.getStructFieldOKInternal(val, namespace) } diff --git a/vendor/github.com/go-playground/validator/v10/go.mod b/vendor/github.com/go-playground/validator/v10/go.mod new file mode 100644 index 0000000..53c4820 --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/go.mod @@ -0,0 +1,12 @@ +module github.com/go-playground/validator/v10 + +go 1.13 + +require ( + github.com/go-playground/assert/v2 v2.0.1 + github.com/go-playground/locales v0.13.0 + github.com/go-playground/universal-translator v0.17.0 + github.com/leodido/go-urn v1.2.0 + golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9 + golang.org/x/text v0.3.2 // indirect +) diff --git a/vendor/github.com/go-playground/validator/v10/go.sum b/vendor/github.com/go-playground/validator/v10/go.sum new file mode 100644 index 0000000..4b00cf6 --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/go.sum @@ -0,0 +1,33 @@ +github.com/davecgh/go-spew v1.1.0 h1:ZDRjVQ15GmhC3fiQ8ni8+OwkZQO4DARzQgrnXU1Liz8= +github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= +github.com/go-playground/assert/v2 v2.0.1 h1:MsBgLAaY856+nPRTKrp3/OZK38U/wa0CcBYNjji3q3A= +github.com/go-playground/assert/v2 v2.0.1/go.mod h1:VDjEfimB/XKnb+ZQfWdccd7VUvScMdVu0Titje2rxJ4= +github.com/go-playground/locales v0.13.0 h1:HyWk6mgj5qFqCT5fjGBuRArbVDfE4hi8+e8ceBS/t7Q= +github.com/go-playground/locales v0.13.0/go.mod h1:taPMhCMXrRLJO55olJkUXHZBHCxTMfnGwq/HNwmWNS8= +github.com/go-playground/universal-translator v0.17.0 h1:icxd5fm+REJzpZx7ZfpaD876Lmtgy7VtROAbHHXk8no= +github.com/go-playground/universal-translator v0.17.0/go.mod h1:UkSxE5sNxxRwHyU+Scu5vgOQjsIJAF8j9muTVoKLVtA= +github.com/leodido/go-urn v1.2.0 h1:hpXL4XnriNwQ/ABnpepYM/1vCLWNDfUNts8dX3xTG6Y= +github.com/leodido/go-urn v1.2.0/go.mod h1:+8+nEpDfqqsY+g338gtMEUOtuK+4dEMhiQEgxpxOKII= +github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= +github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= +github.com/stretchr/objx v0.1.0 h1:4G4v2dO3VZwixGIRoQ5Lfboy6nUhCyYzaqnIAPPhYs4= +github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= +github.com/stretchr/testify v1.4.0 h1:2E4SXV/wtOkTonXsotYi4li6zVWxYlZuYNCXe9XRJyk= +github.com/stretchr/testify v1.4.0/go.mod h1:j7eGeouHqKxXV5pUuKE4zz7dFj8WfuZ+81PSLYec5m4= +golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w= +golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9 h1:psW17arqaxU48Z5kZ0CQnkZWQJsqcURM6tKiBApRjXI= +golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto= +golang.org/x/net v0.0.0-20190404232315-eb5bcb51f2a3 h1:0GoQqolDA55aaLxZyTzK/Y2ePZzZTUrRacwib7cNsYQ= +golang.org/x/net v0.0.0-20190404232315-eb5bcb51f2a3/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg= +golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= +golang.org/x/sys v0.0.0-20190412213103-97732733099d h1:+R4KGOnez64A81RvjARKc4UT5/tI9ujCIVX+P5KiHuI= +golang.org/x/sys v0.0.0-20190412213103-97732733099d/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= +golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= +golang.org/x/text v0.3.2 h1:tW2bmiBqwgJj/UpqtC8EpXEZVYOwU0yG4iWbprSVAcs= +golang.org/x/text v0.3.2/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= +golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e h1:FDhOuMEY4JVRztM/gsbk+IKUQ8kj74bxZrgw87eMMVc= +golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= +gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 h1:yhCVgyC4o1eVCa2tZl7eS0r+SDo693bJlVdllGtEeKM= +gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= +gopkg.in/yaml.v2 v2.2.2 h1:ZCJp+EgiOT7lHqUV2J862kp8Qj64Jo6az82+3Td9dZw= +gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= diff --git a/vendor/gopkg.in/go-playground/validator.v9/logo.png b/vendor/github.com/go-playground/validator/v10/logo.png similarity index 100% rename from vendor/gopkg.in/go-playground/validator.v9/logo.png rename to vendor/github.com/go-playground/validator/v10/logo.png diff --git a/vendor/gopkg.in/go-playground/validator.v9/regexes.go b/vendor/github.com/go-playground/validator/v10/regexes.go similarity index 84% rename from vendor/gopkg.in/go-playground/validator.v9/regexes.go rename to vendor/github.com/go-playground/validator/v10/regexes.go index 0253d70..b741f4e 100644 --- a/vendor/gopkg.in/go-playground/validator.v9/regexes.go +++ b/vendor/github.com/go-playground/validator/v10/regexes.go @@ -9,13 +9,14 @@ const ( alphaUnicodeNumericRegexString = "^[\\p{L}\\p{N}]+$" numericRegexString = "^[-+]?[0-9]+(?:\\.[0-9]+)?$" numberRegexString = "^[0-9]+$" - hexadecimalRegexString = "^[0-9a-fA-F]+$" + hexadecimalRegexString = "^(0[xX])?[0-9a-fA-F]+$" hexcolorRegexString = "^#(?:[0-9a-fA-F]{3}|[0-9a-fA-F]{6})$" rgbRegexString = "^rgb\\(\\s*(?:(?:0|[1-9]\\d?|1\\d\\d?|2[0-4]\\d|25[0-5])\\s*,\\s*(?:0|[1-9]\\d?|1\\d\\d?|2[0-4]\\d|25[0-5])\\s*,\\s*(?:0|[1-9]\\d?|1\\d\\d?|2[0-4]\\d|25[0-5])|(?:0|[1-9]\\d?|1\\d\\d?|2[0-4]\\d|25[0-5])%\\s*,\\s*(?:0|[1-9]\\d?|1\\d\\d?|2[0-4]\\d|25[0-5])%\\s*,\\s*(?:0|[1-9]\\d?|1\\d\\d?|2[0-4]\\d|25[0-5])%)\\s*\\)$" rgbaRegexString = "^rgba\\(\\s*(?:(?:0|[1-9]\\d?|1\\d\\d?|2[0-4]\\d|25[0-5])\\s*,\\s*(?:0|[1-9]\\d?|1\\d\\d?|2[0-4]\\d|25[0-5])\\s*,\\s*(?:0|[1-9]\\d?|1\\d\\d?|2[0-4]\\d|25[0-5])|(?:0|[1-9]\\d?|1\\d\\d?|2[0-4]\\d|25[0-5])%\\s*,\\s*(?:0|[1-9]\\d?|1\\d\\d?|2[0-4]\\d|25[0-5])%\\s*,\\s*(?:0|[1-9]\\d?|1\\d\\d?|2[0-4]\\d|25[0-5])%)\\s*,\\s*(?:(?:0.[1-9]*)|[01])\\s*\\)$" hslRegexString = "^hsl\\(\\s*(?:0|[1-9]\\d?|[12]\\d\\d|3[0-5]\\d|360)\\s*,\\s*(?:(?:0|[1-9]\\d?|100)%)\\s*,\\s*(?:(?:0|[1-9]\\d?|100)%)\\s*\\)$" hslaRegexString = "^hsla\\(\\s*(?:0|[1-9]\\d?|[12]\\d\\d|3[0-5]\\d|360)\\s*,\\s*(?:(?:0|[1-9]\\d?|100)%)\\s*,\\s*(?:(?:0|[1-9]\\d?|100)%)\\s*,\\s*(?:(?:0.[1-9]*)|[01])\\s*\\)$" emailRegexString = "^(?:(?:(?:(?:[a-zA-Z]|\\d|[!#\\$%&'\\*\\+\\-\\/=\\?\\^_`{\\|}~]|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])+(?:\\.([a-zA-Z]|\\d|[!#\\$%&'\\*\\+\\-\\/=\\?\\^_`{\\|}~]|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])+)*)|(?:(?:\\x22)(?:(?:(?:(?:\\x20|\\x09)*(?:\\x0d\\x0a))?(?:\\x20|\\x09)+)?(?:(?:[\\x01-\\x08\\x0b\\x0c\\x0e-\\x1f\\x7f]|\\x21|[\\x23-\\x5b]|[\\x5d-\\x7e]|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])|(?:(?:[\\x01-\\x09\\x0b\\x0c\\x0d-\\x7f]|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}]))))*(?:(?:(?:\\x20|\\x09)*(?:\\x0d\\x0a))?(\\x20|\\x09)+)?(?:\\x22))))@(?:(?:(?:[a-zA-Z]|\\d|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])|(?:(?:[a-zA-Z]|\\d|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])(?:[a-zA-Z]|\\d|-|\\.|~|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])*(?:[a-zA-Z]|\\d|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])))\\.)+(?:(?:[a-zA-Z]|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])|(?:(?:[a-zA-Z]|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])(?:[a-zA-Z]|\\d|-|\\.|~|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])*(?:[a-zA-Z]|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])))\\.?$" + e164RegexString = "^\\+[1-9]?[0-9]{7,14}$" base64RegexString = "^(?:[A-Za-z0-9+\\/]{4})*(?:[A-Za-z0-9+\\/]{2}==|[A-Za-z0-9+\\/]{3}=|[A-Za-z0-9+\\/]{4})$" base64URLRegexString = "^(?:[A-Za-z0-9-_]{4})*(?:[A-Za-z0-9-_]{2}==|[A-Za-z0-9-_]{3}=|[A-Za-z0-9-_]{4})$" iSBN10RegexString = "^(?:[0-9]{9}X|[0-9]{10})$" @@ -31,21 +32,23 @@ const ( aSCIIRegexString = "^[\x00-\x7F]*$" printableASCIIRegexString = "^[\x20-\x7E]*$" multibyteRegexString = "[^\x00-\x7F]" - dataURIRegexString = "^data:.+\\/(.+);base64$" + dataURIRegexString = `^data:((?:\w+\/(?:([^;]|;[^;]).)+)?)` latitudeRegexString = "^[-+]?([1-8]?\\d(\\.\\d+)?|90(\\.0+)?)$" longitudeRegexString = "^[-+]?(180(\\.0+)?|((1[0-7]\\d)|([1-9]?\\d))(\\.\\d+)?)$" sSNRegexString = `^[0-9]{3}[ -]?(0[1-9]|[1-9][0-9])[ -]?([1-9][0-9]{3}|[0-9][1-9][0-9]{2}|[0-9]{2}[1-9][0-9]|[0-9]{3}[1-9])$` - hostnameRegexStringRFC952 = `^[a-zA-Z][a-zA-Z0-9\-\.]+[a-zA-Z0-9]$` // https://tools.ietf.org/html/rfc952 - hostnameRegexStringRFC1123 = `^[a-zA-Z0-9][a-zA-Z0-9\-\.]+[a-zA-Z0-9]$` // accepts hostname starting with a digit https://tools.ietf.org/html/rfc1123 - btcAddressRegexString = `^[13][a-km-zA-HJ-NP-Z1-9]{25,34}$` // bitcoin address - btcAddressUpperRegexStringBech32 = `^BC1[02-9AC-HJ-NP-Z]{7,76}$` // bitcoin bech32 address https://en.bitcoin.it/wiki/Bech32 - btcAddressLowerRegexStringBech32 = `^bc1[02-9ac-hj-np-z]{7,76}$` // bitcoin bech32 address https://en.bitcoin.it/wiki/Bech32 + hostnameRegexStringRFC952 = `^[a-zA-Z]([a-zA-Z0-9\-]+[\.]?)*[a-zA-Z0-9]$` // https://tools.ietf.org/html/rfc952 + hostnameRegexStringRFC1123 = `^([a-zA-Z0-9]{1}[a-zA-Z0-9_-]{0,62}){1}(\.[a-zA-Z0-9_]{1}[a-zA-Z0-9_-]{0,62})*?$` // accepts hostname starting with a digit https://tools.ietf.org/html/rfc1123 + fqdnRegexStringRFC1123 = `^([a-zA-Z0-9]{1}[a-zA-Z0-9_-]{0,62})(\.[a-zA-Z0-9_]{1}[a-zA-Z0-9_-]{0,62})*?(\.[a-zA-Z]{1}[a-zA-Z0-9]{0,62})\.?$` // same as hostnameRegexStringRFC1123 but must contain a non numerical TLD (possibly ending with '.') + btcAddressRegexString = `^[13][a-km-zA-HJ-NP-Z1-9]{25,34}$` // bitcoin address + btcAddressUpperRegexStringBech32 = `^BC1[02-9AC-HJ-NP-Z]{7,76}$` // bitcoin bech32 address https://en.bitcoin.it/wiki/Bech32 + btcAddressLowerRegexStringBech32 = `^bc1[02-9ac-hj-np-z]{7,76}$` // bitcoin bech32 address https://en.bitcoin.it/wiki/Bech32 ethAddressRegexString = `^0x[0-9a-fA-F]{40}$` ethAddressUpperRegexString = `^0x[0-9A-F]{40}$` ethAddressLowerRegexString = `^0x[0-9a-f]{40}$` uRLEncodedRegexString = `(%[A-Fa-f0-9]{2})` hTMLEncodedRegexString = `&#[x]?([0-9a-fA-F]{2})|(>)|(<)|(")|(&)+[;]?` hTMLRegexString = `<[/]?([a-zA-Z]+).*?>` + splitParamsRegexString = `'[^']*'|\S+` ) var ( @@ -61,6 +64,7 @@ var ( rgbaRegex = regexp.MustCompile(rgbaRegexString) hslRegex = regexp.MustCompile(hslRegexString) hslaRegex = regexp.MustCompile(hslaRegexString) + e164Regex = regexp.MustCompile(e164RegexString) emailRegex = regexp.MustCompile(emailRegexString) base64Regex = regexp.MustCompile(base64RegexString) base64URLRegex = regexp.MustCompile(base64URLRegexString) @@ -83,6 +87,7 @@ var ( sSNRegex = regexp.MustCompile(sSNRegexString) hostnameRegexRFC952 = regexp.MustCompile(hostnameRegexStringRFC952) hostnameRegexRFC1123 = regexp.MustCompile(hostnameRegexStringRFC1123) + fqdnRegexRFC1123 = regexp.MustCompile(fqdnRegexStringRFC1123) btcAddressRegex = regexp.MustCompile(btcAddressRegexString) btcUpperAddressRegexBech32 = regexp.MustCompile(btcAddressUpperRegexStringBech32) btcLowerAddressRegexBech32 = regexp.MustCompile(btcAddressLowerRegexStringBech32) @@ -92,4 +97,5 @@ var ( uRLEncodedRegex = regexp.MustCompile(uRLEncodedRegexString) hTMLEncodedRegex = regexp.MustCompile(hTMLEncodedRegexString) hTMLRegex = regexp.MustCompile(hTMLRegexString) + splitParamsRegex = regexp.MustCompile(splitParamsRegexString) ) diff --git a/vendor/gopkg.in/go-playground/validator.v9/struct_level.go b/vendor/github.com/go-playground/validator/v10/struct_level.go similarity index 100% rename from vendor/gopkg.in/go-playground/validator.v9/struct_level.go rename to vendor/github.com/go-playground/validator/v10/struct_level.go diff --git a/vendor/gopkg.in/go-playground/validator.v9/translations.go b/vendor/github.com/go-playground/validator/v10/translations.go similarity index 100% rename from vendor/gopkg.in/go-playground/validator.v9/translations.go rename to vendor/github.com/go-playground/validator/v10/translations.go diff --git a/vendor/gopkg.in/go-playground/validator.v9/util.go b/vendor/github.com/go-playground/validator/v10/util.go similarity index 86% rename from vendor/gopkg.in/go-playground/validator.v9/util.go rename to vendor/github.com/go-playground/validator/v10/util.go index 16a5517..56420f4 100644 --- a/vendor/gopkg.in/go-playground/validator.v9/util.go +++ b/vendor/github.com/go-playground/validator/v10/util.go @@ -4,6 +4,7 @@ import ( "reflect" "strconv" "strings" + "time" ) // extractTypeInternal gets the actual underlying type of field value. @@ -57,11 +58,10 @@ BEGIN: // // NOTE: when not successful ok will be false, this can happen when a nested struct is nil and so the field // could not be retrieved because it didn't exist. -func (v *validate) getStructFieldOKInternal(val reflect.Value, namespace string) (current reflect.Value, kind reflect.Kind, found bool) { +func (v *validate) getStructFieldOKInternal(val reflect.Value, namespace string) (current reflect.Value, kind reflect.Kind, nullable bool, found bool) { BEGIN: - current, kind, _ = v.ExtractType(val) - + current, kind, nullable = v.ExtractType(val) if kind == reflect.Invalid { return } @@ -112,7 +112,7 @@ BEGIN: arrIdx, _ := strconv.Atoi(namespace[idx+1 : idx2]) if arrIdx >= current.Len() { - return current, kind, false + return } startIdx := idx2 + 1 @@ -223,13 +223,34 @@ BEGIN: // asInt returns the parameter as a int64 // or panics if it can't convert func asInt(param string) int64 { - i, err := strconv.ParseInt(param, 0, 64) panicIf(err) return i } +// asIntFromTimeDuration parses param as time.Duration and returns it as int64 +// or panics on error. +func asIntFromTimeDuration(param string) int64 { + d, err := time.ParseDuration(param) + if err != nil { + // attempt parsing as an an integer assuming nanosecond precision + return asInt(param) + } + return int64(d) +} + +// asIntFromType calls the proper function to parse param as int64, +// given a field's Type t. +func asIntFromType(t reflect.Type, param string) int64 { + switch t { + case timeDurationType: + return asIntFromTimeDuration(param) + default: + return asInt(param) + } +} + // asUint returns the parameter as a uint64 // or panics if it can't convert func asUint(param string) uint64 { @@ -250,6 +271,16 @@ func asFloat(param string) float64 { return i } +// asBool returns the parameter as a bool +// or panics if it can't convert +func asBool(param string) bool { + + i, err := strconv.ParseBool(param) + panicIf(err) + + return i +} + func panicIf(err error) { if err != nil { panic(err.Error()) diff --git a/vendor/gopkg.in/go-playground/validator.v9/validator.go b/vendor/github.com/go-playground/validator/v10/validator.go similarity index 98% rename from vendor/gopkg.in/go-playground/validator.v9/validator.go rename to vendor/github.com/go-playground/validator/v10/validator.go index 3abf5d3..9569c0d 100644 --- a/vendor/gopkg.in/go-playground/validator.v9/validator.go +++ b/vendor/github.com/go-playground/validator/v10/validator.go @@ -7,7 +7,7 @@ import ( "strconv" ) -// per validate contruct +// per validate construct type validate struct { v *Validate top reflect.Value @@ -74,7 +74,7 @@ func (v *validate) validateStruct(ctx context.Context, parent reflect.Value, cur } } - v.traverseField(ctx, parent, current.Field(f.idx), ns, structNs, f, f.cTags) + v.traverseField(ctx, current, current.Field(f.idx), ns, structNs, f, f.cTags) } } @@ -222,7 +222,7 @@ func (v *validate) traverseField(ctx context.Context, parent reflect.Value, curr structNs = append(append(structNs, cf.name...), '.') } - v.validateStruct(ctx, current, current, typ, ns, structNs, ct) + v.validateStruct(ctx, parent, current, typ, ns, structNs, ct) return } } @@ -249,7 +249,7 @@ OUTER: v.cf = cf v.ct = ct - if !v.fldIsPointer && !hasValue(v) { + if !hasValue(v) { return } diff --git a/vendor/gopkg.in/go-playground/validator.v9/validator_instance.go b/vendor/github.com/go-playground/validator/v10/validator_instance.go similarity index 96% rename from vendor/gopkg.in/go-playground/validator.v9/validator_instance.go rename to vendor/github.com/go-playground/validator/v10/validator_instance.go index 4a89d40..d230a32 100644 --- a/vendor/gopkg.in/go-playground/validator.v9/validator_instance.go +++ b/vendor/github.com/go-playground/validator/v10/validator_instance.go @@ -27,6 +27,12 @@ const ( requiredWithoutTag = "required_without" requiredWithTag = "required_with" requiredWithAllTag = "required_with_all" + requiredIfTag = "required_if" + requiredUnlessTag = "required_unless" + excludedWithoutAllTag = "excluded_without_all" + excludedWithoutTag = "excluded_without" + excludedWithTag = "excluded_with" + excludedWithAllTag = "excluded_with_all" skipValidationTag = "-" diveTag = "dive" keysTag = "keys" @@ -41,7 +47,9 @@ const ( ) var ( - timeType = reflect.TypeOf(time.Time{}) + timeDurationType = reflect.TypeOf(time.Duration(0)) + timeType = reflect.TypeOf(time.Time{}) + defaultCField = &cField{namesEqual: true} ) @@ -107,7 +115,8 @@ func New() *Validate { switch k { // these require that even if the value is nil that the validation should run, omitempty still overrides this behaviour - case requiredWithTag, requiredWithAllTag, requiredWithoutTag, requiredWithoutAllTag: + case requiredIfTag, requiredUnlessTag, requiredWithTag, requiredWithAllTag, requiredWithoutTag, requiredWithoutAllTag, + excludedWithTag, excludedWithAllTag, excludedWithoutTag, excludedWithoutAllTag: _ = v.registerValidation(k, wrapFunc(val), true, true) default: // no need to error check here, baked in will always be valid @@ -405,7 +414,10 @@ func (v *Validate) StructPartialCtx(ctx context.Context, s interface{}, fields . if len(flds) > 0 { vd.misc = append(vd.misc[0:0], name...) - vd.misc = append(vd.misc, '.') + // Don't append empty name for unnamed structs + if len(vd.misc) != 0 { + vd.misc = append(vd.misc, '.') + } for _, s := range flds { diff --git a/vendor/github.com/stretchr/testify/assert/assertion_compare.go b/vendor/github.com/stretchr/testify/assert/assertion_compare.go index dc20039..41649d2 100644 --- a/vendor/github.com/stretchr/testify/assert/assertion_compare.go +++ b/vendor/github.com/stretchr/testify/assert/assertion_compare.go @@ -13,12 +13,42 @@ const ( compareGreater ) +var ( + intType = reflect.TypeOf(int(1)) + int8Type = reflect.TypeOf(int8(1)) + int16Type = reflect.TypeOf(int16(1)) + int32Type = reflect.TypeOf(int32(1)) + int64Type = reflect.TypeOf(int64(1)) + + uintType = reflect.TypeOf(uint(1)) + uint8Type = reflect.TypeOf(uint8(1)) + uint16Type = reflect.TypeOf(uint16(1)) + uint32Type = reflect.TypeOf(uint32(1)) + uint64Type = reflect.TypeOf(uint64(1)) + + float32Type = reflect.TypeOf(float32(1)) + float64Type = reflect.TypeOf(float64(1)) + + stringType = reflect.TypeOf("") +) + func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { + obj1Value := reflect.ValueOf(obj1) + obj2Value := reflect.ValueOf(obj2) + + // throughout this switch we try and avoid calling .Convert() if possible, + // as this has a pretty big performance impact switch kind { case reflect.Int: { - intobj1 := obj1.(int) - intobj2 := obj2.(int) + intobj1, ok := obj1.(int) + if !ok { + intobj1 = obj1Value.Convert(intType).Interface().(int) + } + intobj2, ok := obj2.(int) + if !ok { + intobj2 = obj2Value.Convert(intType).Interface().(int) + } if intobj1 > intobj2 { return compareGreater, true } @@ -31,8 +61,14 @@ func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { } case reflect.Int8: { - int8obj1 := obj1.(int8) - int8obj2 := obj2.(int8) + int8obj1, ok := obj1.(int8) + if !ok { + int8obj1 = obj1Value.Convert(int8Type).Interface().(int8) + } + int8obj2, ok := obj2.(int8) + if !ok { + int8obj2 = obj2Value.Convert(int8Type).Interface().(int8) + } if int8obj1 > int8obj2 { return compareGreater, true } @@ -45,8 +81,14 @@ func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { } case reflect.Int16: { - int16obj1 := obj1.(int16) - int16obj2 := obj2.(int16) + int16obj1, ok := obj1.(int16) + if !ok { + int16obj1 = obj1Value.Convert(int16Type).Interface().(int16) + } + int16obj2, ok := obj2.(int16) + if !ok { + int16obj2 = obj2Value.Convert(int16Type).Interface().(int16) + } if int16obj1 > int16obj2 { return compareGreater, true } @@ -59,8 +101,14 @@ func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { } case reflect.Int32: { - int32obj1 := obj1.(int32) - int32obj2 := obj2.(int32) + int32obj1, ok := obj1.(int32) + if !ok { + int32obj1 = obj1Value.Convert(int32Type).Interface().(int32) + } + int32obj2, ok := obj2.(int32) + if !ok { + int32obj2 = obj2Value.Convert(int32Type).Interface().(int32) + } if int32obj1 > int32obj2 { return compareGreater, true } @@ -73,8 +121,14 @@ func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { } case reflect.Int64: { - int64obj1 := obj1.(int64) - int64obj2 := obj2.(int64) + int64obj1, ok := obj1.(int64) + if !ok { + int64obj1 = obj1Value.Convert(int64Type).Interface().(int64) + } + int64obj2, ok := obj2.(int64) + if !ok { + int64obj2 = obj2Value.Convert(int64Type).Interface().(int64) + } if int64obj1 > int64obj2 { return compareGreater, true } @@ -87,8 +141,14 @@ func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { } case reflect.Uint: { - uintobj1 := obj1.(uint) - uintobj2 := obj2.(uint) + uintobj1, ok := obj1.(uint) + if !ok { + uintobj1 = obj1Value.Convert(uintType).Interface().(uint) + } + uintobj2, ok := obj2.(uint) + if !ok { + uintobj2 = obj2Value.Convert(uintType).Interface().(uint) + } if uintobj1 > uintobj2 { return compareGreater, true } @@ -101,8 +161,14 @@ func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { } case reflect.Uint8: { - uint8obj1 := obj1.(uint8) - uint8obj2 := obj2.(uint8) + uint8obj1, ok := obj1.(uint8) + if !ok { + uint8obj1 = obj1Value.Convert(uint8Type).Interface().(uint8) + } + uint8obj2, ok := obj2.(uint8) + if !ok { + uint8obj2 = obj2Value.Convert(uint8Type).Interface().(uint8) + } if uint8obj1 > uint8obj2 { return compareGreater, true } @@ -115,8 +181,14 @@ func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { } case reflect.Uint16: { - uint16obj1 := obj1.(uint16) - uint16obj2 := obj2.(uint16) + uint16obj1, ok := obj1.(uint16) + if !ok { + uint16obj1 = obj1Value.Convert(uint16Type).Interface().(uint16) + } + uint16obj2, ok := obj2.(uint16) + if !ok { + uint16obj2 = obj2Value.Convert(uint16Type).Interface().(uint16) + } if uint16obj1 > uint16obj2 { return compareGreater, true } @@ -129,8 +201,14 @@ func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { } case reflect.Uint32: { - uint32obj1 := obj1.(uint32) - uint32obj2 := obj2.(uint32) + uint32obj1, ok := obj1.(uint32) + if !ok { + uint32obj1 = obj1Value.Convert(uint32Type).Interface().(uint32) + } + uint32obj2, ok := obj2.(uint32) + if !ok { + uint32obj2 = obj2Value.Convert(uint32Type).Interface().(uint32) + } if uint32obj1 > uint32obj2 { return compareGreater, true } @@ -143,8 +221,14 @@ func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { } case reflect.Uint64: { - uint64obj1 := obj1.(uint64) - uint64obj2 := obj2.(uint64) + uint64obj1, ok := obj1.(uint64) + if !ok { + uint64obj1 = obj1Value.Convert(uint64Type).Interface().(uint64) + } + uint64obj2, ok := obj2.(uint64) + if !ok { + uint64obj2 = obj2Value.Convert(uint64Type).Interface().(uint64) + } if uint64obj1 > uint64obj2 { return compareGreater, true } @@ -157,8 +241,14 @@ func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { } case reflect.Float32: { - float32obj1 := obj1.(float32) - float32obj2 := obj2.(float32) + float32obj1, ok := obj1.(float32) + if !ok { + float32obj1 = obj1Value.Convert(float32Type).Interface().(float32) + } + float32obj2, ok := obj2.(float32) + if !ok { + float32obj2 = obj2Value.Convert(float32Type).Interface().(float32) + } if float32obj1 > float32obj2 { return compareGreater, true } @@ -171,8 +261,14 @@ func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { } case reflect.Float64: { - float64obj1 := obj1.(float64) - float64obj2 := obj2.(float64) + float64obj1, ok := obj1.(float64) + if !ok { + float64obj1 = obj1Value.Convert(float64Type).Interface().(float64) + } + float64obj2, ok := obj2.(float64) + if !ok { + float64obj2 = obj2Value.Convert(float64Type).Interface().(float64) + } if float64obj1 > float64obj2 { return compareGreater, true } @@ -185,8 +281,14 @@ func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { } case reflect.String: { - stringobj1 := obj1.(string) - stringobj2 := obj2.(string) + stringobj1, ok := obj1.(string) + if !ok { + stringobj1 = obj1Value.Convert(stringType).Interface().(string) + } + stringobj2, ok := obj2.(string) + if !ok { + stringobj2 = obj2Value.Convert(stringType).Interface().(string) + } if stringobj1 > stringobj2 { return compareGreater, true } @@ -240,6 +342,24 @@ func LessOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...inter return compareTwoValues(t, e1, e2, []CompareType{compareLess, compareEqual}, "\"%v\" is not less than or equal to \"%v\"", msgAndArgs) } +// Positive asserts that the specified element is positive +// +// assert.Positive(t, 1) +// assert.Positive(t, 1.23) +func Positive(t TestingT, e interface{}, msgAndArgs ...interface{}) bool { + zero := reflect.Zero(reflect.TypeOf(e)) + return compareTwoValues(t, e, zero.Interface(), []CompareType{compareGreater}, "\"%v\" is not positive", msgAndArgs) +} + +// Negative asserts that the specified element is negative +// +// assert.Negative(t, -1) +// assert.Negative(t, -1.23) +func Negative(t TestingT, e interface{}, msgAndArgs ...interface{}) bool { + zero := reflect.Zero(reflect.TypeOf(e)) + return compareTwoValues(t, e, zero.Interface(), []CompareType{compareLess}, "\"%v\" is not negative", msgAndArgs) +} + func compareTwoValues(t TestingT, e1 interface{}, e2 interface{}, allowedComparesResults []CompareType, failMessage string, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() diff --git a/vendor/github.com/stretchr/testify/assert/assertion_format.go b/vendor/github.com/stretchr/testify/assert/assertion_format.go index 49370eb..4dfd122 100644 --- a/vendor/github.com/stretchr/testify/assert/assertion_format.go +++ b/vendor/github.com/stretchr/testify/assert/assertion_format.go @@ -114,6 +114,24 @@ func Errorf(t TestingT, err error, msg string, args ...interface{}) bool { return Error(t, err, append([]interface{}{msg}, args...)...) } +// ErrorAsf asserts that at least one of the errors in err's chain matches target, and if so, sets target to that error value. +// This is a wrapper for errors.As. +func ErrorAsf(t TestingT, err error, target interface{}, msg string, args ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + return ErrorAs(t, err, target, append([]interface{}{msg}, args...)...) +} + +// ErrorIsf asserts that at least one of the errors in err's chain matches target. +// This is a wrapper for errors.Is. +func ErrorIsf(t TestingT, err error, target error, msg string, args ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + return ErrorIs(t, err, target, append([]interface{}{msg}, args...)...) +} + // Eventuallyf asserts that given condition will be met in waitFor time, // periodically checking target function each tick. // @@ -321,6 +339,54 @@ func InEpsilonSlicef(t TestingT, expected interface{}, actual interface{}, epsil return InEpsilonSlice(t, expected, actual, epsilon, append([]interface{}{msg}, args...)...) } +// IsDecreasingf asserts that the collection is decreasing +// +// assert.IsDecreasingf(t, []int{2, 1, 0}, "error message %s", "formatted") +// assert.IsDecreasingf(t, []float{2, 1}, "error message %s", "formatted") +// assert.IsDecreasingf(t, []string{"b", "a"}, "error message %s", "formatted") +func IsDecreasingf(t TestingT, object interface{}, msg string, args ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + return IsDecreasing(t, object, append([]interface{}{msg}, args...)...) +} + +// IsIncreasingf asserts that the collection is increasing +// +// assert.IsIncreasingf(t, []int{1, 2, 3}, "error message %s", "formatted") +// assert.IsIncreasingf(t, []float{1, 2}, "error message %s", "formatted") +// assert.IsIncreasingf(t, []string{"a", "b"}, "error message %s", "formatted") +func IsIncreasingf(t TestingT, object interface{}, msg string, args ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + return IsIncreasing(t, object, append([]interface{}{msg}, args...)...) +} + +// IsNonDecreasingf asserts that the collection is not decreasing +// +// assert.IsNonDecreasingf(t, []int{1, 1, 2}, "error message %s", "formatted") +// assert.IsNonDecreasingf(t, []float{1, 2}, "error message %s", "formatted") +// assert.IsNonDecreasingf(t, []string{"a", "b"}, "error message %s", "formatted") +func IsNonDecreasingf(t TestingT, object interface{}, msg string, args ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + return IsNonDecreasing(t, object, append([]interface{}{msg}, args...)...) +} + +// IsNonIncreasingf asserts that the collection is not increasing +// +// assert.IsNonIncreasingf(t, []int{2, 1, 1}, "error message %s", "formatted") +// assert.IsNonIncreasingf(t, []float{2, 1}, "error message %s", "formatted") +// assert.IsNonIncreasingf(t, []string{"b", "a"}, "error message %s", "formatted") +func IsNonIncreasingf(t TestingT, object interface{}, msg string, args ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + return IsNonIncreasing(t, object, append([]interface{}{msg}, args...)...) +} + // IsTypef asserts that the specified objects are of the same type. func IsTypef(t TestingT, expectedType interface{}, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { @@ -375,6 +441,17 @@ func LessOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, args . return LessOrEqual(t, e1, e2, append([]interface{}{msg}, args...)...) } +// Negativef asserts that the specified element is negative +// +// assert.Negativef(t, -1, "error message %s", "formatted") +// assert.Negativef(t, -1.23, "error message %s", "formatted") +func Negativef(t TestingT, e interface{}, msg string, args ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + return Negative(t, e, append([]interface{}{msg}, args...)...) +} + // Neverf asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // @@ -476,6 +553,15 @@ func NotEqualValuesf(t TestingT, expected interface{}, actual interface{}, msg s return NotEqualValues(t, expected, actual, append([]interface{}{msg}, args...)...) } +// NotErrorIsf asserts that at none of the errors in err's chain matches target. +// This is a wrapper for errors.Is. +func NotErrorIsf(t TestingT, err error, target error, msg string, args ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + return NotErrorIs(t, err, target, append([]interface{}{msg}, args...)...) +} + // NotNilf asserts that the specified object is not nil. // // assert.NotNilf(t, err, "error message %s", "formatted") @@ -572,6 +658,17 @@ func PanicsWithValuef(t TestingT, expected interface{}, f PanicTestFunc, msg str return PanicsWithValue(t, expected, f, append([]interface{}{msg}, args...)...) } +// Positivef asserts that the specified element is positive +// +// assert.Positivef(t, 1, "error message %s", "formatted") +// assert.Positivef(t, 1.23, "error message %s", "formatted") +func Positivef(t TestingT, e interface{}, msg string, args ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + return Positive(t, e, append([]interface{}{msg}, args...)...) +} + // Regexpf asserts that a specified regexp matches a string. // // assert.Regexpf(t, regexp.MustCompile("start"), "it's starting", "error message %s", "formatted") diff --git a/vendor/github.com/stretchr/testify/assert/assertion_forward.go b/vendor/github.com/stretchr/testify/assert/assertion_forward.go index 9db8894..25337a6 100644 --- a/vendor/github.com/stretchr/testify/assert/assertion_forward.go +++ b/vendor/github.com/stretchr/testify/assert/assertion_forward.go @@ -204,6 +204,42 @@ func (a *Assertions) Error(err error, msgAndArgs ...interface{}) bool { return Error(a.t, err, msgAndArgs...) } +// ErrorAs asserts that at least one of the errors in err's chain matches target, and if so, sets target to that error value. +// This is a wrapper for errors.As. +func (a *Assertions) ErrorAs(err error, target interface{}, msgAndArgs ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return ErrorAs(a.t, err, target, msgAndArgs...) +} + +// ErrorAsf asserts that at least one of the errors in err's chain matches target, and if so, sets target to that error value. +// This is a wrapper for errors.As. +func (a *Assertions) ErrorAsf(err error, target interface{}, msg string, args ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return ErrorAsf(a.t, err, target, msg, args...) +} + +// ErrorIs asserts that at least one of the errors in err's chain matches target. +// This is a wrapper for errors.Is. +func (a *Assertions) ErrorIs(err error, target error, msgAndArgs ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return ErrorIs(a.t, err, target, msgAndArgs...) +} + +// ErrorIsf asserts that at least one of the errors in err's chain matches target. +// This is a wrapper for errors.Is. +func (a *Assertions) ErrorIsf(err error, target error, msg string, args ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return ErrorIsf(a.t, err, target, msg, args...) +} + // Errorf asserts that a function returned an error (i.e. not `nil`). // // actualObj, err := SomeFunction() @@ -631,6 +667,102 @@ func (a *Assertions) InEpsilonf(expected interface{}, actual interface{}, epsilo return InEpsilonf(a.t, expected, actual, epsilon, msg, args...) } +// IsDecreasing asserts that the collection is decreasing +// +// a.IsDecreasing([]int{2, 1, 0}) +// a.IsDecreasing([]float{2, 1}) +// a.IsDecreasing([]string{"b", "a"}) +func (a *Assertions) IsDecreasing(object interface{}, msgAndArgs ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return IsDecreasing(a.t, object, msgAndArgs...) +} + +// IsDecreasingf asserts that the collection is decreasing +// +// a.IsDecreasingf([]int{2, 1, 0}, "error message %s", "formatted") +// a.IsDecreasingf([]float{2, 1}, "error message %s", "formatted") +// a.IsDecreasingf([]string{"b", "a"}, "error message %s", "formatted") +func (a *Assertions) IsDecreasingf(object interface{}, msg string, args ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return IsDecreasingf(a.t, object, msg, args...) +} + +// IsIncreasing asserts that the collection is increasing +// +// a.IsIncreasing([]int{1, 2, 3}) +// a.IsIncreasing([]float{1, 2}) +// a.IsIncreasing([]string{"a", "b"}) +func (a *Assertions) IsIncreasing(object interface{}, msgAndArgs ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return IsIncreasing(a.t, object, msgAndArgs...) +} + +// IsIncreasingf asserts that the collection is increasing +// +// a.IsIncreasingf([]int{1, 2, 3}, "error message %s", "formatted") +// a.IsIncreasingf([]float{1, 2}, "error message %s", "formatted") +// a.IsIncreasingf([]string{"a", "b"}, "error message %s", "formatted") +func (a *Assertions) IsIncreasingf(object interface{}, msg string, args ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return IsIncreasingf(a.t, object, msg, args...) +} + +// IsNonDecreasing asserts that the collection is not decreasing +// +// a.IsNonDecreasing([]int{1, 1, 2}) +// a.IsNonDecreasing([]float{1, 2}) +// a.IsNonDecreasing([]string{"a", "b"}) +func (a *Assertions) IsNonDecreasing(object interface{}, msgAndArgs ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return IsNonDecreasing(a.t, object, msgAndArgs...) +} + +// IsNonDecreasingf asserts that the collection is not decreasing +// +// a.IsNonDecreasingf([]int{1, 1, 2}, "error message %s", "formatted") +// a.IsNonDecreasingf([]float{1, 2}, "error message %s", "formatted") +// a.IsNonDecreasingf([]string{"a", "b"}, "error message %s", "formatted") +func (a *Assertions) IsNonDecreasingf(object interface{}, msg string, args ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return IsNonDecreasingf(a.t, object, msg, args...) +} + +// IsNonIncreasing asserts that the collection is not increasing +// +// a.IsNonIncreasing([]int{2, 1, 1}) +// a.IsNonIncreasing([]float{2, 1}) +// a.IsNonIncreasing([]string{"b", "a"}) +func (a *Assertions) IsNonIncreasing(object interface{}, msgAndArgs ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return IsNonIncreasing(a.t, object, msgAndArgs...) +} + +// IsNonIncreasingf asserts that the collection is not increasing +// +// a.IsNonIncreasingf([]int{2, 1, 1}, "error message %s", "formatted") +// a.IsNonIncreasingf([]float{2, 1}, "error message %s", "formatted") +// a.IsNonIncreasingf([]string{"b", "a"}, "error message %s", "formatted") +func (a *Assertions) IsNonIncreasingf(object interface{}, msg string, args ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return IsNonIncreasingf(a.t, object, msg, args...) +} + // IsType asserts that the specified objects are of the same type. func (a *Assertions) IsType(expectedType interface{}, object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { @@ -739,6 +871,28 @@ func (a *Assertions) Lessf(e1 interface{}, e2 interface{}, msg string, args ...i return Lessf(a.t, e1, e2, msg, args...) } +// Negative asserts that the specified element is negative +// +// a.Negative(-1) +// a.Negative(-1.23) +func (a *Assertions) Negative(e interface{}, msgAndArgs ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return Negative(a.t, e, msgAndArgs...) +} + +// Negativef asserts that the specified element is negative +// +// a.Negativef(-1, "error message %s", "formatted") +// a.Negativef(-1.23, "error message %s", "formatted") +func (a *Assertions) Negativef(e interface{}, msg string, args ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return Negativef(a.t, e, msg, args...) +} + // Never asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // @@ -941,6 +1095,24 @@ func (a *Assertions) NotEqualf(expected interface{}, actual interface{}, msg str return NotEqualf(a.t, expected, actual, msg, args...) } +// NotErrorIs asserts that at none of the errors in err's chain matches target. +// This is a wrapper for errors.Is. +func (a *Assertions) NotErrorIs(err error, target error, msgAndArgs ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return NotErrorIs(a.t, err, target, msgAndArgs...) +} + +// NotErrorIsf asserts that at none of the errors in err's chain matches target. +// This is a wrapper for errors.Is. +func (a *Assertions) NotErrorIsf(err error, target error, msg string, args ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return NotErrorIsf(a.t, err, target, msg, args...) +} + // NotNil asserts that the specified object is not nil. // // a.NotNil(err) @@ -1133,6 +1305,28 @@ func (a *Assertions) Panicsf(f PanicTestFunc, msg string, args ...interface{}) b return Panicsf(a.t, f, msg, args...) } +// Positive asserts that the specified element is positive +// +// a.Positive(1) +// a.Positive(1.23) +func (a *Assertions) Positive(e interface{}, msgAndArgs ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return Positive(a.t, e, msgAndArgs...) +} + +// Positivef asserts that the specified element is positive +// +// a.Positivef(1, "error message %s", "formatted") +// a.Positivef(1.23, "error message %s", "formatted") +func (a *Assertions) Positivef(e interface{}, msg string, args ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return Positivef(a.t, e, msg, args...) +} + // Regexp asserts that a specified regexp matches a string. // // a.Regexp(regexp.MustCompile("start"), "it's starting") diff --git a/vendor/github.com/stretchr/testify/assert/assertion_order.go b/vendor/github.com/stretchr/testify/assert/assertion_order.go new file mode 100644 index 0000000..1c3b471 --- /dev/null +++ b/vendor/github.com/stretchr/testify/assert/assertion_order.go @@ -0,0 +1,81 @@ +package assert + +import ( + "fmt" + "reflect" +) + +// isOrdered checks that collection contains orderable elements. +func isOrdered(t TestingT, object interface{}, allowedComparesResults []CompareType, failMessage string, msgAndArgs ...interface{}) bool { + objKind := reflect.TypeOf(object).Kind() + if objKind != reflect.Slice && objKind != reflect.Array { + return false + } + + objValue := reflect.ValueOf(object) + objLen := objValue.Len() + + if objLen <= 1 { + return true + } + + value := objValue.Index(0) + valueInterface := value.Interface() + firstValueKind := value.Kind() + + for i := 1; i < objLen; i++ { + prevValue := value + prevValueInterface := valueInterface + + value = objValue.Index(i) + valueInterface = value.Interface() + + compareResult, isComparable := compare(prevValueInterface, valueInterface, firstValueKind) + + if !isComparable { + return Fail(t, fmt.Sprintf("Can not compare type \"%s\" and \"%s\"", reflect.TypeOf(value), reflect.TypeOf(prevValue)), msgAndArgs...) + } + + if !containsValue(allowedComparesResults, compareResult) { + return Fail(t, fmt.Sprintf(failMessage, prevValue, value), msgAndArgs...) + } + } + + return true +} + +// IsIncreasing asserts that the collection is increasing +// +// assert.IsIncreasing(t, []int{1, 2, 3}) +// assert.IsIncreasing(t, []float{1, 2}) +// assert.IsIncreasing(t, []string{"a", "b"}) +func IsIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { + return isOrdered(t, object, []CompareType{compareLess}, "\"%v\" is not less than \"%v\"", msgAndArgs) +} + +// IsNonIncreasing asserts that the collection is not increasing +// +// assert.IsNonIncreasing(t, []int{2, 1, 1}) +// assert.IsNonIncreasing(t, []float{2, 1}) +// assert.IsNonIncreasing(t, []string{"b", "a"}) +func IsNonIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { + return isOrdered(t, object, []CompareType{compareEqual, compareGreater}, "\"%v\" is not greater than or equal to \"%v\"", msgAndArgs) +} + +// IsDecreasing asserts that the collection is decreasing +// +// assert.IsDecreasing(t, []int{2, 1, 0}) +// assert.IsDecreasing(t, []float{2, 1}) +// assert.IsDecreasing(t, []string{"b", "a"}) +func IsDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { + return isOrdered(t, object, []CompareType{compareGreater}, "\"%v\" is not greater than \"%v\"", msgAndArgs) +} + +// IsNonDecreasing asserts that the collection is not decreasing +// +// assert.IsNonDecreasing(t, []int{1, 1, 2}) +// assert.IsNonDecreasing(t, []float{1, 2}) +// assert.IsNonDecreasing(t, []string{"a", "b"}) +func IsNonDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { + return isOrdered(t, object, []CompareType{compareLess, compareEqual}, "\"%v\" is not less than or equal to \"%v\"", msgAndArgs) +} diff --git a/vendor/github.com/stretchr/testify/assert/assertions.go b/vendor/github.com/stretchr/testify/assert/assertions.go index 914a10d..bcac440 100644 --- a/vendor/github.com/stretchr/testify/assert/assertions.go +++ b/vendor/github.com/stretchr/testify/assert/assertions.go @@ -172,8 +172,8 @@ func isTest(name, prefix string) bool { if len(name) == len(prefix) { // "Test" is ok return true } - rune, _ := utf8.DecodeRuneInString(name[len(prefix):]) - return !unicode.IsLower(rune) + r, _ := utf8.DecodeRuneInString(name[len(prefix):]) + return !unicode.IsLower(r) } func messageFromMsgAndArgs(msgAndArgs ...interface{}) string { @@ -1622,6 +1622,7 @@ var spewConfig = spew.ConfigState{ DisableCapacities: true, SortKeys: true, DisableMethods: true, + MaxDepth: 10, } type tHelper interface { @@ -1693,3 +1694,81 @@ func Never(t TestingT, condition func() bool, waitFor time.Duration, tick time.D } } } + +// ErrorIs asserts that at least one of the errors in err's chain matches target. +// This is a wrapper for errors.Is. +func ErrorIs(t TestingT, err, target error, msgAndArgs ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if errors.Is(err, target) { + return true + } + + var expectedText string + if target != nil { + expectedText = target.Error() + } + + chain := buildErrorChainString(err) + + return Fail(t, fmt.Sprintf("Target error should be in err chain:\n"+ + "expected: %q\n"+ + "in chain: %s", expectedText, chain, + ), msgAndArgs...) +} + +// NotErrorIs asserts that at none of the errors in err's chain matches target. +// This is a wrapper for errors.Is. +func NotErrorIs(t TestingT, err, target error, msgAndArgs ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if !errors.Is(err, target) { + return true + } + + var expectedText string + if target != nil { + expectedText = target.Error() + } + + chain := buildErrorChainString(err) + + return Fail(t, fmt.Sprintf("Target error should not be in err chain:\n"+ + "found: %q\n"+ + "in chain: %s", expectedText, chain, + ), msgAndArgs...) +} + +// ErrorAs asserts that at least one of the errors in err's chain matches target, and if so, sets target to that error value. +// This is a wrapper for errors.As. +func ErrorAs(t TestingT, err error, target interface{}, msgAndArgs ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if errors.As(err, target) { + return true + } + + chain := buildErrorChainString(err) + + return Fail(t, fmt.Sprintf("Should be in error chain:\n"+ + "expected: %q\n"+ + "in chain: %s", target, chain, + ), msgAndArgs...) +} + +func buildErrorChainString(err error) string { + if err == nil { + return "" + } + + e := errors.Unwrap(err) + chain := fmt.Sprintf("%q", err.Error()) + for e != nil { + chain += fmt.Sprintf("\n\t%q", e.Error()) + e = errors.Unwrap(e) + } + return chain +} diff --git a/vendor/github.com/stretchr/testify/require/require.go b/vendor/github.com/stretchr/testify/require/require.go index ec4624b..51820df 100644 --- a/vendor/github.com/stretchr/testify/require/require.go +++ b/vendor/github.com/stretchr/testify/require/require.go @@ -256,6 +256,54 @@ func Error(t TestingT, err error, msgAndArgs ...interface{}) { t.FailNow() } +// ErrorAs asserts that at least one of the errors in err's chain matches target, and if so, sets target to that error value. +// This is a wrapper for errors.As. +func ErrorAs(t TestingT, err error, target interface{}, msgAndArgs ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.ErrorAs(t, err, target, msgAndArgs...) { + return + } + t.FailNow() +} + +// ErrorAsf asserts that at least one of the errors in err's chain matches target, and if so, sets target to that error value. +// This is a wrapper for errors.As. +func ErrorAsf(t TestingT, err error, target interface{}, msg string, args ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.ErrorAsf(t, err, target, msg, args...) { + return + } + t.FailNow() +} + +// ErrorIs asserts that at least one of the errors in err's chain matches target. +// This is a wrapper for errors.Is. +func ErrorIs(t TestingT, err error, target error, msgAndArgs ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.ErrorIs(t, err, target, msgAndArgs...) { + return + } + t.FailNow() +} + +// ErrorIsf asserts that at least one of the errors in err's chain matches target. +// This is a wrapper for errors.Is. +func ErrorIsf(t TestingT, err error, target error, msg string, args ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.ErrorIsf(t, err, target, msg, args...) { + return + } + t.FailNow() +} + // Errorf asserts that a function returned an error (i.e. not `nil`). // // actualObj, err := SomeFunction() @@ -806,6 +854,126 @@ func InEpsilonf(t TestingT, expected interface{}, actual interface{}, epsilon fl t.FailNow() } +// IsDecreasing asserts that the collection is decreasing +// +// assert.IsDecreasing(t, []int{2, 1, 0}) +// assert.IsDecreasing(t, []float{2, 1}) +// assert.IsDecreasing(t, []string{"b", "a"}) +func IsDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.IsDecreasing(t, object, msgAndArgs...) { + return + } + t.FailNow() +} + +// IsDecreasingf asserts that the collection is decreasing +// +// assert.IsDecreasingf(t, []int{2, 1, 0}, "error message %s", "formatted") +// assert.IsDecreasingf(t, []float{2, 1}, "error message %s", "formatted") +// assert.IsDecreasingf(t, []string{"b", "a"}, "error message %s", "formatted") +func IsDecreasingf(t TestingT, object interface{}, msg string, args ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.IsDecreasingf(t, object, msg, args...) { + return + } + t.FailNow() +} + +// IsIncreasing asserts that the collection is increasing +// +// assert.IsIncreasing(t, []int{1, 2, 3}) +// assert.IsIncreasing(t, []float{1, 2}) +// assert.IsIncreasing(t, []string{"a", "b"}) +func IsIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.IsIncreasing(t, object, msgAndArgs...) { + return + } + t.FailNow() +} + +// IsIncreasingf asserts that the collection is increasing +// +// assert.IsIncreasingf(t, []int{1, 2, 3}, "error message %s", "formatted") +// assert.IsIncreasingf(t, []float{1, 2}, "error message %s", "formatted") +// assert.IsIncreasingf(t, []string{"a", "b"}, "error message %s", "formatted") +func IsIncreasingf(t TestingT, object interface{}, msg string, args ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.IsIncreasingf(t, object, msg, args...) { + return + } + t.FailNow() +} + +// IsNonDecreasing asserts that the collection is not decreasing +// +// assert.IsNonDecreasing(t, []int{1, 1, 2}) +// assert.IsNonDecreasing(t, []float{1, 2}) +// assert.IsNonDecreasing(t, []string{"a", "b"}) +func IsNonDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.IsNonDecreasing(t, object, msgAndArgs...) { + return + } + t.FailNow() +} + +// IsNonDecreasingf asserts that the collection is not decreasing +// +// assert.IsNonDecreasingf(t, []int{1, 1, 2}, "error message %s", "formatted") +// assert.IsNonDecreasingf(t, []float{1, 2}, "error message %s", "formatted") +// assert.IsNonDecreasingf(t, []string{"a", "b"}, "error message %s", "formatted") +func IsNonDecreasingf(t TestingT, object interface{}, msg string, args ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.IsNonDecreasingf(t, object, msg, args...) { + return + } + t.FailNow() +} + +// IsNonIncreasing asserts that the collection is not increasing +// +// assert.IsNonIncreasing(t, []int{2, 1, 1}) +// assert.IsNonIncreasing(t, []float{2, 1}) +// assert.IsNonIncreasing(t, []string{"b", "a"}) +func IsNonIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.IsNonIncreasing(t, object, msgAndArgs...) { + return + } + t.FailNow() +} + +// IsNonIncreasingf asserts that the collection is not increasing +// +// assert.IsNonIncreasingf(t, []int{2, 1, 1}, "error message %s", "formatted") +// assert.IsNonIncreasingf(t, []float{2, 1}, "error message %s", "formatted") +// assert.IsNonIncreasingf(t, []string{"b", "a"}, "error message %s", "formatted") +func IsNonIncreasingf(t TestingT, object interface{}, msg string, args ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.IsNonIncreasingf(t, object, msg, args...) { + return + } + t.FailNow() +} + // IsType asserts that the specified objects are of the same type. func IsType(t TestingT, expectedType interface{}, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { @@ -944,6 +1112,34 @@ func Lessf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...inter t.FailNow() } +// Negative asserts that the specified element is negative +// +// assert.Negative(t, -1) +// assert.Negative(t, -1.23) +func Negative(t TestingT, e interface{}, msgAndArgs ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.Negative(t, e, msgAndArgs...) { + return + } + t.FailNow() +} + +// Negativef asserts that the specified element is negative +// +// assert.Negativef(t, -1, "error message %s", "formatted") +// assert.Negativef(t, -1.23, "error message %s", "formatted") +func Negativef(t TestingT, e interface{}, msg string, args ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.Negativef(t, e, msg, args...) { + return + } + t.FailNow() +} + // Never asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // @@ -1200,6 +1396,30 @@ func NotEqualf(t TestingT, expected interface{}, actual interface{}, msg string, t.FailNow() } +// NotErrorIs asserts that at none of the errors in err's chain matches target. +// This is a wrapper for errors.Is. +func NotErrorIs(t TestingT, err error, target error, msgAndArgs ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.NotErrorIs(t, err, target, msgAndArgs...) { + return + } + t.FailNow() +} + +// NotErrorIsf asserts that at none of the errors in err's chain matches target. +// This is a wrapper for errors.Is. +func NotErrorIsf(t TestingT, err error, target error, msg string, args ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.NotErrorIsf(t, err, target, msg, args...) { + return + } + t.FailNow() +} + // NotNil asserts that the specified object is not nil. // // assert.NotNil(t, err) @@ -1446,6 +1666,34 @@ func Panicsf(t TestingT, f assert.PanicTestFunc, msg string, args ...interface{} t.FailNow() } +// Positive asserts that the specified element is positive +// +// assert.Positive(t, 1) +// assert.Positive(t, 1.23) +func Positive(t TestingT, e interface{}, msgAndArgs ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.Positive(t, e, msgAndArgs...) { + return + } + t.FailNow() +} + +// Positivef asserts that the specified element is positive +// +// assert.Positivef(t, 1, "error message %s", "formatted") +// assert.Positivef(t, 1.23, "error message %s", "formatted") +func Positivef(t TestingT, e interface{}, msg string, args ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.Positivef(t, e, msg, args...) { + return + } + t.FailNow() +} + // Regexp asserts that a specified regexp matches a string. // // assert.Regexp(t, regexp.MustCompile("start"), "it's starting") diff --git a/vendor/github.com/stretchr/testify/require/require_forward.go b/vendor/github.com/stretchr/testify/require/require_forward.go index 103d7dc..ed54a9d 100644 --- a/vendor/github.com/stretchr/testify/require/require_forward.go +++ b/vendor/github.com/stretchr/testify/require/require_forward.go @@ -205,6 +205,42 @@ func (a *Assertions) Error(err error, msgAndArgs ...interface{}) { Error(a.t, err, msgAndArgs...) } +// ErrorAs asserts that at least one of the errors in err's chain matches target, and if so, sets target to that error value. +// This is a wrapper for errors.As. +func (a *Assertions) ErrorAs(err error, target interface{}, msgAndArgs ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + ErrorAs(a.t, err, target, msgAndArgs...) +} + +// ErrorAsf asserts that at least one of the errors in err's chain matches target, and if so, sets target to that error value. +// This is a wrapper for errors.As. +func (a *Assertions) ErrorAsf(err error, target interface{}, msg string, args ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + ErrorAsf(a.t, err, target, msg, args...) +} + +// ErrorIs asserts that at least one of the errors in err's chain matches target. +// This is a wrapper for errors.Is. +func (a *Assertions) ErrorIs(err error, target error, msgAndArgs ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + ErrorIs(a.t, err, target, msgAndArgs...) +} + +// ErrorIsf asserts that at least one of the errors in err's chain matches target. +// This is a wrapper for errors.Is. +func (a *Assertions) ErrorIsf(err error, target error, msg string, args ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + ErrorIsf(a.t, err, target, msg, args...) +} + // Errorf asserts that a function returned an error (i.e. not `nil`). // // actualObj, err := SomeFunction() @@ -632,6 +668,102 @@ func (a *Assertions) InEpsilonf(expected interface{}, actual interface{}, epsilo InEpsilonf(a.t, expected, actual, epsilon, msg, args...) } +// IsDecreasing asserts that the collection is decreasing +// +// a.IsDecreasing([]int{2, 1, 0}) +// a.IsDecreasing([]float{2, 1}) +// a.IsDecreasing([]string{"b", "a"}) +func (a *Assertions) IsDecreasing(object interface{}, msgAndArgs ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + IsDecreasing(a.t, object, msgAndArgs...) +} + +// IsDecreasingf asserts that the collection is decreasing +// +// a.IsDecreasingf([]int{2, 1, 0}, "error message %s", "formatted") +// a.IsDecreasingf([]float{2, 1}, "error message %s", "formatted") +// a.IsDecreasingf([]string{"b", "a"}, "error message %s", "formatted") +func (a *Assertions) IsDecreasingf(object interface{}, msg string, args ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + IsDecreasingf(a.t, object, msg, args...) +} + +// IsIncreasing asserts that the collection is increasing +// +// a.IsIncreasing([]int{1, 2, 3}) +// a.IsIncreasing([]float{1, 2}) +// a.IsIncreasing([]string{"a", "b"}) +func (a *Assertions) IsIncreasing(object interface{}, msgAndArgs ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + IsIncreasing(a.t, object, msgAndArgs...) +} + +// IsIncreasingf asserts that the collection is increasing +// +// a.IsIncreasingf([]int{1, 2, 3}, "error message %s", "formatted") +// a.IsIncreasingf([]float{1, 2}, "error message %s", "formatted") +// a.IsIncreasingf([]string{"a", "b"}, "error message %s", "formatted") +func (a *Assertions) IsIncreasingf(object interface{}, msg string, args ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + IsIncreasingf(a.t, object, msg, args...) +} + +// IsNonDecreasing asserts that the collection is not decreasing +// +// a.IsNonDecreasing([]int{1, 1, 2}) +// a.IsNonDecreasing([]float{1, 2}) +// a.IsNonDecreasing([]string{"a", "b"}) +func (a *Assertions) IsNonDecreasing(object interface{}, msgAndArgs ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + IsNonDecreasing(a.t, object, msgAndArgs...) +} + +// IsNonDecreasingf asserts that the collection is not decreasing +// +// a.IsNonDecreasingf([]int{1, 1, 2}, "error message %s", "formatted") +// a.IsNonDecreasingf([]float{1, 2}, "error message %s", "formatted") +// a.IsNonDecreasingf([]string{"a", "b"}, "error message %s", "formatted") +func (a *Assertions) IsNonDecreasingf(object interface{}, msg string, args ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + IsNonDecreasingf(a.t, object, msg, args...) +} + +// IsNonIncreasing asserts that the collection is not increasing +// +// a.IsNonIncreasing([]int{2, 1, 1}) +// a.IsNonIncreasing([]float{2, 1}) +// a.IsNonIncreasing([]string{"b", "a"}) +func (a *Assertions) IsNonIncreasing(object interface{}, msgAndArgs ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + IsNonIncreasing(a.t, object, msgAndArgs...) +} + +// IsNonIncreasingf asserts that the collection is not increasing +// +// a.IsNonIncreasingf([]int{2, 1, 1}, "error message %s", "formatted") +// a.IsNonIncreasingf([]float{2, 1}, "error message %s", "formatted") +// a.IsNonIncreasingf([]string{"b", "a"}, "error message %s", "formatted") +func (a *Assertions) IsNonIncreasingf(object interface{}, msg string, args ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + IsNonIncreasingf(a.t, object, msg, args...) +} + // IsType asserts that the specified objects are of the same type. func (a *Assertions) IsType(expectedType interface{}, object interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { @@ -740,6 +872,28 @@ func (a *Assertions) Lessf(e1 interface{}, e2 interface{}, msg string, args ...i Lessf(a.t, e1, e2, msg, args...) } +// Negative asserts that the specified element is negative +// +// a.Negative(-1) +// a.Negative(-1.23) +func (a *Assertions) Negative(e interface{}, msgAndArgs ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + Negative(a.t, e, msgAndArgs...) +} + +// Negativef asserts that the specified element is negative +// +// a.Negativef(-1, "error message %s", "formatted") +// a.Negativef(-1.23, "error message %s", "formatted") +func (a *Assertions) Negativef(e interface{}, msg string, args ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + Negativef(a.t, e, msg, args...) +} + // Never asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // @@ -942,6 +1096,24 @@ func (a *Assertions) NotEqualf(expected interface{}, actual interface{}, msg str NotEqualf(a.t, expected, actual, msg, args...) } +// NotErrorIs asserts that at none of the errors in err's chain matches target. +// This is a wrapper for errors.Is. +func (a *Assertions) NotErrorIs(err error, target error, msgAndArgs ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + NotErrorIs(a.t, err, target, msgAndArgs...) +} + +// NotErrorIsf asserts that at none of the errors in err's chain matches target. +// This is a wrapper for errors.Is. +func (a *Assertions) NotErrorIsf(err error, target error, msg string, args ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + NotErrorIsf(a.t, err, target, msg, args...) +} + // NotNil asserts that the specified object is not nil. // // a.NotNil(err) @@ -1134,6 +1306,28 @@ func (a *Assertions) Panicsf(f assert.PanicTestFunc, msg string, args ...interfa Panicsf(a.t, f, msg, args...) } +// Positive asserts that the specified element is positive +// +// a.Positive(1) +// a.Positive(1.23) +func (a *Assertions) Positive(e interface{}, msgAndArgs ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + Positive(a.t, e, msgAndArgs...) +} + +// Positivef asserts that the specified element is positive +// +// a.Positivef(1, "error message %s", "formatted") +// a.Positivef(1.23, "error message %s", "formatted") +func (a *Assertions) Positivef(e interface{}, msg string, args ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + Positivef(a.t, e, msg, args...) +} + // Regexp asserts that a specified regexp matches a string. // // a.Regexp(regexp.MustCompile("start"), "it's starting") diff --git a/vendor/go.uber.org/atomic/.codecov.yml b/vendor/go.uber.org/atomic/.codecov.yml index 6d4d1be..571116c 100644 --- a/vendor/go.uber.org/atomic/.codecov.yml +++ b/vendor/go.uber.org/atomic/.codecov.yml @@ -13,3 +13,7 @@ coverage: if_not_found: success # if parent is not found report status as success, error, or failure if_ci_failed: error # if ci fails report status as success, error, or failure +# Also update COVER_IGNORE_PKGS in the Makefile. +ignore: + - /internal/gen-atomicint/ + - /internal/gen-valuewrapper/ diff --git a/vendor/go.uber.org/atomic/.gitignore b/vendor/go.uber.org/atomic/.gitignore index c3fa253..2e337a0 100644 --- a/vendor/go.uber.org/atomic/.gitignore +++ b/vendor/go.uber.org/atomic/.gitignore @@ -10,3 +10,6 @@ lint.log # Profiling output *.prof + +# Output of fossa analyzer +/fossa diff --git a/vendor/go.uber.org/atomic/.travis.yml b/vendor/go.uber.org/atomic/.travis.yml deleted file mode 100644 index 4e73268..0000000 --- a/vendor/go.uber.org/atomic/.travis.yml +++ /dev/null @@ -1,27 +0,0 @@ -sudo: false -language: go -go_import_path: go.uber.org/atomic - -env: - global: - - GO111MODULE=on - -matrix: - include: - - go: 1.12.x - - go: 1.13.x - env: LINT=1 - -cache: - directories: - - vendor - -before_install: - - go version - -script: - - test -z "$LINT" || make lint - - make cover - -after_success: - - bash <(curl -s https://codecov.io/bash) diff --git a/vendor/go.uber.org/atomic/CHANGELOG.md b/vendor/go.uber.org/atomic/CHANGELOG.md index aef8b6e..3c3f238 100644 --- a/vendor/go.uber.org/atomic/CHANGELOG.md +++ b/vendor/go.uber.org/atomic/CHANGELOG.md @@ -4,6 +4,22 @@ All notable changes to this project will be documented in this file. The format is based on [Keep a Changelog](https://keepachangelog.com/en/1.0.0/), and this project adheres to [Semantic Versioning](https://semver.org/spec/v2.0.0.html). +## [1.8.0] - 2021-06-09 +### Added +- Add `atomic.Uintptr` type for atomic operations on `uintptr` values. +- Add `atomic.UnsafePointer` type for atomic operations on `unsafe.Pointer` values. + +## [1.7.0] - 2020-09-14 +### Added +- Support JSON serialization and deserialization of primitive atomic types. +- Support Text marshalling and unmarshalling for string atomics. + +### Changed +- Disallow incorrect comparison of atomic values in a non-atomic way. + +### Removed +- Remove dependency on `golang.org/x/{lint, tools}`. + ## [1.6.0] - 2020-02-24 ### Changed - Drop library dependency on `golang.org/x/{lint, tools}`. @@ -52,6 +68,8 @@ and this project adheres to [Semantic Versioning](https://semver.org/spec/v2.0.0 - Initial release. +[1.8.0]: https://github.com/uber-go/atomic/compare/v1.7.0...v1.8.0 +[1.7.0]: https://github.com/uber-go/atomic/compare/v1.6.0...v1.7.0 [1.6.0]: https://github.com/uber-go/atomic/compare/v1.5.1...v1.6.0 [1.5.1]: https://github.com/uber-go/atomic/compare/v1.5.0...v1.5.1 [1.5.0]: https://github.com/uber-go/atomic/compare/v1.4.0...v1.5.0 diff --git a/vendor/go.uber.org/atomic/Makefile b/vendor/go.uber.org/atomic/Makefile index 39af0fb..46c945b 100644 --- a/vendor/go.uber.org/atomic/Makefile +++ b/vendor/go.uber.org/atomic/Makefile @@ -2,8 +2,16 @@ export GOBIN ?= $(shell pwd)/bin GOLINT = $(GOBIN)/golint +GEN_ATOMICINT = $(GOBIN)/gen-atomicint +GEN_ATOMICWRAPPER = $(GOBIN)/gen-atomicwrapper +STATICCHECK = $(GOBIN)/staticcheck -GO_FILES ?= *.go +GO_FILES ?= $(shell find . '(' -path .git -o -path vendor ')' -prune -o -name '*.go' -print) + +# Also update ignore section in .codecov.yml. +COVER_IGNORE_PKGS = \ + go.uber.org/atomic/internal/gen-atomicint \ + go.uber.org/atomic/internal/gen-atomicwrapper .PHONY: build build: @@ -20,16 +28,52 @@ gofmt: @[ ! -s "$(FMT_LOG)" ] || (echo "gofmt failed:" && cat $(FMT_LOG) && false) $(GOLINT): - go install golang.org/x/lint/golint + cd tools && go install golang.org/x/lint/golint + +$(STATICCHECK): + cd tools && go install honnef.co/go/tools/cmd/staticcheck + +$(GEN_ATOMICWRAPPER): $(wildcard ./internal/gen-atomicwrapper/*) + go build -o $@ ./internal/gen-atomicwrapper + +$(GEN_ATOMICINT): $(wildcard ./internal/gen-atomicint/*) + go build -o $@ ./internal/gen-atomicint .PHONY: golint golint: $(GOLINT) $(GOLINT) ./... +.PHONY: staticcheck +staticcheck: $(STATICCHECK) + $(STATICCHECK) ./... + .PHONY: lint -lint: gofmt golint +lint: gofmt golint staticcheck generatenodirty + +# comma separated list of packages to consider for code coverage. +COVER_PKG = $(shell \ + go list -find ./... | \ + grep -v $(foreach pkg,$(COVER_IGNORE_PKGS),-e "^$(pkg)$$") | \ + paste -sd, -) .PHONY: cover cover: - go test -coverprofile=cover.out -coverpkg ./... -v ./... + go test -coverprofile=cover.out -coverpkg $(COVER_PKG) -v ./... go tool cover -html=cover.out -o cover.html + +.PHONY: generate +generate: $(GEN_ATOMICINT) $(GEN_ATOMICWRAPPER) + go generate ./... + +.PHONY: generatenodirty +generatenodirty: + @[ -z "$$(git status --porcelain)" ] || ( \ + echo "Working tree is dirty. Commit your changes first."; \ + git status; \ + exit 1 ) + @make generate + @status=$$(git status --porcelain); \ + [ -z "$$status" ] || ( \ + echo "Working tree is dirty after `make generate`:"; \ + echo "$$status"; \ + echo "Please ensure that the generated code is up-to-date." ) diff --git a/vendor/go.uber.org/atomic/README.md b/vendor/go.uber.org/atomic/README.md index ade0c20..96b47a1 100644 --- a/vendor/go.uber.org/atomic/README.md +++ b/vendor/go.uber.org/atomic/README.md @@ -55,8 +55,8 @@ Released under the [MIT License](LICENSE.txt). [doc-img]: https://godoc.org/github.com/uber-go/atomic?status.svg [doc]: https://godoc.org/go.uber.org/atomic -[ci-img]: https://travis-ci.com/uber-go/atomic.svg?branch=master -[ci]: https://travis-ci.com/uber-go/atomic +[ci-img]: https://github.com/uber-go/atomic/actions/workflows/go.yml/badge.svg +[ci]: https://github.com/uber-go/atomic/actions/workflows/go.yml [cov-img]: https://codecov.io/gh/uber-go/atomic/branch/master/graph/badge.svg [cov]: https://codecov.io/gh/uber-go/atomic [reportcard-img]: https://goreportcard.com/badge/go.uber.org/atomic diff --git a/vendor/go.uber.org/atomic/atomic.go b/vendor/go.uber.org/atomic/atomic.go deleted file mode 100644 index ad5fa09..0000000 --- a/vendor/go.uber.org/atomic/atomic.go +++ /dev/null @@ -1,356 +0,0 @@ -// Copyright (c) 2016 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -// Package atomic provides simple wrappers around numerics to enforce atomic -// access. -package atomic - -import ( - "math" - "sync/atomic" - "time" -) - -// Int32 is an atomic wrapper around an int32. -type Int32 struct{ v int32 } - -// NewInt32 creates an Int32. -func NewInt32(i int32) *Int32 { - return &Int32{i} -} - -// Load atomically loads the wrapped value. -func (i *Int32) Load() int32 { - return atomic.LoadInt32(&i.v) -} - -// Add atomically adds to the wrapped int32 and returns the new value. -func (i *Int32) Add(n int32) int32 { - return atomic.AddInt32(&i.v, n) -} - -// Sub atomically subtracts from the wrapped int32 and returns the new value. -func (i *Int32) Sub(n int32) int32 { - return atomic.AddInt32(&i.v, -n) -} - -// Inc atomically increments the wrapped int32 and returns the new value. -func (i *Int32) Inc() int32 { - return i.Add(1) -} - -// Dec atomically decrements the wrapped int32 and returns the new value. -func (i *Int32) Dec() int32 { - return i.Sub(1) -} - -// CAS is an atomic compare-and-swap. -func (i *Int32) CAS(old, new int32) bool { - return atomic.CompareAndSwapInt32(&i.v, old, new) -} - -// Store atomically stores the passed value. -func (i *Int32) Store(n int32) { - atomic.StoreInt32(&i.v, n) -} - -// Swap atomically swaps the wrapped int32 and returns the old value. -func (i *Int32) Swap(n int32) int32 { - return atomic.SwapInt32(&i.v, n) -} - -// Int64 is an atomic wrapper around an int64. -type Int64 struct{ v int64 } - -// NewInt64 creates an Int64. -func NewInt64(i int64) *Int64 { - return &Int64{i} -} - -// Load atomically loads the wrapped value. -func (i *Int64) Load() int64 { - return atomic.LoadInt64(&i.v) -} - -// Add atomically adds to the wrapped int64 and returns the new value. -func (i *Int64) Add(n int64) int64 { - return atomic.AddInt64(&i.v, n) -} - -// Sub atomically subtracts from the wrapped int64 and returns the new value. -func (i *Int64) Sub(n int64) int64 { - return atomic.AddInt64(&i.v, -n) -} - -// Inc atomically increments the wrapped int64 and returns the new value. -func (i *Int64) Inc() int64 { - return i.Add(1) -} - -// Dec atomically decrements the wrapped int64 and returns the new value. -func (i *Int64) Dec() int64 { - return i.Sub(1) -} - -// CAS is an atomic compare-and-swap. -func (i *Int64) CAS(old, new int64) bool { - return atomic.CompareAndSwapInt64(&i.v, old, new) -} - -// Store atomically stores the passed value. -func (i *Int64) Store(n int64) { - atomic.StoreInt64(&i.v, n) -} - -// Swap atomically swaps the wrapped int64 and returns the old value. -func (i *Int64) Swap(n int64) int64 { - return atomic.SwapInt64(&i.v, n) -} - -// Uint32 is an atomic wrapper around an uint32. -type Uint32 struct{ v uint32 } - -// NewUint32 creates a Uint32. -func NewUint32(i uint32) *Uint32 { - return &Uint32{i} -} - -// Load atomically loads the wrapped value. -func (i *Uint32) Load() uint32 { - return atomic.LoadUint32(&i.v) -} - -// Add atomically adds to the wrapped uint32 and returns the new value. -func (i *Uint32) Add(n uint32) uint32 { - return atomic.AddUint32(&i.v, n) -} - -// Sub atomically subtracts from the wrapped uint32 and returns the new value. -func (i *Uint32) Sub(n uint32) uint32 { - return atomic.AddUint32(&i.v, ^(n - 1)) -} - -// Inc atomically increments the wrapped uint32 and returns the new value. -func (i *Uint32) Inc() uint32 { - return i.Add(1) -} - -// Dec atomically decrements the wrapped int32 and returns the new value. -func (i *Uint32) Dec() uint32 { - return i.Sub(1) -} - -// CAS is an atomic compare-and-swap. -func (i *Uint32) CAS(old, new uint32) bool { - return atomic.CompareAndSwapUint32(&i.v, old, new) -} - -// Store atomically stores the passed value. -func (i *Uint32) Store(n uint32) { - atomic.StoreUint32(&i.v, n) -} - -// Swap atomically swaps the wrapped uint32 and returns the old value. -func (i *Uint32) Swap(n uint32) uint32 { - return atomic.SwapUint32(&i.v, n) -} - -// Uint64 is an atomic wrapper around a uint64. -type Uint64 struct{ v uint64 } - -// NewUint64 creates a Uint64. -func NewUint64(i uint64) *Uint64 { - return &Uint64{i} -} - -// Load atomically loads the wrapped value. -func (i *Uint64) Load() uint64 { - return atomic.LoadUint64(&i.v) -} - -// Add atomically adds to the wrapped uint64 and returns the new value. -func (i *Uint64) Add(n uint64) uint64 { - return atomic.AddUint64(&i.v, n) -} - -// Sub atomically subtracts from the wrapped uint64 and returns the new value. -func (i *Uint64) Sub(n uint64) uint64 { - return atomic.AddUint64(&i.v, ^(n - 1)) -} - -// Inc atomically increments the wrapped uint64 and returns the new value. -func (i *Uint64) Inc() uint64 { - return i.Add(1) -} - -// Dec atomically decrements the wrapped uint64 and returns the new value. -func (i *Uint64) Dec() uint64 { - return i.Sub(1) -} - -// CAS is an atomic compare-and-swap. -func (i *Uint64) CAS(old, new uint64) bool { - return atomic.CompareAndSwapUint64(&i.v, old, new) -} - -// Store atomically stores the passed value. -func (i *Uint64) Store(n uint64) { - atomic.StoreUint64(&i.v, n) -} - -// Swap atomically swaps the wrapped uint64 and returns the old value. -func (i *Uint64) Swap(n uint64) uint64 { - return atomic.SwapUint64(&i.v, n) -} - -// Bool is an atomic Boolean. -type Bool struct{ v uint32 } - -// NewBool creates a Bool. -func NewBool(initial bool) *Bool { - return &Bool{boolToInt(initial)} -} - -// Load atomically loads the Boolean. -func (b *Bool) Load() bool { - return truthy(atomic.LoadUint32(&b.v)) -} - -// CAS is an atomic compare-and-swap. -func (b *Bool) CAS(old, new bool) bool { - return atomic.CompareAndSwapUint32(&b.v, boolToInt(old), boolToInt(new)) -} - -// Store atomically stores the passed value. -func (b *Bool) Store(new bool) { - atomic.StoreUint32(&b.v, boolToInt(new)) -} - -// Swap sets the given value and returns the previous value. -func (b *Bool) Swap(new bool) bool { - return truthy(atomic.SwapUint32(&b.v, boolToInt(new))) -} - -// Toggle atomically negates the Boolean and returns the previous value. -func (b *Bool) Toggle() bool { - for { - old := b.Load() - if b.CAS(old, !old) { - return old - } - } -} - -func truthy(n uint32) bool { - return n == 1 -} - -func boolToInt(b bool) uint32 { - if b { - return 1 - } - return 0 -} - -// Float64 is an atomic wrapper around float64. -type Float64 struct { - v uint64 -} - -// NewFloat64 creates a Float64. -func NewFloat64(f float64) *Float64 { - return &Float64{math.Float64bits(f)} -} - -// Load atomically loads the wrapped value. -func (f *Float64) Load() float64 { - return math.Float64frombits(atomic.LoadUint64(&f.v)) -} - -// Store atomically stores the passed value. -func (f *Float64) Store(s float64) { - atomic.StoreUint64(&f.v, math.Float64bits(s)) -} - -// Add atomically adds to the wrapped float64 and returns the new value. -func (f *Float64) Add(s float64) float64 { - for { - old := f.Load() - new := old + s - if f.CAS(old, new) { - return new - } - } -} - -// Sub atomically subtracts from the wrapped float64 and returns the new value. -func (f *Float64) Sub(s float64) float64 { - return f.Add(-s) -} - -// CAS is an atomic compare-and-swap. -func (f *Float64) CAS(old, new float64) bool { - return atomic.CompareAndSwapUint64(&f.v, math.Float64bits(old), math.Float64bits(new)) -} - -// Duration is an atomic wrapper around time.Duration -// https://godoc.org/time#Duration -type Duration struct { - v Int64 -} - -// NewDuration creates a Duration. -func NewDuration(d time.Duration) *Duration { - return &Duration{v: *NewInt64(int64(d))} -} - -// Load atomically loads the wrapped value. -func (d *Duration) Load() time.Duration { - return time.Duration(d.v.Load()) -} - -// Store atomically stores the passed value. -func (d *Duration) Store(n time.Duration) { - d.v.Store(int64(n)) -} - -// Add atomically adds to the wrapped time.Duration and returns the new value. -func (d *Duration) Add(n time.Duration) time.Duration { - return time.Duration(d.v.Add(int64(n))) -} - -// Sub atomically subtracts from the wrapped time.Duration and returns the new value. -func (d *Duration) Sub(n time.Duration) time.Duration { - return time.Duration(d.v.Sub(int64(n))) -} - -// Swap atomically swaps the wrapped time.Duration and returns the old value. -func (d *Duration) Swap(n time.Duration) time.Duration { - return time.Duration(d.v.Swap(int64(n))) -} - -// CAS is an atomic compare-and-swap. -func (d *Duration) CAS(old, new time.Duration) bool { - return d.v.CAS(int64(old), int64(new)) -} - -// Value shadows the type of the same name from sync/atomic -// https://godoc.org/sync/atomic#Value -type Value struct{ atomic.Value } diff --git a/vendor/go.uber.org/atomic/bool.go b/vendor/go.uber.org/atomic/bool.go new file mode 100644 index 0000000..de5f72a --- /dev/null +++ b/vendor/go.uber.org/atomic/bool.go @@ -0,0 +1,81 @@ +// @generated Code generated by gen-atomicwrapper. + +// Copyright (c) 2020-2021 Uber Technologies, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package atomic + +import ( + "encoding/json" +) + +// Bool is an atomic type-safe wrapper for bool values. +type Bool struct { + _ nocmp // disallow non-atomic comparison + + v Uint32 +} + +var _zeroBool bool + +// NewBool creates a new Bool. +func NewBool(v bool) *Bool { + x := &Bool{} + if v != _zeroBool { + x.Store(v) + } + return x +} + +// Load atomically loads the wrapped bool. +func (x *Bool) Load() bool { + return truthy(x.v.Load()) +} + +// Store atomically stores the passed bool. +func (x *Bool) Store(v bool) { + x.v.Store(boolToInt(v)) +} + +// CAS is an atomic compare-and-swap for bool values. +func (x *Bool) CAS(o, n bool) bool { + return x.v.CAS(boolToInt(o), boolToInt(n)) +} + +// Swap atomically stores the given bool and returns the old +// value. +func (x *Bool) Swap(o bool) bool { + return truthy(x.v.Swap(boolToInt(o))) +} + +// MarshalJSON encodes the wrapped bool into JSON. +func (x *Bool) MarshalJSON() ([]byte, error) { + return json.Marshal(x.Load()) +} + +// UnmarshalJSON decodes a bool from JSON. +func (x *Bool) UnmarshalJSON(b []byte) error { + var v bool + if err := json.Unmarshal(b, &v); err != nil { + return err + } + x.Store(v) + return nil +} diff --git a/vendor/go.uber.org/multierr/go113.go b/vendor/go.uber.org/atomic/bool_ext.go similarity index 58% rename from vendor/go.uber.org/multierr/go113.go rename to vendor/go.uber.org/atomic/bool_ext.go index 264b0ea..c7bf7a8 100644 --- a/vendor/go.uber.org/multierr/go113.go +++ b/vendor/go.uber.org/atomic/bool_ext.go @@ -1,4 +1,4 @@ -// Copyright (c) 2019 Uber Technologies, Inc. +// Copyright (c) 2020 Uber Technologies, Inc. // // Permission is hereby granted, free of charge, to any person obtaining a copy // of this software and associated documentation files (the "Software"), to deal @@ -18,35 +18,36 @@ // OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN // THE SOFTWARE. -// +build go1.13 +package atomic -package multierr +import ( + "strconv" +) -import "errors" +//go:generate bin/gen-atomicwrapper -name=Bool -type=bool -wrapped=Uint32 -pack=boolToInt -unpack=truthy -cas -swap -json -file=bool.go -// As attempts to find the first error in the error list that matches the type -// of the value that target points to. -// -// This function allows errors.As to traverse the values stored on the -// multierr error. -func (merr *multiError) As(target interface{}) bool { - for _, err := range merr.Errors() { - if errors.As(err, target) { - return true - } +func truthy(n uint32) bool { + return n == 1 +} + +func boolToInt(b bool) uint32 { + if b { + return 1 } - return false + return 0 } -// Is attempts to match the provided error against errors in the error list. -// -// This function allows errors.Is to traverse the values stored on the -// multierr error. -func (merr *multiError) Is(target error) bool { - for _, err := range merr.Errors() { - if errors.Is(err, target) { - return true +// Toggle atomically negates the Boolean and returns the previous value. +func (b *Bool) Toggle() bool { + for { + old := b.Load() + if b.CAS(old, !old) { + return old } } - return false +} + +// String encodes the wrapped value as a string. +func (b *Bool) String() string { + return strconv.FormatBool(b.Load()) } diff --git a/vendor/go.uber.org/atomic/doc.go b/vendor/go.uber.org/atomic/doc.go new file mode 100644 index 0000000..ae7390e --- /dev/null +++ b/vendor/go.uber.org/atomic/doc.go @@ -0,0 +1,23 @@ +// Copyright (c) 2020 Uber Technologies, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +// Package atomic provides simple wrappers around numerics to enforce atomic +// access. +package atomic diff --git a/vendor/go.uber.org/atomic/duration.go b/vendor/go.uber.org/atomic/duration.go new file mode 100644 index 0000000..2bad9c0 --- /dev/null +++ b/vendor/go.uber.org/atomic/duration.go @@ -0,0 +1,82 @@ +// @generated Code generated by gen-atomicwrapper. + +// Copyright (c) 2020-2021 Uber Technologies, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package atomic + +import ( + "encoding/json" + "time" +) + +// Duration is an atomic type-safe wrapper for time.Duration values. +type Duration struct { + _ nocmp // disallow non-atomic comparison + + v Int64 +} + +var _zeroDuration time.Duration + +// NewDuration creates a new Duration. +func NewDuration(v time.Duration) *Duration { + x := &Duration{} + if v != _zeroDuration { + x.Store(v) + } + return x +} + +// Load atomically loads the wrapped time.Duration. +func (x *Duration) Load() time.Duration { + return time.Duration(x.v.Load()) +} + +// Store atomically stores the passed time.Duration. +func (x *Duration) Store(v time.Duration) { + x.v.Store(int64(v)) +} + +// CAS is an atomic compare-and-swap for time.Duration values. +func (x *Duration) CAS(o, n time.Duration) bool { + return x.v.CAS(int64(o), int64(n)) +} + +// Swap atomically stores the given time.Duration and returns the old +// value. +func (x *Duration) Swap(o time.Duration) time.Duration { + return time.Duration(x.v.Swap(int64(o))) +} + +// MarshalJSON encodes the wrapped time.Duration into JSON. +func (x *Duration) MarshalJSON() ([]byte, error) { + return json.Marshal(x.Load()) +} + +// UnmarshalJSON decodes a time.Duration from JSON. +func (x *Duration) UnmarshalJSON(b []byte) error { + var v time.Duration + if err := json.Unmarshal(b, &v); err != nil { + return err + } + x.Store(v) + return nil +} diff --git a/vendor/go.uber.org/atomic/duration_ext.go b/vendor/go.uber.org/atomic/duration_ext.go new file mode 100644 index 0000000..6273b66 --- /dev/null +++ b/vendor/go.uber.org/atomic/duration_ext.go @@ -0,0 +1,40 @@ +// Copyright (c) 2020 Uber Technologies, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package atomic + +import "time" + +//go:generate bin/gen-atomicwrapper -name=Duration -type=time.Duration -wrapped=Int64 -pack=int64 -unpack=time.Duration -cas -swap -json -imports time -file=duration.go + +// Add atomically adds to the wrapped time.Duration and returns the new value. +func (d *Duration) Add(n time.Duration) time.Duration { + return time.Duration(d.v.Add(int64(n))) +} + +// Sub atomically subtracts from the wrapped time.Duration and returns the new value. +func (d *Duration) Sub(n time.Duration) time.Duration { + return time.Duration(d.v.Sub(int64(n))) +} + +// String encodes the wrapped value as a string. +func (d *Duration) String() string { + return d.Load().String() +} diff --git a/vendor/go.uber.org/atomic/error.go b/vendor/go.uber.org/atomic/error.go index 0489d19..fc52975 100644 --- a/vendor/go.uber.org/atomic/error.go +++ b/vendor/go.uber.org/atomic/error.go @@ -1,4 +1,6 @@ -// Copyright (c) 2016 Uber Technologies, Inc. +// @generated Code generated by gen-atomicwrapper. + +// Copyright (c) 2020-2021 Uber Technologies, Inc. // // Permission is hereby granted, free of charge, to any person obtaining a copy // of this software and associated documentation files (the "Software"), to deal @@ -20,36 +22,30 @@ package atomic -// Error is an atomic type-safe wrapper around Value for errors -type Error struct{ v Value } - -// errorHolder is non-nil holder for error object. -// atomic.Value panics on saving nil object, so err object needs to be -// wrapped with valid object first. -type errorHolder struct{ err error } +// Error is an atomic type-safe wrapper for error values. +type Error struct { + _ nocmp // disallow non-atomic comparison -// NewError creates new atomic error object -func NewError(err error) *Error { - e := &Error{} - if err != nil { - e.Store(err) - } - return e + v Value } -// Load atomically loads the wrapped error -func (e *Error) Load() error { - v := e.v.Load() - if v == nil { - return nil +var _zeroError error + +// NewError creates a new Error. +func NewError(v error) *Error { + x := &Error{} + if v != _zeroError { + x.Store(v) } + return x +} - eh := v.(errorHolder) - return eh.err +// Load atomically loads the wrapped error. +func (x *Error) Load() error { + return unpackError(x.v.Load()) } -// Store atomically stores error. -// NOTE: a holder object is allocated on each Store call. -func (e *Error) Store(err error) { - e.v.Store(errorHolder{err: err}) +// Store atomically stores the passed error. +func (x *Error) Store(v error) { + x.v.Store(packError(v)) } diff --git a/vendor/go.uber.org/atomic/error_ext.go b/vendor/go.uber.org/atomic/error_ext.go new file mode 100644 index 0000000..ffe0be2 --- /dev/null +++ b/vendor/go.uber.org/atomic/error_ext.go @@ -0,0 +1,39 @@ +// Copyright (c) 2020 Uber Technologies, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package atomic + +// atomic.Value panics on nil inputs, or if the underlying type changes. +// Stabilize by always storing a custom struct that we control. + +//go:generate bin/gen-atomicwrapper -name=Error -type=error -wrapped=Value -pack=packError -unpack=unpackError -file=error.go + +type packedError struct{ Value error } + +func packError(v error) interface{} { + return packedError{v} +} + +func unpackError(v interface{}) error { + if err, ok := v.(packedError); ok { + return err.Value + } + return nil +} diff --git a/vendor/go.uber.org/atomic/float64.go b/vendor/go.uber.org/atomic/float64.go new file mode 100644 index 0000000..f833fd3 --- /dev/null +++ b/vendor/go.uber.org/atomic/float64.go @@ -0,0 +1,76 @@ +// @generated Code generated by gen-atomicwrapper. + +// Copyright (c) 2020-2021 Uber Technologies, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package atomic + +import ( + "encoding/json" + "math" +) + +// Float64 is an atomic type-safe wrapper for float64 values. +type Float64 struct { + _ nocmp // disallow non-atomic comparison + + v Uint64 +} + +var _zeroFloat64 float64 + +// NewFloat64 creates a new Float64. +func NewFloat64(v float64) *Float64 { + x := &Float64{} + if v != _zeroFloat64 { + x.Store(v) + } + return x +} + +// Load atomically loads the wrapped float64. +func (x *Float64) Load() float64 { + return math.Float64frombits(x.v.Load()) +} + +// Store atomically stores the passed float64. +func (x *Float64) Store(v float64) { + x.v.Store(math.Float64bits(v)) +} + +// CAS is an atomic compare-and-swap for float64 values. +func (x *Float64) CAS(o, n float64) bool { + return x.v.CAS(math.Float64bits(o), math.Float64bits(n)) +} + +// MarshalJSON encodes the wrapped float64 into JSON. +func (x *Float64) MarshalJSON() ([]byte, error) { + return json.Marshal(x.Load()) +} + +// UnmarshalJSON decodes a float64 from JSON. +func (x *Float64) UnmarshalJSON(b []byte) error { + var v float64 + if err := json.Unmarshal(b, &v); err != nil { + return err + } + x.Store(v) + return nil +} diff --git a/vendor/go.uber.org/atomic/float64_ext.go b/vendor/go.uber.org/atomic/float64_ext.go new file mode 100644 index 0000000..927b1ad --- /dev/null +++ b/vendor/go.uber.org/atomic/float64_ext.go @@ -0,0 +1,47 @@ +// Copyright (c) 2020 Uber Technologies, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package atomic + +import "strconv" + +//go:generate bin/gen-atomicwrapper -name=Float64 -type=float64 -wrapped=Uint64 -pack=math.Float64bits -unpack=math.Float64frombits -cas -json -imports math -file=float64.go + +// Add atomically adds to the wrapped float64 and returns the new value. +func (f *Float64) Add(s float64) float64 { + for { + old := f.Load() + new := old + s + if f.CAS(old, new) { + return new + } + } +} + +// Sub atomically subtracts from the wrapped float64 and returns the new value. +func (f *Float64) Sub(s float64) float64 { + return f.Add(-s) +} + +// String encodes the wrapped value as a string. +func (f *Float64) String() string { + // 'g' is the behavior for floats with %v. + return strconv.FormatFloat(f.Load(), 'g', -1, 64) +} diff --git a/vendor/go.uber.org/atomic/gen.go b/vendor/go.uber.org/atomic/gen.go new file mode 100644 index 0000000..1e9ef4f --- /dev/null +++ b/vendor/go.uber.org/atomic/gen.go @@ -0,0 +1,27 @@ +// Copyright (c) 2020 Uber Technologies, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package atomic + +//go:generate bin/gen-atomicint -name=Int32 -wrapped=int32 -file=int32.go +//go:generate bin/gen-atomicint -name=Int64 -wrapped=int64 -file=int64.go +//go:generate bin/gen-atomicint -name=Uint32 -wrapped=uint32 -unsigned -file=uint32.go +//go:generate bin/gen-atomicint -name=Uint64 -wrapped=uint64 -unsigned -file=uint64.go +//go:generate bin/gen-atomicint -name=Uintptr -wrapped=uintptr -unsigned -file=uintptr.go diff --git a/vendor/go.uber.org/atomic/go.mod b/vendor/go.uber.org/atomic/go.mod index a935dae..daa7599 100644 --- a/vendor/go.uber.org/atomic/go.mod +++ b/vendor/go.uber.org/atomic/go.mod @@ -3,8 +3,6 @@ module go.uber.org/atomic require ( github.com/davecgh/go-spew v1.1.1 // indirect github.com/stretchr/testify v1.3.0 - golang.org/x/lint v0.0.0-20190930215403-16217165b5de - golang.org/x/tools v0.0.0-20191029041327-9cc4af7d6b2c // indirect ) go 1.13 diff --git a/vendor/go.uber.org/atomic/go.sum b/vendor/go.uber.org/atomic/go.sum index 51b2b62..4f89841 100644 --- a/vendor/go.uber.org/atomic/go.sum +++ b/vendor/go.uber.org/atomic/go.sum @@ -1,4 +1,3 @@ -github.com/davecgh/go-spew v1.1.0 h1:ZDRjVQ15GmhC3fiQ8ni8+OwkZQO4DARzQgrnXU1Liz8= github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c= github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= @@ -7,16 +6,3 @@ github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZN github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= github.com/stretchr/testify v1.3.0 h1:TivCn/peBQ7UY8ooIcPgZFpTNSz0Q2U6UrFlUfqbe0Q= github.com/stretchr/testify v1.3.0/go.mod h1:M5WIy9Dh21IEIfnGCwXGc5bZfKNJtfHm1UVUgZn+9EI= -golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w= -golang.org/x/lint v0.0.0-20190930215403-16217165b5de h1:5hukYrvBGR8/eNkX5mdUezrA6JiaEZDtJb9Ei+1LlBs= -golang.org/x/lint v0.0.0-20190930215403-16217165b5de/go.mod h1:6SW0HCj/g11FgYtHlgUYUwCkIfeOF89ocIRzGO/8vkc= -golang.org/x/net v0.0.0-20190311183353-d8887717615a/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg= -golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s= -golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= -golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= -golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= -golang.org/x/tools v0.0.0-20190311212946-11955173bddd h1:/e+gpKk9r3dJobndpTytxS2gOy6m5uvpg+ISQoEcusQ= -golang.org/x/tools v0.0.0-20190311212946-11955173bddd/go.mod h1:LCzVGOaR6xXOjkQ3onu1FJEFr0SW1gC7cKk1uF8kGRs= -golang.org/x/tools v0.0.0-20191029041327-9cc4af7d6b2c h1:IGkKhmfzcztjm6gYkykvu/NiS8kaqbCWAEWWAyf8J5U= -golang.org/x/tools v0.0.0-20191029041327-9cc4af7d6b2c/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo= -golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= diff --git a/vendor/go.uber.org/atomic/int32.go b/vendor/go.uber.org/atomic/int32.go new file mode 100644 index 0000000..a20fc99 --- /dev/null +++ b/vendor/go.uber.org/atomic/int32.go @@ -0,0 +1,102 @@ +// @generated Code generated by gen-atomicint. + +// Copyright (c) 2020-2021 Uber Technologies, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package atomic + +import ( + "encoding/json" + "strconv" + "sync/atomic" +) + +// Int32 is an atomic wrapper around int32. +type Int32 struct { + _ nocmp // disallow non-atomic comparison + + v int32 +} + +// NewInt32 creates a new Int32. +func NewInt32(i int32) *Int32 { + return &Int32{v: i} +} + +// Load atomically loads the wrapped value. +func (i *Int32) Load() int32 { + return atomic.LoadInt32(&i.v) +} + +// Add atomically adds to the wrapped int32 and returns the new value. +func (i *Int32) Add(n int32) int32 { + return atomic.AddInt32(&i.v, n) +} + +// Sub atomically subtracts from the wrapped int32 and returns the new value. +func (i *Int32) Sub(n int32) int32 { + return atomic.AddInt32(&i.v, -n) +} + +// Inc atomically increments the wrapped int32 and returns the new value. +func (i *Int32) Inc() int32 { + return i.Add(1) +} + +// Dec atomically decrements the wrapped int32 and returns the new value. +func (i *Int32) Dec() int32 { + return i.Sub(1) +} + +// CAS is an atomic compare-and-swap. +func (i *Int32) CAS(old, new int32) bool { + return atomic.CompareAndSwapInt32(&i.v, old, new) +} + +// Store atomically stores the passed value. +func (i *Int32) Store(n int32) { + atomic.StoreInt32(&i.v, n) +} + +// Swap atomically swaps the wrapped int32 and returns the old value. +func (i *Int32) Swap(n int32) int32 { + return atomic.SwapInt32(&i.v, n) +} + +// MarshalJSON encodes the wrapped int32 into JSON. +func (i *Int32) MarshalJSON() ([]byte, error) { + return json.Marshal(i.Load()) +} + +// UnmarshalJSON decodes JSON into the wrapped int32. +func (i *Int32) UnmarshalJSON(b []byte) error { + var v int32 + if err := json.Unmarshal(b, &v); err != nil { + return err + } + i.Store(v) + return nil +} + +// String encodes the wrapped value as a string. +func (i *Int32) String() string { + v := i.Load() + return strconv.FormatInt(int64(v), 10) +} diff --git a/vendor/go.uber.org/atomic/int64.go b/vendor/go.uber.org/atomic/int64.go new file mode 100644 index 0000000..f03ee00 --- /dev/null +++ b/vendor/go.uber.org/atomic/int64.go @@ -0,0 +1,102 @@ +// @generated Code generated by gen-atomicint. + +// Copyright (c) 2020-2021 Uber Technologies, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package atomic + +import ( + "encoding/json" + "strconv" + "sync/atomic" +) + +// Int64 is an atomic wrapper around int64. +type Int64 struct { + _ nocmp // disallow non-atomic comparison + + v int64 +} + +// NewInt64 creates a new Int64. +func NewInt64(i int64) *Int64 { + return &Int64{v: i} +} + +// Load atomically loads the wrapped value. +func (i *Int64) Load() int64 { + return atomic.LoadInt64(&i.v) +} + +// Add atomically adds to the wrapped int64 and returns the new value. +func (i *Int64) Add(n int64) int64 { + return atomic.AddInt64(&i.v, n) +} + +// Sub atomically subtracts from the wrapped int64 and returns the new value. +func (i *Int64) Sub(n int64) int64 { + return atomic.AddInt64(&i.v, -n) +} + +// Inc atomically increments the wrapped int64 and returns the new value. +func (i *Int64) Inc() int64 { + return i.Add(1) +} + +// Dec atomically decrements the wrapped int64 and returns the new value. +func (i *Int64) Dec() int64 { + return i.Sub(1) +} + +// CAS is an atomic compare-and-swap. +func (i *Int64) CAS(old, new int64) bool { + return atomic.CompareAndSwapInt64(&i.v, old, new) +} + +// Store atomically stores the passed value. +func (i *Int64) Store(n int64) { + atomic.StoreInt64(&i.v, n) +} + +// Swap atomically swaps the wrapped int64 and returns the old value. +func (i *Int64) Swap(n int64) int64 { + return atomic.SwapInt64(&i.v, n) +} + +// MarshalJSON encodes the wrapped int64 into JSON. +func (i *Int64) MarshalJSON() ([]byte, error) { + return json.Marshal(i.Load()) +} + +// UnmarshalJSON decodes JSON into the wrapped int64. +func (i *Int64) UnmarshalJSON(b []byte) error { + var v int64 + if err := json.Unmarshal(b, &v); err != nil { + return err + } + i.Store(v) + return nil +} + +// String encodes the wrapped value as a string. +func (i *Int64) String() string { + v := i.Load() + return strconv.FormatInt(int64(v), 10) +} diff --git a/vendor/go.uber.org/atomic/nocmp.go b/vendor/go.uber.org/atomic/nocmp.go new file mode 100644 index 0000000..a8201cb --- /dev/null +++ b/vendor/go.uber.org/atomic/nocmp.go @@ -0,0 +1,35 @@ +// Copyright (c) 2020 Uber Technologies, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package atomic + +// nocmp is an uncomparable struct. Embed this inside another struct to make +// it uncomparable. +// +// type Foo struct { +// nocmp +// // ... +// } +// +// This DOES NOT: +// +// - Disallow shallow copies of structs +// - Disallow comparison of pointers to uncomparable structs +type nocmp [0]func() diff --git a/vendor/go.uber.org/atomic/string.go b/vendor/go.uber.org/atomic/string.go index ede8136..f8a6f33 100644 --- a/vendor/go.uber.org/atomic/string.go +++ b/vendor/go.uber.org/atomic/string.go @@ -1,4 +1,6 @@ -// Copyright (c) 2016 Uber Technologies, Inc. +// @generated Code generated by gen-atomicwrapper. + +// Copyright (c) 2020-2021 Uber Technologies, Inc. // // Permission is hereby granted, free of charge, to any person obtaining a copy // of this software and associated documentation files (the "Software"), to deal @@ -20,30 +22,33 @@ package atomic -// String is an atomic type-safe wrapper around Value for strings. -type String struct{ v Value } +// String is an atomic type-safe wrapper for string values. +type String struct { + _ nocmp // disallow non-atomic comparison + + v Value +} + +var _zeroString string -// NewString creates a String. -func NewString(str string) *String { - s := &String{} - if str != "" { - s.Store(str) +// NewString creates a new String. +func NewString(v string) *String { + x := &String{} + if v != _zeroString { + x.Store(v) } - return s + return x } // Load atomically loads the wrapped string. -func (s *String) Load() string { - v := s.v.Load() - if v == nil { - return "" +func (x *String) Load() string { + if v := x.v.Load(); v != nil { + return v.(string) } - return v.(string) + return _zeroString } // Store atomically stores the passed string. -// Note: Converting the string to an interface{} to store in the Value -// requires an allocation. -func (s *String) Store(str string) { - s.v.Store(str) +func (x *String) Store(v string) { + x.v.Store(v) } diff --git a/vendor/go.uber.org/atomic/string_ext.go b/vendor/go.uber.org/atomic/string_ext.go new file mode 100644 index 0000000..3a95582 --- /dev/null +++ b/vendor/go.uber.org/atomic/string_ext.go @@ -0,0 +1,43 @@ +// Copyright (c) 2020 Uber Technologies, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package atomic + +//go:generate bin/gen-atomicwrapper -name=String -type=string -wrapped=Value -file=string.go + +// String returns the wrapped value. +func (s *String) String() string { + return s.Load() +} + +// MarshalText encodes the wrapped string into a textual form. +// +// This makes it encodable as JSON, YAML, XML, and more. +func (s *String) MarshalText() ([]byte, error) { + return []byte(s.Load()), nil +} + +// UnmarshalText decodes text and replaces the wrapped string with it. +// +// This makes it decodable from JSON, YAML, XML, and more. +func (s *String) UnmarshalText(b []byte) error { + s.Store(string(b)) + return nil +} diff --git a/vendor/go.uber.org/atomic/uint32.go b/vendor/go.uber.org/atomic/uint32.go new file mode 100644 index 0000000..0b51732 --- /dev/null +++ b/vendor/go.uber.org/atomic/uint32.go @@ -0,0 +1,102 @@ +// @generated Code generated by gen-atomicint. + +// Copyright (c) 2020-2021 Uber Technologies, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package atomic + +import ( + "encoding/json" + "strconv" + "sync/atomic" +) + +// Uint32 is an atomic wrapper around uint32. +type Uint32 struct { + _ nocmp // disallow non-atomic comparison + + v uint32 +} + +// NewUint32 creates a new Uint32. +func NewUint32(i uint32) *Uint32 { + return &Uint32{v: i} +} + +// Load atomically loads the wrapped value. +func (i *Uint32) Load() uint32 { + return atomic.LoadUint32(&i.v) +} + +// Add atomically adds to the wrapped uint32 and returns the new value. +func (i *Uint32) Add(n uint32) uint32 { + return atomic.AddUint32(&i.v, n) +} + +// Sub atomically subtracts from the wrapped uint32 and returns the new value. +func (i *Uint32) Sub(n uint32) uint32 { + return atomic.AddUint32(&i.v, ^(n - 1)) +} + +// Inc atomically increments the wrapped uint32 and returns the new value. +func (i *Uint32) Inc() uint32 { + return i.Add(1) +} + +// Dec atomically decrements the wrapped uint32 and returns the new value. +func (i *Uint32) Dec() uint32 { + return i.Sub(1) +} + +// CAS is an atomic compare-and-swap. +func (i *Uint32) CAS(old, new uint32) bool { + return atomic.CompareAndSwapUint32(&i.v, old, new) +} + +// Store atomically stores the passed value. +func (i *Uint32) Store(n uint32) { + atomic.StoreUint32(&i.v, n) +} + +// Swap atomically swaps the wrapped uint32 and returns the old value. +func (i *Uint32) Swap(n uint32) uint32 { + return atomic.SwapUint32(&i.v, n) +} + +// MarshalJSON encodes the wrapped uint32 into JSON. +func (i *Uint32) MarshalJSON() ([]byte, error) { + return json.Marshal(i.Load()) +} + +// UnmarshalJSON decodes JSON into the wrapped uint32. +func (i *Uint32) UnmarshalJSON(b []byte) error { + var v uint32 + if err := json.Unmarshal(b, &v); err != nil { + return err + } + i.Store(v) + return nil +} + +// String encodes the wrapped value as a string. +func (i *Uint32) String() string { + v := i.Load() + return strconv.FormatUint(uint64(v), 10) +} diff --git a/vendor/go.uber.org/atomic/uint64.go b/vendor/go.uber.org/atomic/uint64.go new file mode 100644 index 0000000..71e3f32 --- /dev/null +++ b/vendor/go.uber.org/atomic/uint64.go @@ -0,0 +1,102 @@ +// @generated Code generated by gen-atomicint. + +// Copyright (c) 2020-2021 Uber Technologies, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package atomic + +import ( + "encoding/json" + "strconv" + "sync/atomic" +) + +// Uint64 is an atomic wrapper around uint64. +type Uint64 struct { + _ nocmp // disallow non-atomic comparison + + v uint64 +} + +// NewUint64 creates a new Uint64. +func NewUint64(i uint64) *Uint64 { + return &Uint64{v: i} +} + +// Load atomically loads the wrapped value. +func (i *Uint64) Load() uint64 { + return atomic.LoadUint64(&i.v) +} + +// Add atomically adds to the wrapped uint64 and returns the new value. +func (i *Uint64) Add(n uint64) uint64 { + return atomic.AddUint64(&i.v, n) +} + +// Sub atomically subtracts from the wrapped uint64 and returns the new value. +func (i *Uint64) Sub(n uint64) uint64 { + return atomic.AddUint64(&i.v, ^(n - 1)) +} + +// Inc atomically increments the wrapped uint64 and returns the new value. +func (i *Uint64) Inc() uint64 { + return i.Add(1) +} + +// Dec atomically decrements the wrapped uint64 and returns the new value. +func (i *Uint64) Dec() uint64 { + return i.Sub(1) +} + +// CAS is an atomic compare-and-swap. +func (i *Uint64) CAS(old, new uint64) bool { + return atomic.CompareAndSwapUint64(&i.v, old, new) +} + +// Store atomically stores the passed value. +func (i *Uint64) Store(n uint64) { + atomic.StoreUint64(&i.v, n) +} + +// Swap atomically swaps the wrapped uint64 and returns the old value. +func (i *Uint64) Swap(n uint64) uint64 { + return atomic.SwapUint64(&i.v, n) +} + +// MarshalJSON encodes the wrapped uint64 into JSON. +func (i *Uint64) MarshalJSON() ([]byte, error) { + return json.Marshal(i.Load()) +} + +// UnmarshalJSON decodes JSON into the wrapped uint64. +func (i *Uint64) UnmarshalJSON(b []byte) error { + var v uint64 + if err := json.Unmarshal(b, &v); err != nil { + return err + } + i.Store(v) + return nil +} + +// String encodes the wrapped value as a string. +func (i *Uint64) String() string { + v := i.Load() + return strconv.FormatUint(uint64(v), 10) +} diff --git a/vendor/go.uber.org/atomic/uintptr.go b/vendor/go.uber.org/atomic/uintptr.go new file mode 100644 index 0000000..6b363ad --- /dev/null +++ b/vendor/go.uber.org/atomic/uintptr.go @@ -0,0 +1,102 @@ +// @generated Code generated by gen-atomicint. + +// Copyright (c) 2020-2021 Uber Technologies, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package atomic + +import ( + "encoding/json" + "strconv" + "sync/atomic" +) + +// Uintptr is an atomic wrapper around uintptr. +type Uintptr struct { + _ nocmp // disallow non-atomic comparison + + v uintptr +} + +// NewUintptr creates a new Uintptr. +func NewUintptr(i uintptr) *Uintptr { + return &Uintptr{v: i} +} + +// Load atomically loads the wrapped value. +func (i *Uintptr) Load() uintptr { + return atomic.LoadUintptr(&i.v) +} + +// Add atomically adds to the wrapped uintptr and returns the new value. +func (i *Uintptr) Add(n uintptr) uintptr { + return atomic.AddUintptr(&i.v, n) +} + +// Sub atomically subtracts from the wrapped uintptr and returns the new value. +func (i *Uintptr) Sub(n uintptr) uintptr { + return atomic.AddUintptr(&i.v, ^(n - 1)) +} + +// Inc atomically increments the wrapped uintptr and returns the new value. +func (i *Uintptr) Inc() uintptr { + return i.Add(1) +} + +// Dec atomically decrements the wrapped uintptr and returns the new value. +func (i *Uintptr) Dec() uintptr { + return i.Sub(1) +} + +// CAS is an atomic compare-and-swap. +func (i *Uintptr) CAS(old, new uintptr) bool { + return atomic.CompareAndSwapUintptr(&i.v, old, new) +} + +// Store atomically stores the passed value. +func (i *Uintptr) Store(n uintptr) { + atomic.StoreUintptr(&i.v, n) +} + +// Swap atomically swaps the wrapped uintptr and returns the old value. +func (i *Uintptr) Swap(n uintptr) uintptr { + return atomic.SwapUintptr(&i.v, n) +} + +// MarshalJSON encodes the wrapped uintptr into JSON. +func (i *Uintptr) MarshalJSON() ([]byte, error) { + return json.Marshal(i.Load()) +} + +// UnmarshalJSON decodes JSON into the wrapped uintptr. +func (i *Uintptr) UnmarshalJSON(b []byte) error { + var v uintptr + if err := json.Unmarshal(b, &v); err != nil { + return err + } + i.Store(v) + return nil +} + +// String encodes the wrapped value as a string. +func (i *Uintptr) String() string { + v := i.Load() + return strconv.FormatUint(uint64(v), 10) +} diff --git a/vendor/go.uber.org/atomic/unsafe_pointer.go b/vendor/go.uber.org/atomic/unsafe_pointer.go new file mode 100644 index 0000000..a3830c6 --- /dev/null +++ b/vendor/go.uber.org/atomic/unsafe_pointer.go @@ -0,0 +1,58 @@ +// Copyright (c) 2021 Uber Technologies, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package atomic + +import ( + "sync/atomic" + "unsafe" +) + +// UnsafePointer is an atomic wrapper around unsafe.Pointer. +type UnsafePointer struct { + _ nocmp // disallow non-atomic comparison + + v unsafe.Pointer +} + +// NewUnsafePointer creates a new UnsafePointer. +func NewUnsafePointer(p unsafe.Pointer) *UnsafePointer { + return &UnsafePointer{v: p} +} + +// Load atomically loads the wrapped value. +func (p *UnsafePointer) Load() unsafe.Pointer { + return atomic.LoadPointer(&p.v) +} + +// Store atomically stores the passed value. +func (p *UnsafePointer) Store(q unsafe.Pointer) { + atomic.StorePointer(&p.v, q) +} + +// Swap atomically swaps the wrapped unsafe.Pointer and returns the old value. +func (p *UnsafePointer) Swap(q unsafe.Pointer) unsafe.Pointer { + return atomic.SwapPointer(&p.v, q) +} + +// CAS is an atomic compare-and-swap. +func (p *UnsafePointer) CAS(old, new unsafe.Pointer) bool { + return atomic.CompareAndSwapPointer(&p.v, old, new) +} diff --git a/vendor/go.uber.org/atomic/value.go b/vendor/go.uber.org/atomic/value.go new file mode 100644 index 0000000..671f3a3 --- /dev/null +++ b/vendor/go.uber.org/atomic/value.go @@ -0,0 +1,31 @@ +// Copyright (c) 2020 Uber Technologies, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package atomic + +import "sync/atomic" + +// Value shadows the type of the same name from sync/atomic +// https://godoc.org/sync/atomic#Value +type Value struct { + atomic.Value + + _ nocmp // disallow non-atomic comparison +} diff --git a/vendor/go.uber.org/multierr/.travis.yml b/vendor/go.uber.org/multierr/.travis.yml deleted file mode 100644 index 786c917..0000000 --- a/vendor/go.uber.org/multierr/.travis.yml +++ /dev/null @@ -1,29 +0,0 @@ -sudo: false -language: go -go_import_path: go.uber.org/multierr - -env: - global: - - GO15VENDOREXPERIMENT=1 - - GO111MODULE=on - -go: - - 1.11.x - - 1.12.x - - 1.13.x - -cache: - directories: - - vendor - -before_install: -- go version - -script: -- | - set -e - make lint - make cover - -after_success: -- bash <(curl -s https://codecov.io/bash) diff --git a/vendor/go.uber.org/multierr/CHANGELOG.md b/vendor/go.uber.org/multierr/CHANGELOG.md index 3110c5a..b0814e7 100644 --- a/vendor/go.uber.org/multierr/CHANGELOG.md +++ b/vendor/go.uber.org/multierr/CHANGELOG.md @@ -1,6 +1,18 @@ Releases ======== +v1.7.0 (2021-05-06) +=================== + +- Add `AppendInvoke` to append into errors from `defer` blocks. + + +v1.6.0 (2020-09-14) +=================== + +- Actually drop library dependency on development-time tooling. + + v1.5.0 (2020-02-24) =================== diff --git a/vendor/go.uber.org/multierr/LICENSE.txt b/vendor/go.uber.org/multierr/LICENSE.txt index 858e024..413e30f 100644 --- a/vendor/go.uber.org/multierr/LICENSE.txt +++ b/vendor/go.uber.org/multierr/LICENSE.txt @@ -1,4 +1,4 @@ -Copyright (c) 2017 Uber Technologies, Inc. +Copyright (c) 2017-2021 Uber Technologies, Inc. Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the "Software"), to deal diff --git a/vendor/go.uber.org/multierr/Makefile b/vendor/go.uber.org/multierr/Makefile index 4160182..dcb6fe7 100644 --- a/vendor/go.uber.org/multierr/Makefile +++ b/vendor/go.uber.org/multierr/Makefile @@ -21,12 +21,12 @@ gofmt: .PHONY: golint golint: - @go install golang.org/x/lint/golint + @cd tools && go install golang.org/x/lint/golint @$(GOBIN)/golint ./... .PHONY: staticcheck staticcheck: - @go install honnef.co/go/tools/cmd/staticcheck + @cd tools && go install honnef.co/go/tools/cmd/staticcheck @$(GOBIN)/staticcheck ./... .PHONY: lint @@ -34,9 +34,5 @@ lint: gofmt golint staticcheck .PHONY: cover cover: - go test -coverprofile=cover.out -coverpkg=./... -v ./... + go test -race -coverprofile=cover.out -coverpkg=./... -v ./... go tool cover -html=cover.out -o cover.html - -update-license: - @go install go.uber.org/tools/update-license - @$(GOBIN)/update-license $(GO_FILES) diff --git a/vendor/go.uber.org/multierr/README.md b/vendor/go.uber.org/multierr/README.md index 751bd65..70aacec 100644 --- a/vendor/go.uber.org/multierr/README.md +++ b/vendor/go.uber.org/multierr/README.md @@ -15,9 +15,9 @@ Stable: No breaking changes will be made before 2.0. Released under the [MIT License]. [MIT License]: LICENSE.txt -[doc-img]: https://godoc.org/go.uber.org/multierr?status.svg -[doc]: https://godoc.org/go.uber.org/multierr -[ci-img]: https://travis-ci.com/uber-go/multierr.svg?branch=master +[doc-img]: https://pkg.go.dev/badge/go.uber.org/multierr +[doc]: https://pkg.go.dev/go.uber.org/multierr +[ci-img]: https://github.com/uber-go/multierr/actions/workflows/go.yml/badge.svg [cov-img]: https://codecov.io/gh/uber-go/multierr/branch/master/graph/badge.svg -[ci]: https://travis-ci.com/uber-go/multierr +[ci]: https://github.com/uber-go/multierr/actions/workflows/go.yml [cov]: https://codecov.io/gh/uber-go/multierr diff --git a/vendor/go.uber.org/multierr/error.go b/vendor/go.uber.org/multierr/error.go index 04eb961..faa0a05 100644 --- a/vendor/go.uber.org/multierr/error.go +++ b/vendor/go.uber.org/multierr/error.go @@ -1,4 +1,4 @@ -// Copyright (c) 2019 Uber Technologies, Inc. +// Copyright (c) 2017-2021 Uber Technologies, Inc. // // Permission is hereby granted, free of charge, to any person obtaining a copy // of this software and associated documentation files (the "Software"), to deal @@ -35,8 +35,53 @@ // // err = multierr.Append(reader.Close(), writer.Close()) // -// This makes it possible to record resource cleanup failures from deferred -// blocks with the help of named return values. +// The underlying list of errors for a returned error object may be retrieved +// with the Errors function. +// +// errors := multierr.Errors(err) +// if len(errors) > 0 { +// fmt.Println("The following errors occurred:", errors) +// } +// +// Appending from a loop +// +// You sometimes need to append into an error from a loop. +// +// var err error +// for _, item := range items { +// err = multierr.Append(err, process(item)) +// } +// +// Cases like this may require knowledge of whether an individual instance +// failed. This usually requires introduction of a new variable. +// +// var err error +// for _, item := range items { +// if perr := process(item); perr != nil { +// log.Warn("skipping item", item) +// err = multierr.Append(err, perr) +// } +// } +// +// multierr includes AppendInto to simplify cases like this. +// +// var err error +// for _, item := range items { +// if multierr.AppendInto(&err, process(item)) { +// log.Warn("skipping item", item) +// } +// } +// +// This will append the error into the err variable, and return true if that +// individual error was non-nil. +// +// See AppendInto for more information. +// +// Deferred Functions +// +// Go makes it possible to modify the return value of a function in a defer +// block if the function was using named returns. This makes it possible to +// record resource cleanup failures from deferred blocks. // // func sendRequest(req Request) (err error) { // conn, err := openConnection() @@ -49,14 +94,21 @@ // // ... // } // -// The underlying list of errors for a returned error object may be retrieved -// with the Errors function. +// multierr provides the Invoker type and AppendInvoke function to make cases +// like the above simpler and obviate the need for a closure. The following is +// roughly equivalent to the example above. // -// errors := multierr.Errors(err) -// if len(errors) > 0 { -// fmt.Println("The following errors occurred:") +// func sendRequest(req Request) (err error) { +// conn, err := openConnection() +// if err != nil { +// return err +// } +// defer multierr.AppendInvoke(err, multierr.Close(conn)) +// // ... // } // +// See AppendInvoke and Invoker for more information. +// // Advanced Usage // // Errors returned by Combine and Append MAY implement the following @@ -87,6 +139,7 @@ package multierr // import "go.uber.org/multierr" import ( "bytes" + "errors" "fmt" "io" "strings" @@ -186,6 +239,33 @@ func (merr *multiError) Errors() []error { return merr.errors } +// As attempts to find the first error in the error list that matches the type +// of the value that target points to. +// +// This function allows errors.As to traverse the values stored on the +// multierr error. +func (merr *multiError) As(target interface{}) bool { + for _, err := range merr.Errors() { + if errors.As(err, target) { + return true + } + } + return false +} + +// Is attempts to match the provided error against errors in the error list. +// +// This function allows errors.Is to traverse the values stored on the +// multierr error. +func (merr *multiError) Is(target error) bool { + for _, err := range merr.Errors() { + if errors.Is(err, target) { + return true + } + } + return false +} + func (merr *multiError) Error() string { if merr == nil { return "" @@ -421,7 +501,7 @@ func Append(left error, right error) error { // items = append(items, item) // } // -// Compare this with a verison that relies solely on Append: +// Compare this with a version that relies solely on Append: // // var err error // for line := range lines { @@ -447,3 +527,113 @@ func AppendInto(into *error, err error) (errored bool) { *into = Append(*into, err) return true } + +// Invoker is an operation that may fail with an error. Use it with +// AppendInvoke to append the result of calling the function into an error. +// This allows you to conveniently defer capture of failing operations. +// +// See also, Close and Invoke. +type Invoker interface { + Invoke() error +} + +// Invoke wraps a function which may fail with an error to match the Invoker +// interface. Use it to supply functions matching this signature to +// AppendInvoke. +// +// For example, +// +// func processReader(r io.Reader) (err error) { +// scanner := bufio.NewScanner(r) +// defer multierr.AppendInvoke(&err, multierr.Invoke(scanner.Err)) +// for scanner.Scan() { +// // ... +// } +// // ... +// } +// +// In this example, the following line will construct the Invoker right away, +// but defer the invocation of scanner.Err() until the function returns. +// +// defer multierr.AppendInvoke(&err, multierr.Invoke(scanner.Err)) +type Invoke func() error + +// Invoke calls the supplied function and returns its result. +func (i Invoke) Invoke() error { return i() } + +// Close builds an Invoker that closes the provided io.Closer. Use it with +// AppendInvoke to close io.Closers and append their results into an error. +// +// For example, +// +// func processFile(path string) (err error) { +// f, err := os.Open(path) +// if err != nil { +// return err +// } +// defer multierr.AppendInvoke(&err, multierr.Close(f)) +// return processReader(f) +// } +// +// In this example, multierr.Close will construct the Invoker right away, but +// defer the invocation of f.Close until the function returns. +// +// defer multierr.AppendInvoke(&err, multierr.Close(f)) +func Close(closer io.Closer) Invoker { + return Invoke(closer.Close) +} + +// AppendInvoke appends the result of calling the given Invoker into the +// provided error pointer. Use it with named returns to safely defer +// invocation of fallible operations until a function returns, and capture the +// resulting errors. +// +// func doSomething(...) (err error) { +// // ... +// f, err := openFile(..) +// if err != nil { +// return err +// } +// +// // multierr will call f.Close() when this function returns and +// // if the operation fails, its append its error into the +// // returned error. +// defer multierr.AppendInvoke(&err, multierr.Close(f)) +// +// scanner := bufio.NewScanner(f) +// // Similarly, this scheduled scanner.Err to be called and +// // inspected when the function returns and append its error +// // into the returned error. +// defer multierr.AppendInvoke(&err, multierr.Invoke(scanner.Err)) +// +// // ... +// } +// +// Without defer, AppendInvoke behaves exactly like AppendInto. +// +// err := // ... +// multierr.AppendInvoke(&err, mutltierr.Invoke(foo)) +// +// // ...is roughly equivalent to... +// +// err := // ... +// multierr.AppendInto(&err, foo()) +// +// The advantage of the indirection introduced by Invoker is to make it easy +// to defer the invocation of a function. Without this indirection, the +// invoked function will be evaluated at the time of the defer block rather +// than when the function returns. +// +// // BAD: This is likely not what the caller intended. This will evaluate +// // foo() right away and append its result into the error when the +// // function returns. +// defer multierr.AppendInto(&err, foo()) +// +// // GOOD: This will defer invocation of foo unutil the function returns. +// defer multierr.AppendInvoke(&err, multierr.Invoke(foo)) +// +// multierr provides a few Invoker implementations out of the box for +// convenience. See Invoker for more information. +func AppendInvoke(into *error, invoker Invoker) { + AppendInto(into, invoker.Invoke()) +} diff --git a/vendor/go.uber.org/multierr/go.mod b/vendor/go.uber.org/multierr/go.mod index 58d5f90..398d6c9 100644 --- a/vendor/go.uber.org/multierr/go.mod +++ b/vendor/go.uber.org/multierr/go.mod @@ -1,12 +1,9 @@ module go.uber.org/multierr -go 1.12 +go 1.14 require ( - github.com/stretchr/testify v1.3.0 - go.uber.org/atomic v1.6.0 - go.uber.org/tools v0.0.0-20190618225709-2cfd321de3ee - golang.org/x/lint v0.0.0-20190930215403-16217165b5de - golang.org/x/tools v0.0.0-20191029190741-b9c20aec41a5 // indirect - honnef.co/go/tools v0.0.1-2019.2.3 + github.com/stretchr/testify v1.7.0 + go.uber.org/atomic v1.7.0 + gopkg.in/yaml.v3 v3.0.0-20210107192922-496545a6307b // indirect ) diff --git a/vendor/go.uber.org/multierr/go.sum b/vendor/go.uber.org/multierr/go.sum index 557fbba..75edd73 100644 --- a/vendor/go.uber.org/multierr/go.sum +++ b/vendor/go.uber.org/multierr/go.sum @@ -1,45 +1,16 @@ -github.com/BurntSushi/toml v0.3.1 h1:WXkYYl6Yr3qBf1K79EBnL4mak0OimBfB0XUf9Vl28OQ= -github.com/BurntSushi/toml v0.3.1/go.mod h1:xHWCNGjB5oqiDr8zfno3MHue2Ht5sIBksp03qcyfWMU= -github.com/davecgh/go-spew v1.1.0 h1:ZDRjVQ15GmhC3fiQ8ni8+OwkZQO4DARzQgrnXU1Liz8= github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c= github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= -github.com/google/renameio v0.1.0/go.mod h1:KWCgfxg9yswjAJkECMjeO8J8rahYeXnNhOm40UhjYkI= -github.com/kisielk/gotool v1.0.0/go.mod h1:XhKaO+MFFWcvkIS/tQcRk01m1F5IRFswLeQ+oQHNcck= -github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo= -github.com/kr/pty v1.1.1/go.mod h1:pFQYn66WHrOpPYNljwOMqo10TkYh1fy3cYio2l3bCsQ= -github.com/kr/text v0.1.0/go.mod h1:4Jbv+DJW3UT/LiOwJeYQe1efqtUx/iVham/4vfdArNI= github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= -github.com/rogpeppe/go-internal v1.3.0/go.mod h1:M8bDsm7K2OlrFYOpmOWEs/qY81heoFRclV5y23lUDJ4= github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= -github.com/stretchr/testify v1.3.0 h1:TivCn/peBQ7UY8ooIcPgZFpTNSz0Q2U6UrFlUfqbe0Q= github.com/stretchr/testify v1.3.0/go.mod h1:M5WIy9Dh21IEIfnGCwXGc5bZfKNJtfHm1UVUgZn+9EI= -go.uber.org/atomic v1.6.0 h1:Ezj3JGmsOnG1MoRWQkPBsKLe9DwWD9QeXzTRzzldNVk= -go.uber.org/atomic v1.6.0/go.mod h1:sABNBOSYdrvTF6hTgEIbc7YasKWGhgEQZyfxyTvoXHQ= -go.uber.org/tools v0.0.0-20190618225709-2cfd321de3ee h1:0mgffUl7nfd+FpvXMVz4IDEaUSmT1ysygQC7qYo7sG4= -go.uber.org/tools v0.0.0-20190618225709-2cfd321de3ee/go.mod h1:vJERXedbb3MVM5f9Ejo0C68/HhF8uaILCdgjnY+goOA= -golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w= -golang.org/x/crypto v0.0.0-20190510104115-cbcb75029529/go.mod h1:yigFU9vqHzYiE8UmvKecakEJjdnWj3jj499lnFckfCI= -golang.org/x/lint v0.0.0-20190930215403-16217165b5de h1:5hukYrvBGR8/eNkX5mdUezrA6JiaEZDtJb9Ei+1LlBs= -golang.org/x/lint v0.0.0-20190930215403-16217165b5de/go.mod h1:6SW0HCj/g11FgYtHlgUYUwCkIfeOF89ocIRzGO/8vkc= -golang.org/x/mod v0.0.0-20190513183733-4bf6d317e70e/go.mod h1:mXi4GBBbnImb6dmsKGUJ2LatrhH/nqhxcFungHvyanc= -golang.org/x/net v0.0.0-20190311183353-d8887717615a/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg= -golang.org/x/net v0.0.0-20190404232315-eb5bcb51f2a3/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg= -golang.org/x/net v0.0.0-20190620200207-3b0461eec859 h1:R/3boaszxrf1GEUWTVDzSKVwLmSJpwZ1yqXm8j0v2QI= -golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s= -golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= -golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= -golang.org/x/sys v0.0.0-20190412213103-97732733099d/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= -golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= -golang.org/x/tools v0.0.0-20190311212946-11955173bddd/go.mod h1:LCzVGOaR6xXOjkQ3onu1FJEFr0SW1gC7cKk1uF8kGRs= -golang.org/x/tools v0.0.0-20190621195816-6e04913cbbac/go.mod h1:/rFqwRUd4F7ZHNgwSSTFct+R/Kf4OFW1sUzUTQQTgfc= -golang.org/x/tools v0.0.0-20191029041327-9cc4af7d6b2c h1:IGkKhmfzcztjm6gYkykvu/NiS8kaqbCWAEWWAyf8J5U= -golang.org/x/tools v0.0.0-20191029041327-9cc4af7d6b2c/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo= -golang.org/x/tools v0.0.0-20191029190741-b9c20aec41a5 h1:hKsoRgsbwY1NafxrwTs+k64bikrLBkAgPir1TNCj3Zs= -golang.org/x/tools v0.0.0-20191029190741-b9c20aec41a5/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo= -golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= -gopkg.in/check.v1 v1.0.0-20180628173108-788fd7840127/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= -gopkg.in/errgo.v2 v2.1.0/go.mod h1:hNsd1EY+bozCKY1Ytp96fpM3vjJbqLJn88ws8XvfDNI= -honnef.co/go/tools v0.0.1-2019.2.3 h1:3JgtbtFHMiCmsznwGVTUWbgGov+pVqnlf1dEJTNAXeM= -honnef.co/go/tools v0.0.1-2019.2.3/go.mod h1:a3bituU0lyd329TUQxRnasdCoJDkEUEAqEt0JzvZhAg= +github.com/stretchr/testify v1.7.0 h1:nwc3DEeHmmLAfoZucVR881uASk0Mfjw8xYJ99tb5CcY= +github.com/stretchr/testify v1.7.0/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg= +go.uber.org/atomic v1.7.0 h1:ADUqmZGgLDDfbSL9ZmPxKTybcoEYHgpYfELNoN+7hsw= +go.uber.org/atomic v1.7.0/go.mod h1:fEN4uk6kAWBTFdckzkM89CLk9XfWZrxpCo0nPH17wJc= +gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 h1:yhCVgyC4o1eVCa2tZl7eS0r+SDo693bJlVdllGtEeKM= +gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= +gopkg.in/yaml.v3 v3.0.0-20200313102051-9f266ea9e77c/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= +gopkg.in/yaml.v3 v3.0.0-20210107192922-496545a6307b h1:h8qDotaEPuJATrMmW04NCwg7v22aHH28wwpauUhK9Oo= +gopkg.in/yaml.v3 v3.0.0-20210107192922-496545a6307b/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= diff --git a/vendor/go.uber.org/zap/.travis.yml b/vendor/go.uber.org/zap/.travis.yml deleted file mode 100644 index cfdc69f..0000000 --- a/vendor/go.uber.org/zap/.travis.yml +++ /dev/null @@ -1,23 +0,0 @@ -language: go -sudo: false - -go_import_path: go.uber.org/zap -env: - global: - - TEST_TIMEOUT_SCALE=10 - - GO111MODULE=on - -matrix: - include: - - go: 1.13.x - - go: 1.14.x - env: LINT=1 - -script: - - test -z "$LINT" || make lint - - make test - - make bench - -after_success: - - make cover - - bash <(curl -s https://codecov.io/bash) diff --git a/vendor/go.uber.org/zap/CHANGELOG.md b/vendor/go.uber.org/zap/CHANGELOG.md index fa817e6..6c32101 100644 --- a/vendor/go.uber.org/zap/CHANGELOG.md +++ b/vendor/go.uber.org/zap/CHANGELOG.md @@ -1,5 +1,56 @@ # Changelog +## 1.18.1 (28 Jun 2021) + +Bugfixes: +* [#974][]: Fix nil dereference in logger constructed by `zap.NewNop`. + +[#974]: https://github.com/uber-go/zap/pull/974 + +## 1.18.0 (28 Jun 2021) + +Enhancements: +* [#961][]: Add `zapcore.BufferedWriteSyncer`, a new `WriteSyncer` that buffers + messages in-memory and flushes them periodically. +* [#971][]: Add `zapio.Writer` to use a Zap logger as an `io.Writer`. +* [#897][]: Add `zap.WithClock` option to control the source of time via the + new `zapcore.Clock` interface. +* [#949][]: Avoid panicking in `zap.SugaredLogger` when arguments of `*w` + methods don't match expectations. +* [#943][]: Add support for filtering by level or arbitrary matcher function to + `zaptest/observer`. +* [#691][]: Comply with `io.StringWriter` and `io.ByteWriter` in Zap's + `buffer.Buffer`. + +Thanks to @atrn0, @ernado, @heyanfu, @hnlq715, @zchee +for their contributions to this release. + +[#691]: https://github.com/uber-go/zap/pull/691 +[#897]: https://github.com/uber-go/zap/pull/897 +[#943]: https://github.com/uber-go/zap/pull/943 +[#949]: https://github.com/uber-go/zap/pull/949 +[#961]: https://github.com/uber-go/zap/pull/961 +[#971]: https://github.com/uber-go/zap/pull/971 + +## 1.17.0 (25 May 2021) + +Bugfixes: +* [#867][]: Encode `` for nil `error` instead of a panic. +* [#931][], [#936][]: Update minimum version constraints to address + vulnerabilities in dependencies. + +Enhancements: +* [#865][]: Improve alignment of fields of the Logger struct, reducing its + size from 96 to 80 bytes. +* [#881][]: Support `grpclog.LoggerV2` in zapgrpc. +* [#903][]: Support URL-encoded POST requests to the AtomicLevel HTTP handler + with the `application/x-www-form-urlencoded` content type. +* [#912][]: Support multi-field encoding with `zap.Inline`. +* [#913][]: Speed up SugaredLogger for calls with a single string. +* [#928][]: Add support for filtering by field name to `zaptest/observer`. + +Thanks to @ash2k, @FMLS, @jimmystewpot, @Oncilla, @tsoslow, @tylitianrui, @withshubh, and @wziww for their contributions to this release. + ## 1.16.0 (1 Sep 2020) Bugfixes: @@ -430,3 +481,12 @@ upgrade to the upcoming stable release. [#854]: https://github.com/uber-go/zap/pull/854 [#861]: https://github.com/uber-go/zap/pull/861 [#862]: https://github.com/uber-go/zap/pull/862 +[#865]: https://github.com/uber-go/zap/pull/865 +[#867]: https://github.com/uber-go/zap/pull/867 +[#881]: https://github.com/uber-go/zap/pull/881 +[#903]: https://github.com/uber-go/zap/pull/903 +[#912]: https://github.com/uber-go/zap/pull/912 +[#913]: https://github.com/uber-go/zap/pull/913 +[#928]: https://github.com/uber-go/zap/pull/928 +[#931]: https://github.com/uber-go/zap/pull/931 +[#936]: https://github.com/uber-go/zap/pull/936 diff --git a/vendor/go.uber.org/zap/CONTRIBUTING.md b/vendor/go.uber.org/zap/CONTRIBUTING.md index 9454bba..5cd9656 100644 --- a/vendor/go.uber.org/zap/CONTRIBUTING.md +++ b/vendor/go.uber.org/zap/CONTRIBUTING.md @@ -25,12 +25,6 @@ git remote add upstream https://github.com/uber-go/zap.git git fetch upstream ``` -Install zap's dependencies: - -``` -make dependencies -``` - Make sure that the tests and the linters pass: ``` diff --git a/vendor/go.uber.org/zap/FAQ.md b/vendor/go.uber.org/zap/FAQ.md index 5ec7288..b183b20 100644 --- a/vendor/go.uber.org/zap/FAQ.md +++ b/vendor/go.uber.org/zap/FAQ.md @@ -27,6 +27,13 @@ abstraction, and it lets us add methods without introducing breaking changes. Your applications should define and depend upon an interface that includes just the methods you use. +### Why are some of my logs missing? + +Logs are dropped intentionally by zap when sampling is enabled. The production +configuration (as returned by `NewProductionConfig()` enables sampling which will +cause repeated logs within a second to be sampled. See more details on why sampling +is enabled in [Why sample application logs](https://github.com/uber-go/zap/blob/master/FAQ.md#why-sample-application-logs). + ### Why sample application logs? Applications often experience runs of errors, either because of a bug or @@ -150,6 +157,7 @@ We're aware of the following extensions, but haven't used them ourselves: | `github.com/fgrosse/zaptest` | Ginkgo | | `github.com/blendle/zapdriver` | Stackdriver | | `github.com/moul/zapgorm` | Gorm | +| `github.com/moul/zapfilter` | Advanced filtering rules | [go-proverbs]: https://go-proverbs.github.io/ [import-path]: https://golang.org/cmd/go/#hdr-Remote_import_paths diff --git a/vendor/go.uber.org/zap/Makefile b/vendor/go.uber.org/zap/Makefile index dfaf640..9b1bc3b 100644 --- a/vendor/go.uber.org/zap/Makefile +++ b/vendor/go.uber.org/zap/Makefile @@ -7,7 +7,7 @@ BENCH_FLAGS ?= -cpuprofile=cpu.pprof -memprofile=mem.pprof -benchmem # Directories containing independent Go modules. # # We track coverage only for the main module. -MODULE_DIRS = . ./benchmarks +MODULE_DIRS = . ./benchmarks ./zapgrpc/internal/test # Many Go tools take file globs or directories as arguments instead of packages. GO_FILES := $(shell \ @@ -33,12 +33,18 @@ lint: $(GOLINT) $(STATICCHECK) @echo "Checking for license headers..." @./checklicense.sh | tee -a lint.log @[ ! -s lint.log ] + @echo "Checking 'go mod tidy'..." + @make tidy + @if ! git diff --quiet; then \ + echo "'go mod tidy' resulted in changes or working tree is dirty:"; \ + git --no-pager diff; \ + fi $(GOLINT): - go install golang.org/x/lint/golint + cd tools && go install golang.org/x/lint/golint $(STATICCHECK): - go install honnef.co/go/tools/cmd/staticcheck + cd tools && go install honnef.co/go/tools/cmd/staticcheck .PHONY: test test: @@ -61,3 +67,7 @@ bench: updatereadme: rm -f README.md cat .readme.tmpl | go run internal/readme/readme.go > README.md + +.PHONY: tidy +tidy: + @$(foreach dir,$(MODULE_DIRS),(cd $(dir) && go mod tidy) &&) true diff --git a/vendor/go.uber.org/zap/README.md b/vendor/go.uber.org/zap/README.md index bcea28a..1e64d6c 100644 --- a/vendor/go.uber.org/zap/README.md +++ b/vendor/go.uber.org/zap/README.md @@ -123,10 +123,10 @@ Released under the [MIT License](LICENSE.txt). benchmarking against slightly older versions of other packages. Versions are pinned in the [benchmarks/go.mod][] file. [↩](#anchor-versions) -[doc-img]: https://godoc.org/go.uber.org/zap?status.svg -[doc]: https://godoc.org/go.uber.org/zap -[ci-img]: https://travis-ci.com/uber-go/zap.svg?branch=master -[ci]: https://travis-ci.com/uber-go/zap +[doc-img]: https://pkg.go.dev/badge/go.uber.org/zap +[doc]: https://pkg.go.dev/go.uber.org/zap +[ci-img]: https://github.com/uber-go/zap/actions/workflows/go.yml/badge.svg +[ci]: https://github.com/uber-go/zap/actions/workflows/go.yml [cov-img]: https://codecov.io/gh/uber-go/zap/branch/master/graph/badge.svg [cov]: https://codecov.io/gh/uber-go/zap [benchmarking suite]: https://github.com/uber-go/zap/tree/master/benchmarks diff --git a/vendor/go.uber.org/zap/buffer/buffer.go b/vendor/go.uber.org/zap/buffer/buffer.go index 3f4b86e..9e929cd 100644 --- a/vendor/go.uber.org/zap/buffer/buffer.go +++ b/vendor/go.uber.org/zap/buffer/buffer.go @@ -106,6 +106,24 @@ func (b *Buffer) Write(bs []byte) (int, error) { return len(bs), nil } +// WriteByte writes a single byte to the Buffer. +// +// Error returned is always nil, function signature is compatible +// with bytes.Buffer and bufio.Writer +func (b *Buffer) WriteByte(v byte) error { + b.AppendByte(v) + return nil +} + +// WriteString writes a string to the Buffer. +// +// Error returned is always nil, function signature is compatible +// with bytes.Buffer and bufio.Writer +func (b *Buffer) WriteString(s string) (int, error) { + b.AppendString(s) + return len(s), nil +} + // TrimNewline trims any final "\n" byte from the end of the buffer. func (b *Buffer) TrimNewline() { if i := len(b.bs) - 1; i >= 0 { diff --git a/vendor/go.uber.org/zap/field.go b/vendor/go.uber.org/zap/field.go index 3c0d7d9..bbb745d 100644 --- a/vendor/go.uber.org/zap/field.go +++ b/vendor/go.uber.org/zap/field.go @@ -400,6 +400,16 @@ func Object(key string, val zapcore.ObjectMarshaler) Field { return Field{Key: key, Type: zapcore.ObjectMarshalerType, Interface: val} } +// Inline constructs a Field that is similar to Object, but it +// will add the elements of the provided ObjectMarshaler to the +// current namespace. +func Inline(val zapcore.ObjectMarshaler) Field { + return zapcore.Field{ + Type: zapcore.InlineMarshalerType, + Interface: val, + } +} + // Any takes a key and an arbitrary value and chooses the best way to represent // them as a field, falling back to a reflection-based approach only if // necessary. diff --git a/vendor/go.uber.org/zap/go.mod b/vendor/go.uber.org/zap/go.mod index 6ef4db7..9455c99 100644 --- a/vendor/go.uber.org/zap/go.mod +++ b/vendor/go.uber.org/zap/go.mod @@ -3,11 +3,12 @@ module go.uber.org/zap go 1.13 require ( + github.com/benbjohnson/clock v1.1.0 github.com/pkg/errors v0.8.1 - github.com/stretchr/testify v1.4.0 - go.uber.org/atomic v1.6.0 - go.uber.org/multierr v1.5.0 - golang.org/x/lint v0.0.0-20190930215403-16217165b5de - gopkg.in/yaml.v2 v2.2.2 - honnef.co/go/tools v0.0.1-2019.2.3 + github.com/stretchr/testify v1.7.0 + go.uber.org/atomic v1.7.0 + go.uber.org/goleak v1.1.10 + go.uber.org/multierr v1.6.0 + gopkg.in/yaml.v2 v2.2.8 + gopkg.in/yaml.v3 v3.0.0-20210107192922-496545a6307b // indirect ) diff --git a/vendor/go.uber.org/zap/go.sum b/vendor/go.uber.org/zap/go.sum index 99cdb93..b330071 100644 --- a/vendor/go.uber.org/zap/go.sum +++ b/vendor/go.uber.org/zap/go.sum @@ -1,13 +1,11 @@ -github.com/BurntSushi/toml v0.3.1 h1:WXkYYl6Yr3qBf1K79EBnL4mak0OimBfB0XUf9Vl28OQ= -github.com/BurntSushi/toml v0.3.1/go.mod h1:xHWCNGjB5oqiDr8zfno3MHue2Ht5sIBksp03qcyfWMU= -github.com/davecgh/go-spew v1.1.0 h1:ZDRjVQ15GmhC3fiQ8ni8+OwkZQO4DARzQgrnXU1Liz8= +github.com/benbjohnson/clock v1.1.0 h1:Q92kusRqC1XV2MjkWETPvjJVqKetz1OzxZB7mHJLju8= +github.com/benbjohnson/clock v1.1.0/go.mod h1:J11/hYXuz8f4ySSvYwY0FKfm+ezbsZBKZxNJlLklBHA= github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c= github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= -github.com/google/renameio v0.1.0/go.mod h1:KWCgfxg9yswjAJkECMjeO8J8rahYeXnNhOm40UhjYkI= -github.com/kisielk/gotool v1.0.0/go.mod h1:XhKaO+MFFWcvkIS/tQcRk01m1F5IRFswLeQ+oQHNcck= github.com/kr/pretty v0.1.0 h1:L/CwN0zerZDmRFUapSPitk6f+Q3+0za1rQkzVuMiMFI= github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo= +github.com/kr/pty v1.1.1 h1:VkoXIwSboBpnk99O/KFauAEILuNHv5DVFKZMBN/gUgw= github.com/kr/pty v1.1.1/go.mod h1:pFQYn66WHrOpPYNljwOMqo10TkYh1fy3cYio2l3bCsQ= github.com/kr/text v0.1.0 h1:45sCR5RtlFHMR4UwH9sdQ5TC8v0qDQCHnXt+kaKSTVE= github.com/kr/text v0.1.0/go.mod h1:4Jbv+DJW3UT/LiOwJeYQe1efqtUx/iVham/4vfdArNI= @@ -15,42 +13,42 @@ github.com/pkg/errors v0.8.1 h1:iURUrRGxPUNPdy5/HRSm+Yj6okJ6UtLINN0Q9M4+h3I= github.com/pkg/errors v0.8.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= -github.com/rogpeppe/go-internal v1.3.0/go.mod h1:M8bDsm7K2OlrFYOpmOWEs/qY81heoFRclV5y23lUDJ4= +github.com/stretchr/objx v0.1.0 h1:4G4v2dO3VZwixGIRoQ5Lfboy6nUhCyYzaqnIAPPhYs4= github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= github.com/stretchr/testify v1.3.0/go.mod h1:M5WIy9Dh21IEIfnGCwXGc5bZfKNJtfHm1UVUgZn+9EI= -github.com/stretchr/testify v1.4.0 h1:2E4SXV/wtOkTonXsotYi4li6zVWxYlZuYNCXe9XRJyk= github.com/stretchr/testify v1.4.0/go.mod h1:j7eGeouHqKxXV5pUuKE4zz7dFj8WfuZ+81PSLYec5m4= -go.uber.org/atomic v1.6.0 h1:Ezj3JGmsOnG1MoRWQkPBsKLe9DwWD9QeXzTRzzldNVk= -go.uber.org/atomic v1.6.0/go.mod h1:sABNBOSYdrvTF6hTgEIbc7YasKWGhgEQZyfxyTvoXHQ= -go.uber.org/multierr v1.5.0 h1:KCa4XfM8CWFCpxXRGok+Q0SS/0XBhMDbHHGABQLvD2A= -go.uber.org/multierr v1.5.0/go.mod h1:FeouvMocqHpRaaGuG9EjoKcStLC43Zu/fmqdUMPcKYU= -go.uber.org/tools v0.0.0-20190618225709-2cfd321de3ee h1:0mgffUl7nfd+FpvXMVz4IDEaUSmT1ysygQC7qYo7sG4= -go.uber.org/tools v0.0.0-20190618225709-2cfd321de3ee/go.mod h1:vJERXedbb3MVM5f9Ejo0C68/HhF8uaILCdgjnY+goOA= +github.com/stretchr/testify v1.7.0 h1:nwc3DEeHmmLAfoZucVR881uASk0Mfjw8xYJ99tb5CcY= +github.com/stretchr/testify v1.7.0/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg= +go.uber.org/atomic v1.7.0 h1:ADUqmZGgLDDfbSL9ZmPxKTybcoEYHgpYfELNoN+7hsw= +go.uber.org/atomic v1.7.0/go.mod h1:fEN4uk6kAWBTFdckzkM89CLk9XfWZrxpCo0nPH17wJc= +go.uber.org/goleak v1.1.10 h1:z+mqJhf6ss6BSfSM671tgKyZBFPTTJM+HLxnhPC3wu0= +go.uber.org/goleak v1.1.10/go.mod h1:8a7PlsEVH3e/a/GLqe5IIrQx6GzcnRmZEufDUTk4A7A= +go.uber.org/multierr v1.6.0 h1:y6IPFStTAIT5Ytl7/XYmHvzXQ7S3g/IeZW9hyZ5thw4= +go.uber.org/multierr v1.6.0/go.mod h1:cdWPpRnG4AhwMwsgIHip0KRBQjJy5kYEpYjJxpXp9iU= +golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2 h1:VklqNMn3ovrHsnt90PveolxSbWFaJdECFbxSq0Mqo2M= golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w= -golang.org/x/crypto v0.0.0-20190510104115-cbcb75029529/go.mod h1:yigFU9vqHzYiE8UmvKecakEJjdnWj3jj499lnFckfCI= golang.org/x/lint v0.0.0-20190930215403-16217165b5de h1:5hukYrvBGR8/eNkX5mdUezrA6JiaEZDtJb9Ei+1LlBs= golang.org/x/lint v0.0.0-20190930215403-16217165b5de/go.mod h1:6SW0HCj/g11FgYtHlgUYUwCkIfeOF89ocIRzGO/8vkc= -golang.org/x/mod v0.0.0-20190513183733-4bf6d317e70e/go.mod h1:mXi4GBBbnImb6dmsKGUJ2LatrhH/nqhxcFungHvyanc= golang.org/x/net v0.0.0-20190311183353-d8887717615a/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg= -golang.org/x/net v0.0.0-20190404232315-eb5bcb51f2a3/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg= +golang.org/x/net v0.0.0-20190620200207-3b0461eec859 h1:R/3boaszxrf1GEUWTVDzSKVwLmSJpwZ1yqXm8j0v2QI= golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s= +golang.org/x/sync v0.0.0-20190423024810-112230192c58 h1:8gQV6CLnAEikrhgkHFbMAEhagSSnXWGV915qUMm9mrU= golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= +golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a h1:1BGLXjeY4akVXGgbC9HugT3Jv3hCI0z56oJR5vAMgBU= golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= -golang.org/x/sys v0.0.0-20190412213103-97732733099d/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= +golang.org/x/text v0.3.0 h1:g61tztE5qeGQ89tm6NTjjM9VPIm088od1l6aSorWRWg= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/tools v0.0.0-20190311212946-11955173bddd/go.mod h1:LCzVGOaR6xXOjkQ3onu1FJEFr0SW1gC7cKk1uF8kGRs= -golang.org/x/tools v0.0.0-20190621195816-6e04913cbbac/go.mod h1:/rFqwRUd4F7ZHNgwSSTFct+R/Kf4OFW1sUzUTQQTgfc= -golang.org/x/tools v0.0.0-20191029041327-9cc4af7d6b2c h1:IGkKhmfzcztjm6gYkykvu/NiS8kaqbCWAEWWAyf8J5U= -golang.org/x/tools v0.0.0-20191029041327-9cc4af7d6b2c/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo= -golang.org/x/tools v0.0.0-20191029190741-b9c20aec41a5 h1:hKsoRgsbwY1NafxrwTs+k64bikrLBkAgPir1TNCj3Zs= -golang.org/x/tools v0.0.0-20191029190741-b9c20aec41a5/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo= +golang.org/x/tools v0.0.0-20191108193012-7d206e10da11 h1:Yq9t9jnGoR+dBuitxdo9l6Q7xh/zOyNnYUtDKaQ3x0E= +golang.org/x/tools v0.0.0-20191108193012-7d206e10da11/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo= +golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7 h1:9zdDQZ7Thm29KFXgAX/+yaf3eVbP7djjWp/dXAppNCc= golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= -gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 h1:yhCVgyC4o1eVCa2tZl7eS0r+SDo693bJlVdllGtEeKM= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/check.v1 v1.0.0-20180628173108-788fd7840127 h1:qIbj1fsPNlZgppZ+VLlY7N33q108Sa+fhmuc+sWQYwY= gopkg.in/check.v1 v1.0.0-20180628173108-788fd7840127/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= -gopkg.in/errgo.v2 v2.1.0/go.mod h1:hNsd1EY+bozCKY1Ytp96fpM3vjJbqLJn88ws8XvfDNI= -gopkg.in/yaml.v2 v2.2.2 h1:ZCJp+EgiOT7lHqUV2J862kp8Qj64Jo6az82+3Td9dZw= gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= -honnef.co/go/tools v0.0.1-2019.2.3 h1:3JgtbtFHMiCmsznwGVTUWbgGov+pVqnlf1dEJTNAXeM= -honnef.co/go/tools v0.0.1-2019.2.3/go.mod h1:a3bituU0lyd329TUQxRnasdCoJDkEUEAqEt0JzvZhAg= +gopkg.in/yaml.v2 v2.2.8 h1:obN1ZagJSUGI0Ek/LBmuj4SNLPfIny3KsKFopxRdj10= +gopkg.in/yaml.v2 v2.2.8/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= +gopkg.in/yaml.v3 v3.0.0-20200313102051-9f266ea9e77c/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= +gopkg.in/yaml.v3 v3.0.0-20210107192922-496545a6307b h1:h8qDotaEPuJATrMmW04NCwg7v22aHH28wwpauUhK9Oo= +gopkg.in/yaml.v3 v3.0.0-20210107192922-496545a6307b/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= diff --git a/vendor/go.uber.org/zap/http_handler.go b/vendor/go.uber.org/zap/http_handler.go index 1b0ecac..1297c33 100644 --- a/vendor/go.uber.org/zap/http_handler.go +++ b/vendor/go.uber.org/zap/http_handler.go @@ -23,6 +23,7 @@ package zap import ( "encoding/json" "fmt" + "io" "net/http" "go.uber.org/zap/zapcore" @@ -31,47 +32,63 @@ import ( // ServeHTTP is a simple JSON endpoint that can report on or change the current // logging level. // -// GET requests return a JSON description of the current logging level. PUT -// requests change the logging level and expect a payload like: +// GET +// +// The GET request returns a JSON description of the current logging level like: // {"level":"info"} // -// It's perfectly safe to change the logging level while a program is running. +// PUT +// +// The PUT request changes the logging level. It is perfectly safe to change the +// logging level while a program is running. Two content types are supported: +// +// Content-Type: application/x-www-form-urlencoded +// +// With this content type, the level can be provided through the request body or +// a query parameter. The log level is URL encoded like: +// +// level=debug +// +// The request body takes precedence over the query parameter, if both are +// specified. +// +// This content type is the default for a curl PUT request. Following are two +// example curl requests that both set the logging level to debug. +// +// curl -X PUT localhost:8080/log/level?level=debug +// curl -X PUT localhost:8080/log/level -d level=debug +// +// For any other content type, the payload is expected to be JSON encoded and +// look like: +// +// {"level":"info"} +// +// An example curl request could look like this: +// +// curl -X PUT localhost:8080/log/level -H "Content-Type: application/json" -d '{"level":"debug"}' +// func (lvl AtomicLevel) ServeHTTP(w http.ResponseWriter, r *http.Request) { type errorResponse struct { Error string `json:"error"` } type payload struct { - Level *zapcore.Level `json:"level"` + Level zapcore.Level `json:"level"` } enc := json.NewEncoder(w) switch r.Method { - case http.MethodGet: - current := lvl.Level() - enc.Encode(payload{Level: ¤t}) - + enc.Encode(payload{Level: lvl.Level()}) case http.MethodPut: - var req payload - - if errmess := func() string { - if err := json.NewDecoder(r.Body).Decode(&req); err != nil { - return fmt.Sprintf("Request body must be well-formed JSON: %v", err) - } - if req.Level == nil { - return "Must specify a logging level." - } - return "" - }(); errmess != "" { + requestedLvl, err := decodePutRequest(r.Header.Get("Content-Type"), r) + if err != nil { w.WriteHeader(http.StatusBadRequest) - enc.Encode(errorResponse{Error: errmess}) + enc.Encode(errorResponse{Error: err.Error()}) return } - - lvl.SetLevel(*req.Level) - enc.Encode(req) - + lvl.SetLevel(requestedLvl) + enc.Encode(payload{Level: lvl.Level()}) default: w.WriteHeader(http.StatusMethodNotAllowed) enc.Encode(errorResponse{ @@ -79,3 +96,37 @@ func (lvl AtomicLevel) ServeHTTP(w http.ResponseWriter, r *http.Request) { }) } } + +// Decodes incoming PUT requests and returns the requested logging level. +func decodePutRequest(contentType string, r *http.Request) (zapcore.Level, error) { + if contentType == "application/x-www-form-urlencoded" { + return decodePutURL(r) + } + return decodePutJSON(r.Body) +} + +func decodePutURL(r *http.Request) (zapcore.Level, error) { + lvl := r.FormValue("level") + if lvl == "" { + return 0, fmt.Errorf("must specify logging level") + } + var l zapcore.Level + if err := l.UnmarshalText([]byte(lvl)); err != nil { + return 0, err + } + return l, nil +} + +func decodePutJSON(body io.Reader) (zapcore.Level, error) { + var pld struct { + Level *zapcore.Level `json:"level"` + } + if err := json.NewDecoder(body).Decode(&pld); err != nil { + return 0, fmt.Errorf("malformed request body: %v", err) + } + if pld.Level == nil { + return 0, fmt.Errorf("must specify logging level") + } + return *pld.Level, nil + +} diff --git a/vendor/go.uber.org/zap/logger.go b/vendor/go.uber.org/zap/logger.go index ea484ae..f116bd9 100644 --- a/vendor/go.uber.org/zap/logger.go +++ b/vendor/go.uber.org/zap/logger.go @@ -26,7 +26,6 @@ import ( "os" "runtime" "strings" - "time" "go.uber.org/zap/zapcore" ) @@ -42,14 +41,17 @@ type Logger struct { core zapcore.Core development bool + addCaller bool + onFatal zapcore.CheckWriteAction // default is WriteThenFatal + name string errorOutput zapcore.WriteSyncer - addCaller bool - addStack zapcore.LevelEnabler + addStack zapcore.LevelEnabler callerSkip int - onFatal zapcore.CheckWriteAction // default is WriteThenFatal + + clock zapcore.Clock } // New constructs a new Logger from the provided zapcore.Core and Options. If @@ -70,6 +72,7 @@ func New(core zapcore.Core, options ...Option) *Logger { core: core, errorOutput: zapcore.Lock(os.Stderr), addStack: zapcore.FatalLevel + 1, + clock: zapcore.DefaultClock, } return log.WithOptions(options...) } @@ -84,6 +87,7 @@ func NewNop() *Logger { core: zapcore.NewNopCore(), errorOutput: zapcore.AddSync(ioutil.Discard), addStack: zapcore.FatalLevel + 1, + clock: zapcore.DefaultClock, } } @@ -269,7 +273,7 @@ func (log *Logger) check(lvl zapcore.Level, msg string) *zapcore.CheckedEntry { // log message will actually be written somewhere. ent := zapcore.Entry{ LoggerName: log.name, - Time: time.Now(), + Time: log.clock.Now(), Level: lvl, Message: msg, } @@ -306,7 +310,7 @@ func (log *Logger) check(lvl zapcore.Level, msg string) *zapcore.CheckedEntry { if log.addCaller { frame, defined := getCallerFrame(log.callerSkip + callerSkipOffset) if !defined { - fmt.Fprintf(log.errorOutput, "%v Logger.check error: failed to get caller\n", time.Now().UTC()) + fmt.Fprintf(log.errorOutput, "%v Logger.check error: failed to get caller\n", ent.Time.UTC()) log.errorOutput.Sync() } @@ -334,7 +338,7 @@ func getCallerFrame(skip int) (frame runtime.Frame, ok bool) { const skipOffset = 2 // skip getCallerFrame and Callers pc := make([]uintptr, 1) - numFrames := runtime.Callers(skip+skipOffset, pc[:]) + numFrames := runtime.Callers(skip+skipOffset, pc) if numFrames < 1 { return } diff --git a/vendor/go.uber.org/zap/options.go b/vendor/go.uber.org/zap/options.go index 0135c20..e9e6616 100644 --- a/vendor/go.uber.org/zap/options.go +++ b/vendor/go.uber.org/zap/options.go @@ -138,3 +138,11 @@ func OnFatal(action zapcore.CheckWriteAction) Option { log.onFatal = action }) } + +// WithClock specifies the clock used by the logger to determine the current +// time for logged entries. Defaults to the system clock with time.Now. +func WithClock(clock zapcore.Clock) Option { + return optionFunc(func(log *Logger) { + log.clock = clock + }) +} diff --git a/vendor/go.uber.org/zap/sugar.go b/vendor/go.uber.org/zap/sugar.go index 77ca227..0b96519 100644 --- a/vendor/go.uber.org/zap/sugar.go +++ b/vendor/go.uber.org/zap/sugar.go @@ -222,19 +222,30 @@ func (s *SugaredLogger) log(lvl zapcore.Level, template string, fmtArgs []interf return } - // Format with Sprint, Sprintf, or neither. - msg := template - if msg == "" && len(fmtArgs) > 0 { - msg = fmt.Sprint(fmtArgs...) - } else if msg != "" && len(fmtArgs) > 0 { - msg = fmt.Sprintf(template, fmtArgs...) - } - + msg := getMessage(template, fmtArgs) if ce := s.base.Check(lvl, msg); ce != nil { ce.Write(s.sweetenFields(context)...) } } +// getMessage format with Sprint, Sprintf, or neither. +func getMessage(template string, fmtArgs []interface{}) string { + if len(fmtArgs) == 0 { + return template + } + + if template != "" { + return fmt.Sprintf(template, fmtArgs...) + } + + if len(fmtArgs) == 1 { + if str, ok := fmtArgs[0].(string); ok { + return str + } + } + return fmt.Sprint(fmtArgs...) +} + func (s *SugaredLogger) sweetenFields(args []interface{}) []Field { if len(args) == 0 { return nil @@ -255,7 +266,7 @@ func (s *SugaredLogger) sweetenFields(args []interface{}) []Field { // Make sure this element isn't a dangling key. if i == len(args)-1 { - s.base.DPanic(_oddNumberErrMsg, Any("ignored", args[i])) + s.base.Error(_oddNumberErrMsg, Any("ignored", args[i])) break } @@ -276,7 +287,7 @@ func (s *SugaredLogger) sweetenFields(args []interface{}) []Field { // If we encountered any invalid key-value pairs, log an error. if len(invalid) > 0 { - s.base.DPanic(_nonStringKeyErrMsg, Array("invalid", invalid)) + s.base.Error(_nonStringKeyErrMsg, Array("invalid", invalid)) } return fields } diff --git a/vendor/go.uber.org/zap/zapcore/buffered_write_syncer.go b/vendor/go.uber.org/zap/zapcore/buffered_write_syncer.go new file mode 100644 index 0000000..0c1436f --- /dev/null +++ b/vendor/go.uber.org/zap/zapcore/buffered_write_syncer.go @@ -0,0 +1,188 @@ +// Copyright (c) 2021 Uber Technologies, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package zapcore + +import ( + "bufio" + "sync" + "time" + + "go.uber.org/multierr" +) + +const ( + // _defaultBufferSize specifies the default size used by Buffer. + _defaultBufferSize = 256 * 1024 // 256 kB + + // _defaultFlushInterval specifies the default flush interval for + // Buffer. + _defaultFlushInterval = 30 * time.Second +) + +// A BufferedWriteSyncer is a WriteSyncer that buffers writes in-memory before +// flushing them to a wrapped WriteSyncer after reaching some limit, or at some +// fixed interval--whichever comes first. +// +// BufferedWriteSyncer is safe for concurrent use. You don't need to use +// zapcore.Lock for WriteSyncers with BufferedWriteSyncer. +type BufferedWriteSyncer struct { + // WS is the WriteSyncer around which BufferedWriteSyncer will buffer + // writes. + // + // This field is required. + WS WriteSyncer + + // Size specifies the maximum amount of data the writer will buffered + // before flushing. + // + // Defaults to 256 kB if unspecified. + Size int + + // FlushInterval specifies how often the writer should flush data if + // there have been no writes. + // + // Defaults to 30 seconds if unspecified. + FlushInterval time.Duration + + // Clock, if specified, provides control of the source of time for the + // writer. + // + // Defaults to the system clock. + Clock Clock + + // unexported fields for state + mu sync.Mutex + initialized bool // whether initialize() has run + writer *bufio.Writer + ticker *time.Ticker + stop chan struct{} // closed when flushLoop should stop + stopped bool // whether Stop() has run + done chan struct{} // closed when flushLoop has stopped +} + +func (s *BufferedWriteSyncer) initialize() { + size := s.Size + if size == 0 { + size = _defaultBufferSize + } + + flushInterval := s.FlushInterval + if flushInterval == 0 { + flushInterval = _defaultFlushInterval + } + + if s.Clock == nil { + s.Clock = DefaultClock + } + + s.ticker = s.Clock.NewTicker(flushInterval) + s.writer = bufio.NewWriterSize(s.WS, size) + s.stop = make(chan struct{}) + s.done = make(chan struct{}) + s.initialized = true + go s.flushLoop() +} + +// Write writes log data into buffer syncer directly, multiple Write calls will be batched, +// and log data will be flushed to disk when the buffer is full or periodically. +func (s *BufferedWriteSyncer) Write(bs []byte) (int, error) { + s.mu.Lock() + defer s.mu.Unlock() + + if !s.initialized { + s.initialize() + } + + // To avoid partial writes from being flushed, we manually flush the existing buffer if: + // * The current write doesn't fit into the buffer fully, and + // * The buffer is not empty (since bufio will not split large writes when the buffer is empty) + if len(bs) > s.writer.Available() && s.writer.Buffered() > 0 { + if err := s.writer.Flush(); err != nil { + return 0, err + } + } + + return s.writer.Write(bs) +} + +// Sync flushes buffered log data into disk directly. +func (s *BufferedWriteSyncer) Sync() error { + s.mu.Lock() + defer s.mu.Unlock() + + var err error + if s.initialized { + err = s.writer.Flush() + } + + return multierr.Append(err, s.WS.Sync()) +} + +// flushLoop flushes the buffer at the configured interval until Stop is +// called. +func (s *BufferedWriteSyncer) flushLoop() { + defer close(s.done) + + for { + select { + case <-s.ticker.C: + // we just simply ignore error here + // because the underlying bufio writer stores any errors + // and we return any error from Sync() as part of the close + _ = s.Sync() + case <-s.stop: + return + } + } +} + +// Stop closes the buffer, cleans up background goroutines, and flushes +// remaining unwritten data. +func (s *BufferedWriteSyncer) Stop() (err error) { + var stopped bool + + // Critical section. + func() { + s.mu.Lock() + defer s.mu.Unlock() + + if !s.initialized { + return + } + + stopped = s.stopped + if stopped { + return + } + s.stopped = true + + s.ticker.Stop() + close(s.stop) // tell flushLoop to stop + <-s.done // and wait until it has + }() + + // Don't call Sync on consecutive Stops. + if !stopped { + err = s.Sync() + } + + return err +} diff --git a/vendor/go.uber.org/zap/zapcore/clock.go b/vendor/go.uber.org/zap/zapcore/clock.go new file mode 100644 index 0000000..d2ea95b --- /dev/null +++ b/vendor/go.uber.org/zap/zapcore/clock.go @@ -0,0 +1,50 @@ +// Copyright (c) 2021 Uber Technologies, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package zapcore + +import ( + "time" +) + +// DefaultClock is the default clock used by Zap in operations that require +// time. This clock uses the system clock for all operations. +var DefaultClock = systemClock{} + +// Clock is a source of time for logged entries. +type Clock interface { + // Now returns the current local time. + Now() time.Time + + // NewTicker returns *time.Ticker that holds a channel + // that delivers "ticks" of a clock. + NewTicker(time.Duration) *time.Ticker +} + +// systemClock implements default Clock that uses system time. +type systemClock struct{} + +func (systemClock) Now() time.Time { + return time.Now() +} + +func (systemClock) NewTicker(duration time.Duration) *time.Ticker { + return time.NewTicker(duration) +} diff --git a/vendor/go.uber.org/zap/zapcore/console_encoder.go b/vendor/go.uber.org/zap/zapcore/console_encoder.go index 3b68f8c..2307af4 100644 --- a/vendor/go.uber.org/zap/zapcore/console_encoder.go +++ b/vendor/go.uber.org/zap/zapcore/console_encoder.go @@ -56,7 +56,7 @@ type consoleEncoder struct { // encoder configuration, it will omit any element whose key is set to the empty // string. func NewConsoleEncoder(cfg EncoderConfig) Encoder { - if len(cfg.ConsoleSeparator) == 0 { + if cfg.ConsoleSeparator == "" { // Use a default delimiter of '\t' for backwards compatibility cfg.ConsoleSeparator = "\t" } diff --git a/vendor/go.uber.org/zap/zapcore/entry.go b/vendor/go.uber.org/zap/zapcore/entry.go index 4aa8b4f..2d815fe 100644 --- a/vendor/go.uber.org/zap/zapcore/entry.go +++ b/vendor/go.uber.org/zap/zapcore/entry.go @@ -208,7 +208,7 @@ func (ce *CheckedEntry) Write(fields ...Field) { // If the entry is dirty, log an internal error; because the // CheckedEntry is being used after it was returned to the pool, // the message may be an amalgamation from multiple call sites. - fmt.Fprintf(ce.ErrorOutput, "%v Unsafe CheckedEntry re-use near Entry %+v.\n", time.Now(), ce.Entry) + fmt.Fprintf(ce.ErrorOutput, "%v Unsafe CheckedEntry re-use near Entry %+v.\n", ce.Time, ce.Entry) ce.ErrorOutput.Sync() } return @@ -221,7 +221,7 @@ func (ce *CheckedEntry) Write(fields ...Field) { } if ce.ErrorOutput != nil { if err != nil { - fmt.Fprintf(ce.ErrorOutput, "%v write error: %v\n", time.Now(), err) + fmt.Fprintf(ce.ErrorOutput, "%v write error: %v\n", ce.Time, err) ce.ErrorOutput.Sync() } } diff --git a/vendor/go.uber.org/zap/zapcore/error.go b/vendor/go.uber.org/zap/zapcore/error.go index 9ba2272..f2a07d7 100644 --- a/vendor/go.uber.org/zap/zapcore/error.go +++ b/vendor/go.uber.org/zap/zapcore/error.go @@ -22,6 +22,7 @@ package zapcore import ( "fmt" + "reflect" "sync" ) @@ -42,7 +43,23 @@ import ( // ... // ], // } -func encodeError(key string, err error, enc ObjectEncoder) error { +func encodeError(key string, err error, enc ObjectEncoder) (retErr error) { + // Try to capture panics (from nil references or otherwise) when calling + // the Error() method + defer func() { + if rerr := recover(); rerr != nil { + // If it's a nil pointer, just say "". The likeliest causes are a + // error that fails to guard against nil or a nil pointer for a + // value receiver, and in either case, "" is a nice result. + if v := reflect.ValueOf(err); v.Kind() == reflect.Ptr && v.IsNil() { + enc.AddString(key, "") + return + } + + retErr = fmt.Errorf("PANIC=%v", rerr) + } + }() + basic := err.Error() enc.AddString(key, basic) diff --git a/vendor/go.uber.org/zap/zapcore/field.go b/vendor/go.uber.org/zap/zapcore/field.go index 7e255d6..95bdb0a 100644 --- a/vendor/go.uber.org/zap/zapcore/field.go +++ b/vendor/go.uber.org/zap/zapcore/field.go @@ -92,6 +92,10 @@ const ( ErrorType // SkipType indicates that the field is a no-op. SkipType + + // InlineMarshalerType indicates that the field carries an ObjectMarshaler + // that should be inlined. + InlineMarshalerType ) // A Field is a marshaling operation used to add a key-value pair to a logger's @@ -115,6 +119,8 @@ func (f Field) AddTo(enc ObjectEncoder) { err = enc.AddArray(f.Key, f.Interface.(ArrayMarshaler)) case ObjectMarshalerType: err = enc.AddObject(f.Key, f.Interface.(ObjectMarshaler)) + case InlineMarshalerType: + err = f.Interface.(ObjectMarshaler).MarshalLogObject(enc) case BinaryType: enc.AddBinary(f.Key, f.Interface.([]byte)) case BoolType: @@ -167,7 +173,7 @@ func (f Field) AddTo(enc ObjectEncoder) { case StringerType: err = encodeStringer(f.Key, f.Interface, enc) case ErrorType: - encodeError(f.Key, f.Interface.(error), enc) + err = encodeError(f.Key, f.Interface.(error), enc) case SkipType: break default: diff --git a/vendor/go.uber.org/zap/zapcore/write_syncer.go b/vendor/go.uber.org/zap/zapcore/write_syncer.go index 209e25f..d4a1af3 100644 --- a/vendor/go.uber.org/zap/zapcore/write_syncer.go +++ b/vendor/go.uber.org/zap/zapcore/write_syncer.go @@ -91,8 +91,7 @@ func NewMultiWriteSyncer(ws ...WriteSyncer) WriteSyncer { if len(ws) == 1 { return ws[0] } - // Copy to protect against https://github.com/golang/go/issues/7809 - return multiWriteSyncer(append([]WriteSyncer(nil), ws...)) + return multiWriteSyncer(ws) } // See https://golang.org/src/io/multi.go diff --git a/vendor/golang.org/x/crypto/AUTHORS b/vendor/golang.org/x/crypto/AUTHORS new file mode 100644 index 0000000..2b00ddb --- /dev/null +++ b/vendor/golang.org/x/crypto/AUTHORS @@ -0,0 +1,3 @@ +# This source code refers to The Go Authors for copyright purposes. +# The master list of authors is in the main Go distribution, +# visible at https://tip.golang.org/AUTHORS. diff --git a/vendor/golang.org/x/crypto/CONTRIBUTORS b/vendor/golang.org/x/crypto/CONTRIBUTORS new file mode 100644 index 0000000..1fbd3e9 --- /dev/null +++ b/vendor/golang.org/x/crypto/CONTRIBUTORS @@ -0,0 +1,3 @@ +# This source code was written by the Go contributors. +# The master list of contributors is in the main Go distribution, +# visible at https://tip.golang.org/CONTRIBUTORS. diff --git a/vendor/golang.org/x/crypto/LICENSE b/vendor/golang.org/x/crypto/LICENSE new file mode 100644 index 0000000..6a66aea --- /dev/null +++ b/vendor/golang.org/x/crypto/LICENSE @@ -0,0 +1,27 @@ +Copyright (c) 2009 The Go Authors. All rights reserved. + +Redistribution and use in source and binary forms, with or without +modification, are permitted provided that the following conditions are +met: + + * Redistributions of source code must retain the above copyright +notice, this list of conditions and the following disclaimer. + * Redistributions in binary form must reproduce the above +copyright notice, this list of conditions and the following disclaimer +in the documentation and/or other materials provided with the +distribution. + * Neither the name of Google Inc. nor the names of its +contributors may be used to endorse or promote products derived from +this software without specific prior written permission. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. diff --git a/vendor/golang.org/x/crypto/PATENTS b/vendor/golang.org/x/crypto/PATENTS new file mode 100644 index 0000000..7330990 --- /dev/null +++ b/vendor/golang.org/x/crypto/PATENTS @@ -0,0 +1,22 @@ +Additional IP Rights Grant (Patents) + +"This implementation" means the copyrightable works distributed by +Google as part of the Go project. + +Google hereby grants to You a perpetual, worldwide, non-exclusive, +no-charge, royalty-free, irrevocable (except as stated in this section) +patent license to make, have made, use, offer to sell, sell, import, +transfer and otherwise run, modify and propagate the contents of this +implementation of Go, where such license applies only to those patent +claims, both currently owned or controlled by Google and acquired in +the future, licensable by Google that are necessarily infringed by this +implementation of Go. This grant does not include claims that would be +infringed only as a consequence of further modification of this +implementation. If you or your agent or exclusive licensee institute or +order or agree to the institution of patent litigation against any +entity (including a cross-claim or counterclaim in a lawsuit) alleging +that this implementation of Go or any code incorporated within this +implementation of Go constitutes direct or contributory patent +infringement, or inducement of patent infringement, then any patent +rights granted to you under this License for this implementation of Go +shall terminate as of the date such litigation is filed. diff --git a/vendor/golang.org/x/crypto/sha3/doc.go b/vendor/golang.org/x/crypto/sha3/doc.go new file mode 100644 index 0000000..c2fef30 --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/doc.go @@ -0,0 +1,66 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package sha3 implements the SHA-3 fixed-output-length hash functions and +// the SHAKE variable-output-length hash functions defined by FIPS-202. +// +// Both types of hash function use the "sponge" construction and the Keccak +// permutation. For a detailed specification see http://keccak.noekeon.org/ +// +// +// Guidance +// +// If you aren't sure what function you need, use SHAKE256 with at least 64 +// bytes of output. The SHAKE instances are faster than the SHA3 instances; +// the latter have to allocate memory to conform to the hash.Hash interface. +// +// If you need a secret-key MAC (message authentication code), prepend the +// secret key to the input, hash with SHAKE256 and read at least 32 bytes of +// output. +// +// +// Security strengths +// +// The SHA3-x (x equals 224, 256, 384, or 512) functions have a security +// strength against preimage attacks of x bits. Since they only produce "x" +// bits of output, their collision-resistance is only "x/2" bits. +// +// The SHAKE-256 and -128 functions have a generic security strength of 256 and +// 128 bits against all attacks, provided that at least 2x bits of their output +// is used. Requesting more than 64 or 32 bytes of output, respectively, does +// not increase the collision-resistance of the SHAKE functions. +// +// +// The sponge construction +// +// A sponge builds a pseudo-random function from a public pseudo-random +// permutation, by applying the permutation to a state of "rate + capacity" +// bytes, but hiding "capacity" of the bytes. +// +// A sponge starts out with a zero state. To hash an input using a sponge, up +// to "rate" bytes of the input are XORed into the sponge's state. The sponge +// is then "full" and the permutation is applied to "empty" it. This process is +// repeated until all the input has been "absorbed". The input is then padded. +// The digest is "squeezed" from the sponge in the same way, except that output +// is copied out instead of input being XORed in. +// +// A sponge is parameterized by its generic security strength, which is equal +// to half its capacity; capacity + rate is equal to the permutation's width. +// Since the KeccakF-1600 permutation is 1600 bits (200 bytes) wide, this means +// that the security strength of a sponge instance is equal to (1600 - bitrate) / 2. +// +// +// Recommendations +// +// The SHAKE functions are recommended for most new uses. They can produce +// output of arbitrary length. SHAKE256, with an output length of at least +// 64 bytes, provides 256-bit security against all attacks. The Keccak team +// recommends it for most applications upgrading from SHA2-512. (NIST chose a +// much stronger, but much slower, sponge instance for SHA3-512.) +// +// The SHA-3 functions are "drop-in" replacements for the SHA-2 functions. +// They produce output of the same length, with the same security strengths +// against all attacks. This means, in particular, that SHA3-256 only has +// 128-bit collision resistance, because its output length is 32 bytes. +package sha3 // import "golang.org/x/crypto/sha3" diff --git a/vendor/golang.org/x/crypto/sha3/hashes.go b/vendor/golang.org/x/crypto/sha3/hashes.go new file mode 100644 index 0000000..0d8043f --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/hashes.go @@ -0,0 +1,97 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package sha3 + +// This file provides functions for creating instances of the SHA-3 +// and SHAKE hash functions, as well as utility functions for hashing +// bytes. + +import ( + "hash" +) + +// New224 creates a new SHA3-224 hash. +// Its generic security strength is 224 bits against preimage attacks, +// and 112 bits against collision attacks. +func New224() hash.Hash { + if h := new224Asm(); h != nil { + return h + } + return &state{rate: 144, outputLen: 28, dsbyte: 0x06} +} + +// New256 creates a new SHA3-256 hash. +// Its generic security strength is 256 bits against preimage attacks, +// and 128 bits against collision attacks. +func New256() hash.Hash { + if h := new256Asm(); h != nil { + return h + } + return &state{rate: 136, outputLen: 32, dsbyte: 0x06} +} + +// New384 creates a new SHA3-384 hash. +// Its generic security strength is 384 bits against preimage attacks, +// and 192 bits against collision attacks. +func New384() hash.Hash { + if h := new384Asm(); h != nil { + return h + } + return &state{rate: 104, outputLen: 48, dsbyte: 0x06} +} + +// New512 creates a new SHA3-512 hash. +// Its generic security strength is 512 bits against preimage attacks, +// and 256 bits against collision attacks. +func New512() hash.Hash { + if h := new512Asm(); h != nil { + return h + } + return &state{rate: 72, outputLen: 64, dsbyte: 0x06} +} + +// NewLegacyKeccak256 creates a new Keccak-256 hash. +// +// Only use this function if you require compatibility with an existing cryptosystem +// that uses non-standard padding. All other users should use New256 instead. +func NewLegacyKeccak256() hash.Hash { return &state{rate: 136, outputLen: 32, dsbyte: 0x01} } + +// NewLegacyKeccak512 creates a new Keccak-512 hash. +// +// Only use this function if you require compatibility with an existing cryptosystem +// that uses non-standard padding. All other users should use New512 instead. +func NewLegacyKeccak512() hash.Hash { return &state{rate: 72, outputLen: 64, dsbyte: 0x01} } + +// Sum224 returns the SHA3-224 digest of the data. +func Sum224(data []byte) (digest [28]byte) { + h := New224() + h.Write(data) + h.Sum(digest[:0]) + return +} + +// Sum256 returns the SHA3-256 digest of the data. +func Sum256(data []byte) (digest [32]byte) { + h := New256() + h.Write(data) + h.Sum(digest[:0]) + return +} + +// Sum384 returns the SHA3-384 digest of the data. +func Sum384(data []byte) (digest [48]byte) { + h := New384() + h.Write(data) + h.Sum(digest[:0]) + return +} + +// Sum512 returns the SHA3-512 digest of the data. +func Sum512(data []byte) (digest [64]byte) { + h := New512() + h.Write(data) + h.Sum(digest[:0]) + return +} diff --git a/vendor/golang.org/x/crypto/sha3/hashes_generic.go b/vendor/golang.org/x/crypto/sha3/hashes_generic.go new file mode 100644 index 0000000..f455147 --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/hashes_generic.go @@ -0,0 +1,27 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build gccgo appengine !s390x + +package sha3 + +import ( + "hash" +) + +// new224Asm returns an assembly implementation of SHA3-224 if available, +// otherwise it returns nil. +func new224Asm() hash.Hash { return nil } + +// new256Asm returns an assembly implementation of SHA3-256 if available, +// otherwise it returns nil. +func new256Asm() hash.Hash { return nil } + +// new384Asm returns an assembly implementation of SHA3-384 if available, +// otherwise it returns nil. +func new384Asm() hash.Hash { return nil } + +// new512Asm returns an assembly implementation of SHA3-512 if available, +// otherwise it returns nil. +func new512Asm() hash.Hash { return nil } diff --git a/vendor/golang.org/x/crypto/sha3/keccakf.go b/vendor/golang.org/x/crypto/sha3/keccakf.go new file mode 100644 index 0000000..46d03ed --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/keccakf.go @@ -0,0 +1,412 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build !amd64 appengine gccgo + +package sha3 + +// rc stores the round constants for use in the ι step. +var rc = [24]uint64{ + 0x0000000000000001, + 0x0000000000008082, + 0x800000000000808A, + 0x8000000080008000, + 0x000000000000808B, + 0x0000000080000001, + 0x8000000080008081, + 0x8000000000008009, + 0x000000000000008A, + 0x0000000000000088, + 0x0000000080008009, + 0x000000008000000A, + 0x000000008000808B, + 0x800000000000008B, + 0x8000000000008089, + 0x8000000000008003, + 0x8000000000008002, + 0x8000000000000080, + 0x000000000000800A, + 0x800000008000000A, + 0x8000000080008081, + 0x8000000000008080, + 0x0000000080000001, + 0x8000000080008008, +} + +// keccakF1600 applies the Keccak permutation to a 1600b-wide +// state represented as a slice of 25 uint64s. +func keccakF1600(a *[25]uint64) { + // Implementation translated from Keccak-inplace.c + // in the keccak reference code. + var t, bc0, bc1, bc2, bc3, bc4, d0, d1, d2, d3, d4 uint64 + + for i := 0; i < 24; i += 4 { + // Combines the 5 steps in each round into 2 steps. + // Unrolls 4 rounds per loop and spreads some steps across rounds. + + // Round 1 + bc0 = a[0] ^ a[5] ^ a[10] ^ a[15] ^ a[20] + bc1 = a[1] ^ a[6] ^ a[11] ^ a[16] ^ a[21] + bc2 = a[2] ^ a[7] ^ a[12] ^ a[17] ^ a[22] + bc3 = a[3] ^ a[8] ^ a[13] ^ a[18] ^ a[23] + bc4 = a[4] ^ a[9] ^ a[14] ^ a[19] ^ a[24] + d0 = bc4 ^ (bc1<<1 | bc1>>63) + d1 = bc0 ^ (bc2<<1 | bc2>>63) + d2 = bc1 ^ (bc3<<1 | bc3>>63) + d3 = bc2 ^ (bc4<<1 | bc4>>63) + d4 = bc3 ^ (bc0<<1 | bc0>>63) + + bc0 = a[0] ^ d0 + t = a[6] ^ d1 + bc1 = t<<44 | t>>(64-44) + t = a[12] ^ d2 + bc2 = t<<43 | t>>(64-43) + t = a[18] ^ d3 + bc3 = t<<21 | t>>(64-21) + t = a[24] ^ d4 + bc4 = t<<14 | t>>(64-14) + a[0] = bc0 ^ (bc2 &^ bc1) ^ rc[i] + a[6] = bc1 ^ (bc3 &^ bc2) + a[12] = bc2 ^ (bc4 &^ bc3) + a[18] = bc3 ^ (bc0 &^ bc4) + a[24] = bc4 ^ (bc1 &^ bc0) + + t = a[10] ^ d0 + bc2 = t<<3 | t>>(64-3) + t = a[16] ^ d1 + bc3 = t<<45 | t>>(64-45) + t = a[22] ^ d2 + bc4 = t<<61 | t>>(64-61) + t = a[3] ^ d3 + bc0 = t<<28 | t>>(64-28) + t = a[9] ^ d4 + bc1 = t<<20 | t>>(64-20) + a[10] = bc0 ^ (bc2 &^ bc1) + a[16] = bc1 ^ (bc3 &^ bc2) + a[22] = bc2 ^ (bc4 &^ bc3) + a[3] = bc3 ^ (bc0 &^ bc4) + a[9] = bc4 ^ (bc1 &^ bc0) + + t = a[20] ^ d0 + bc4 = t<<18 | t>>(64-18) + t = a[1] ^ d1 + bc0 = t<<1 | t>>(64-1) + t = a[7] ^ d2 + bc1 = t<<6 | t>>(64-6) + t = a[13] ^ d3 + bc2 = t<<25 | t>>(64-25) + t = a[19] ^ d4 + bc3 = t<<8 | t>>(64-8) + a[20] = bc0 ^ (bc2 &^ bc1) + a[1] = bc1 ^ (bc3 &^ bc2) + a[7] = bc2 ^ (bc4 &^ bc3) + a[13] = bc3 ^ (bc0 &^ bc4) + a[19] = bc4 ^ (bc1 &^ bc0) + + t = a[5] ^ d0 + bc1 = t<<36 | t>>(64-36) + t = a[11] ^ d1 + bc2 = t<<10 | t>>(64-10) + t = a[17] ^ d2 + bc3 = t<<15 | t>>(64-15) + t = a[23] ^ d3 + bc4 = t<<56 | t>>(64-56) + t = a[4] ^ d4 + bc0 = t<<27 | t>>(64-27) + a[5] = bc0 ^ (bc2 &^ bc1) + a[11] = bc1 ^ (bc3 &^ bc2) + a[17] = bc2 ^ (bc4 &^ bc3) + a[23] = bc3 ^ (bc0 &^ bc4) + a[4] = bc4 ^ (bc1 &^ bc0) + + t = a[15] ^ d0 + bc3 = t<<41 | t>>(64-41) + t = a[21] ^ d1 + bc4 = t<<2 | t>>(64-2) + t = a[2] ^ d2 + bc0 = t<<62 | t>>(64-62) + t = a[8] ^ d3 + bc1 = t<<55 | t>>(64-55) + t = a[14] ^ d4 + bc2 = t<<39 | t>>(64-39) + a[15] = bc0 ^ (bc2 &^ bc1) + a[21] = bc1 ^ (bc3 &^ bc2) + a[2] = bc2 ^ (bc4 &^ bc3) + a[8] = bc3 ^ (bc0 &^ bc4) + a[14] = bc4 ^ (bc1 &^ bc0) + + // Round 2 + bc0 = a[0] ^ a[5] ^ a[10] ^ a[15] ^ a[20] + bc1 = a[1] ^ a[6] ^ a[11] ^ a[16] ^ a[21] + bc2 = a[2] ^ a[7] ^ a[12] ^ a[17] ^ a[22] + bc3 = a[3] ^ a[8] ^ a[13] ^ a[18] ^ a[23] + bc4 = a[4] ^ a[9] ^ a[14] ^ a[19] ^ a[24] + d0 = bc4 ^ (bc1<<1 | bc1>>63) + d1 = bc0 ^ (bc2<<1 | bc2>>63) + d2 = bc1 ^ (bc3<<1 | bc3>>63) + d3 = bc2 ^ (bc4<<1 | bc4>>63) + d4 = bc3 ^ (bc0<<1 | bc0>>63) + + bc0 = a[0] ^ d0 + t = a[16] ^ d1 + bc1 = t<<44 | t>>(64-44) + t = a[7] ^ d2 + bc2 = t<<43 | t>>(64-43) + t = a[23] ^ d3 + bc3 = t<<21 | t>>(64-21) + t = a[14] ^ d4 + bc4 = t<<14 | t>>(64-14) + a[0] = bc0 ^ (bc2 &^ bc1) ^ rc[i+1] + a[16] = bc1 ^ (bc3 &^ bc2) + a[7] = bc2 ^ (bc4 &^ bc3) + a[23] = bc3 ^ (bc0 &^ bc4) + a[14] = bc4 ^ (bc1 &^ bc0) + + t = a[20] ^ d0 + bc2 = t<<3 | t>>(64-3) + t = a[11] ^ d1 + bc3 = t<<45 | t>>(64-45) + t = a[2] ^ d2 + bc4 = t<<61 | t>>(64-61) + t = a[18] ^ d3 + bc0 = t<<28 | t>>(64-28) + t = a[9] ^ d4 + bc1 = t<<20 | t>>(64-20) + a[20] = bc0 ^ (bc2 &^ bc1) + a[11] = bc1 ^ (bc3 &^ bc2) + a[2] = bc2 ^ (bc4 &^ bc3) + a[18] = bc3 ^ (bc0 &^ bc4) + a[9] = bc4 ^ (bc1 &^ bc0) + + t = a[15] ^ d0 + bc4 = t<<18 | t>>(64-18) + t = a[6] ^ d1 + bc0 = t<<1 | t>>(64-1) + t = a[22] ^ d2 + bc1 = t<<6 | t>>(64-6) + t = a[13] ^ d3 + bc2 = t<<25 | t>>(64-25) + t = a[4] ^ d4 + bc3 = t<<8 | t>>(64-8) + a[15] = bc0 ^ (bc2 &^ bc1) + a[6] = bc1 ^ (bc3 &^ bc2) + a[22] = bc2 ^ (bc4 &^ bc3) + a[13] = bc3 ^ (bc0 &^ bc4) + a[4] = bc4 ^ (bc1 &^ bc0) + + t = a[10] ^ d0 + bc1 = t<<36 | t>>(64-36) + t = a[1] ^ d1 + bc2 = t<<10 | t>>(64-10) + t = a[17] ^ d2 + bc3 = t<<15 | t>>(64-15) + t = a[8] ^ d3 + bc4 = t<<56 | t>>(64-56) + t = a[24] ^ d4 + bc0 = t<<27 | t>>(64-27) + a[10] = bc0 ^ (bc2 &^ bc1) + a[1] = bc1 ^ (bc3 &^ bc2) + a[17] = bc2 ^ (bc4 &^ bc3) + a[8] = bc3 ^ (bc0 &^ bc4) + a[24] = bc4 ^ (bc1 &^ bc0) + + t = a[5] ^ d0 + bc3 = t<<41 | t>>(64-41) + t = a[21] ^ d1 + bc4 = t<<2 | t>>(64-2) + t = a[12] ^ d2 + bc0 = t<<62 | t>>(64-62) + t = a[3] ^ d3 + bc1 = t<<55 | t>>(64-55) + t = a[19] ^ d4 + bc2 = t<<39 | t>>(64-39) + a[5] = bc0 ^ (bc2 &^ bc1) + a[21] = bc1 ^ (bc3 &^ bc2) + a[12] = bc2 ^ (bc4 &^ bc3) + a[3] = bc3 ^ (bc0 &^ bc4) + a[19] = bc4 ^ (bc1 &^ bc0) + + // Round 3 + bc0 = a[0] ^ a[5] ^ a[10] ^ a[15] ^ a[20] + bc1 = a[1] ^ a[6] ^ a[11] ^ a[16] ^ a[21] + bc2 = a[2] ^ a[7] ^ a[12] ^ a[17] ^ a[22] + bc3 = a[3] ^ a[8] ^ a[13] ^ a[18] ^ a[23] + bc4 = a[4] ^ a[9] ^ a[14] ^ a[19] ^ a[24] + d0 = bc4 ^ (bc1<<1 | bc1>>63) + d1 = bc0 ^ (bc2<<1 | bc2>>63) + d2 = bc1 ^ (bc3<<1 | bc3>>63) + d3 = bc2 ^ (bc4<<1 | bc4>>63) + d4 = bc3 ^ (bc0<<1 | bc0>>63) + + bc0 = a[0] ^ d0 + t = a[11] ^ d1 + bc1 = t<<44 | t>>(64-44) + t = a[22] ^ d2 + bc2 = t<<43 | t>>(64-43) + t = a[8] ^ d3 + bc3 = t<<21 | t>>(64-21) + t = a[19] ^ d4 + bc4 = t<<14 | t>>(64-14) + a[0] = bc0 ^ (bc2 &^ bc1) ^ rc[i+2] + a[11] = bc1 ^ (bc3 &^ bc2) + a[22] = bc2 ^ (bc4 &^ bc3) + a[8] = bc3 ^ (bc0 &^ bc4) + a[19] = bc4 ^ (bc1 &^ bc0) + + t = a[15] ^ d0 + bc2 = t<<3 | t>>(64-3) + t = a[1] ^ d1 + bc3 = t<<45 | t>>(64-45) + t = a[12] ^ d2 + bc4 = t<<61 | t>>(64-61) + t = a[23] ^ d3 + bc0 = t<<28 | t>>(64-28) + t = a[9] ^ d4 + bc1 = t<<20 | t>>(64-20) + a[15] = bc0 ^ (bc2 &^ bc1) + a[1] = bc1 ^ (bc3 &^ bc2) + a[12] = bc2 ^ (bc4 &^ bc3) + a[23] = bc3 ^ (bc0 &^ bc4) + a[9] = bc4 ^ (bc1 &^ bc0) + + t = a[5] ^ d0 + bc4 = t<<18 | t>>(64-18) + t = a[16] ^ d1 + bc0 = t<<1 | t>>(64-1) + t = a[2] ^ d2 + bc1 = t<<6 | t>>(64-6) + t = a[13] ^ d3 + bc2 = t<<25 | t>>(64-25) + t = a[24] ^ d4 + bc3 = t<<8 | t>>(64-8) + a[5] = bc0 ^ (bc2 &^ bc1) + a[16] = bc1 ^ (bc3 &^ bc2) + a[2] = bc2 ^ (bc4 &^ bc3) + a[13] = bc3 ^ (bc0 &^ bc4) + a[24] = bc4 ^ (bc1 &^ bc0) + + t = a[20] ^ d0 + bc1 = t<<36 | t>>(64-36) + t = a[6] ^ d1 + bc2 = t<<10 | t>>(64-10) + t = a[17] ^ d2 + bc3 = t<<15 | t>>(64-15) + t = a[3] ^ d3 + bc4 = t<<56 | t>>(64-56) + t = a[14] ^ d4 + bc0 = t<<27 | t>>(64-27) + a[20] = bc0 ^ (bc2 &^ bc1) + a[6] = bc1 ^ (bc3 &^ bc2) + a[17] = bc2 ^ (bc4 &^ bc3) + a[3] = bc3 ^ (bc0 &^ bc4) + a[14] = bc4 ^ (bc1 &^ bc0) + + t = a[10] ^ d0 + bc3 = t<<41 | t>>(64-41) + t = a[21] ^ d1 + bc4 = t<<2 | t>>(64-2) + t = a[7] ^ d2 + bc0 = t<<62 | t>>(64-62) + t = a[18] ^ d3 + bc1 = t<<55 | t>>(64-55) + t = a[4] ^ d4 + bc2 = t<<39 | t>>(64-39) + a[10] = bc0 ^ (bc2 &^ bc1) + a[21] = bc1 ^ (bc3 &^ bc2) + a[7] = bc2 ^ (bc4 &^ bc3) + a[18] = bc3 ^ (bc0 &^ bc4) + a[4] = bc4 ^ (bc1 &^ bc0) + + // Round 4 + bc0 = a[0] ^ a[5] ^ a[10] ^ a[15] ^ a[20] + bc1 = a[1] ^ a[6] ^ a[11] ^ a[16] ^ a[21] + bc2 = a[2] ^ a[7] ^ a[12] ^ a[17] ^ a[22] + bc3 = a[3] ^ a[8] ^ a[13] ^ a[18] ^ a[23] + bc4 = a[4] ^ a[9] ^ a[14] ^ a[19] ^ a[24] + d0 = bc4 ^ (bc1<<1 | bc1>>63) + d1 = bc0 ^ (bc2<<1 | bc2>>63) + d2 = bc1 ^ (bc3<<1 | bc3>>63) + d3 = bc2 ^ (bc4<<1 | bc4>>63) + d4 = bc3 ^ (bc0<<1 | bc0>>63) + + bc0 = a[0] ^ d0 + t = a[1] ^ d1 + bc1 = t<<44 | t>>(64-44) + t = a[2] ^ d2 + bc2 = t<<43 | t>>(64-43) + t = a[3] ^ d3 + bc3 = t<<21 | t>>(64-21) + t = a[4] ^ d4 + bc4 = t<<14 | t>>(64-14) + a[0] = bc0 ^ (bc2 &^ bc1) ^ rc[i+3] + a[1] = bc1 ^ (bc3 &^ bc2) + a[2] = bc2 ^ (bc4 &^ bc3) + a[3] = bc3 ^ (bc0 &^ bc4) + a[4] = bc4 ^ (bc1 &^ bc0) + + t = a[5] ^ d0 + bc2 = t<<3 | t>>(64-3) + t = a[6] ^ d1 + bc3 = t<<45 | t>>(64-45) + t = a[7] ^ d2 + bc4 = t<<61 | t>>(64-61) + t = a[8] ^ d3 + bc0 = t<<28 | t>>(64-28) + t = a[9] ^ d4 + bc1 = t<<20 | t>>(64-20) + a[5] = bc0 ^ (bc2 &^ bc1) + a[6] = bc1 ^ (bc3 &^ bc2) + a[7] = bc2 ^ (bc4 &^ bc3) + a[8] = bc3 ^ (bc0 &^ bc4) + a[9] = bc4 ^ (bc1 &^ bc0) + + t = a[10] ^ d0 + bc4 = t<<18 | t>>(64-18) + t = a[11] ^ d1 + bc0 = t<<1 | t>>(64-1) + t = a[12] ^ d2 + bc1 = t<<6 | t>>(64-6) + t = a[13] ^ d3 + bc2 = t<<25 | t>>(64-25) + t = a[14] ^ d4 + bc3 = t<<8 | t>>(64-8) + a[10] = bc0 ^ (bc2 &^ bc1) + a[11] = bc1 ^ (bc3 &^ bc2) + a[12] = bc2 ^ (bc4 &^ bc3) + a[13] = bc3 ^ (bc0 &^ bc4) + a[14] = bc4 ^ (bc1 &^ bc0) + + t = a[15] ^ d0 + bc1 = t<<36 | t>>(64-36) + t = a[16] ^ d1 + bc2 = t<<10 | t>>(64-10) + t = a[17] ^ d2 + bc3 = t<<15 | t>>(64-15) + t = a[18] ^ d3 + bc4 = t<<56 | t>>(64-56) + t = a[19] ^ d4 + bc0 = t<<27 | t>>(64-27) + a[15] = bc0 ^ (bc2 &^ bc1) + a[16] = bc1 ^ (bc3 &^ bc2) + a[17] = bc2 ^ (bc4 &^ bc3) + a[18] = bc3 ^ (bc0 &^ bc4) + a[19] = bc4 ^ (bc1 &^ bc0) + + t = a[20] ^ d0 + bc3 = t<<41 | t>>(64-41) + t = a[21] ^ d1 + bc4 = t<<2 | t>>(64-2) + t = a[22] ^ d2 + bc0 = t<<62 | t>>(64-62) + t = a[23] ^ d3 + bc1 = t<<55 | t>>(64-55) + t = a[24] ^ d4 + bc2 = t<<39 | t>>(64-39) + a[20] = bc0 ^ (bc2 &^ bc1) + a[21] = bc1 ^ (bc3 &^ bc2) + a[22] = bc2 ^ (bc4 &^ bc3) + a[23] = bc3 ^ (bc0 &^ bc4) + a[24] = bc4 ^ (bc1 &^ bc0) + } +} diff --git a/vendor/golang.org/x/crypto/sha3/keccakf_amd64.go b/vendor/golang.org/x/crypto/sha3/keccakf_amd64.go new file mode 100644 index 0000000..7886795 --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/keccakf_amd64.go @@ -0,0 +1,13 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build amd64,!appengine,!gccgo + +package sha3 + +// This function is implemented in keccakf_amd64.s. + +//go:noescape + +func keccakF1600(a *[25]uint64) diff --git a/vendor/golang.org/x/crypto/sha3/keccakf_amd64.s b/vendor/golang.org/x/crypto/sha3/keccakf_amd64.s new file mode 100644 index 0000000..f88533a --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/keccakf_amd64.s @@ -0,0 +1,390 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build amd64,!appengine,!gccgo + +// This code was translated into a form compatible with 6a from the public +// domain sources at https://github.com/gvanas/KeccakCodePackage + +// Offsets in state +#define _ba (0*8) +#define _be (1*8) +#define _bi (2*8) +#define _bo (3*8) +#define _bu (4*8) +#define _ga (5*8) +#define _ge (6*8) +#define _gi (7*8) +#define _go (8*8) +#define _gu (9*8) +#define _ka (10*8) +#define _ke (11*8) +#define _ki (12*8) +#define _ko (13*8) +#define _ku (14*8) +#define _ma (15*8) +#define _me (16*8) +#define _mi (17*8) +#define _mo (18*8) +#define _mu (19*8) +#define _sa (20*8) +#define _se (21*8) +#define _si (22*8) +#define _so (23*8) +#define _su (24*8) + +// Temporary registers +#define rT1 AX + +// Round vars +#define rpState DI +#define rpStack SP + +#define rDa BX +#define rDe CX +#define rDi DX +#define rDo R8 +#define rDu R9 + +#define rBa R10 +#define rBe R11 +#define rBi R12 +#define rBo R13 +#define rBu R14 + +#define rCa SI +#define rCe BP +#define rCi rBi +#define rCo rBo +#define rCu R15 + +#define MOVQ_RBI_RCE MOVQ rBi, rCe +#define XORQ_RT1_RCA XORQ rT1, rCa +#define XORQ_RT1_RCE XORQ rT1, rCe +#define XORQ_RBA_RCU XORQ rBa, rCu +#define XORQ_RBE_RCU XORQ rBe, rCu +#define XORQ_RDU_RCU XORQ rDu, rCu +#define XORQ_RDA_RCA XORQ rDa, rCa +#define XORQ_RDE_RCE XORQ rDe, rCe + +#define mKeccakRound(iState, oState, rc, B_RBI_RCE, G_RT1_RCA, G_RT1_RCE, G_RBA_RCU, K_RT1_RCA, K_RT1_RCE, K_RBA_RCU, M_RT1_RCA, M_RT1_RCE, M_RBE_RCU, S_RDU_RCU, S_RDA_RCA, S_RDE_RCE) \ + /* Prepare round */ \ + MOVQ rCe, rDa; \ + ROLQ $1, rDa; \ + \ + MOVQ _bi(iState), rCi; \ + XORQ _gi(iState), rDi; \ + XORQ rCu, rDa; \ + XORQ _ki(iState), rCi; \ + XORQ _mi(iState), rDi; \ + XORQ rDi, rCi; \ + \ + MOVQ rCi, rDe; \ + ROLQ $1, rDe; \ + \ + MOVQ _bo(iState), rCo; \ + XORQ _go(iState), rDo; \ + XORQ rCa, rDe; \ + XORQ _ko(iState), rCo; \ + XORQ _mo(iState), rDo; \ + XORQ rDo, rCo; \ + \ + MOVQ rCo, rDi; \ + ROLQ $1, rDi; \ + \ + MOVQ rCu, rDo; \ + XORQ rCe, rDi; \ + ROLQ $1, rDo; \ + \ + MOVQ rCa, rDu; \ + XORQ rCi, rDo; \ + ROLQ $1, rDu; \ + \ + /* Result b */ \ + MOVQ _ba(iState), rBa; \ + MOVQ _ge(iState), rBe; \ + XORQ rCo, rDu; \ + MOVQ _ki(iState), rBi; \ + MOVQ _mo(iState), rBo; \ + MOVQ _su(iState), rBu; \ + XORQ rDe, rBe; \ + ROLQ $44, rBe; \ + XORQ rDi, rBi; \ + XORQ rDa, rBa; \ + ROLQ $43, rBi; \ + \ + MOVQ rBe, rCa; \ + MOVQ rc, rT1; \ + ORQ rBi, rCa; \ + XORQ rBa, rT1; \ + XORQ rT1, rCa; \ + MOVQ rCa, _ba(oState); \ + \ + XORQ rDu, rBu; \ + ROLQ $14, rBu; \ + MOVQ rBa, rCu; \ + ANDQ rBe, rCu; \ + XORQ rBu, rCu; \ + MOVQ rCu, _bu(oState); \ + \ + XORQ rDo, rBo; \ + ROLQ $21, rBo; \ + MOVQ rBo, rT1; \ + ANDQ rBu, rT1; \ + XORQ rBi, rT1; \ + MOVQ rT1, _bi(oState); \ + \ + NOTQ rBi; \ + ORQ rBa, rBu; \ + ORQ rBo, rBi; \ + XORQ rBo, rBu; \ + XORQ rBe, rBi; \ + MOVQ rBu, _bo(oState); \ + MOVQ rBi, _be(oState); \ + B_RBI_RCE; \ + \ + /* Result g */ \ + MOVQ _gu(iState), rBe; \ + XORQ rDu, rBe; \ + MOVQ _ka(iState), rBi; \ + ROLQ $20, rBe; \ + XORQ rDa, rBi; \ + ROLQ $3, rBi; \ + MOVQ _bo(iState), rBa; \ + MOVQ rBe, rT1; \ + ORQ rBi, rT1; \ + XORQ rDo, rBa; \ + MOVQ _me(iState), rBo; \ + MOVQ _si(iState), rBu; \ + ROLQ $28, rBa; \ + XORQ rBa, rT1; \ + MOVQ rT1, _ga(oState); \ + G_RT1_RCA; \ + \ + XORQ rDe, rBo; \ + ROLQ $45, rBo; \ + MOVQ rBi, rT1; \ + ANDQ rBo, rT1; \ + XORQ rBe, rT1; \ + MOVQ rT1, _ge(oState); \ + G_RT1_RCE; \ + \ + XORQ rDi, rBu; \ + ROLQ $61, rBu; \ + MOVQ rBu, rT1; \ + ORQ rBa, rT1; \ + XORQ rBo, rT1; \ + MOVQ rT1, _go(oState); \ + \ + ANDQ rBe, rBa; \ + XORQ rBu, rBa; \ + MOVQ rBa, _gu(oState); \ + NOTQ rBu; \ + G_RBA_RCU; \ + \ + ORQ rBu, rBo; \ + XORQ rBi, rBo; \ + MOVQ rBo, _gi(oState); \ + \ + /* Result k */ \ + MOVQ _be(iState), rBa; \ + MOVQ _gi(iState), rBe; \ + MOVQ _ko(iState), rBi; \ + MOVQ _mu(iState), rBo; \ + MOVQ _sa(iState), rBu; \ + XORQ rDi, rBe; \ + ROLQ $6, rBe; \ + XORQ rDo, rBi; \ + ROLQ $25, rBi; \ + MOVQ rBe, rT1; \ + ORQ rBi, rT1; \ + XORQ rDe, rBa; \ + ROLQ $1, rBa; \ + XORQ rBa, rT1; \ + MOVQ rT1, _ka(oState); \ + K_RT1_RCA; \ + \ + XORQ rDu, rBo; \ + ROLQ $8, rBo; \ + MOVQ rBi, rT1; \ + ANDQ rBo, rT1; \ + XORQ rBe, rT1; \ + MOVQ rT1, _ke(oState); \ + K_RT1_RCE; \ + \ + XORQ rDa, rBu; \ + ROLQ $18, rBu; \ + NOTQ rBo; \ + MOVQ rBo, rT1; \ + ANDQ rBu, rT1; \ + XORQ rBi, rT1; \ + MOVQ rT1, _ki(oState); \ + \ + MOVQ rBu, rT1; \ + ORQ rBa, rT1; \ + XORQ rBo, rT1; \ + MOVQ rT1, _ko(oState); \ + \ + ANDQ rBe, rBa; \ + XORQ rBu, rBa; \ + MOVQ rBa, _ku(oState); \ + K_RBA_RCU; \ + \ + /* Result m */ \ + MOVQ _ga(iState), rBe; \ + XORQ rDa, rBe; \ + MOVQ _ke(iState), rBi; \ + ROLQ $36, rBe; \ + XORQ rDe, rBi; \ + MOVQ _bu(iState), rBa; \ + ROLQ $10, rBi; \ + MOVQ rBe, rT1; \ + MOVQ _mi(iState), rBo; \ + ANDQ rBi, rT1; \ + XORQ rDu, rBa; \ + MOVQ _so(iState), rBu; \ + ROLQ $27, rBa; \ + XORQ rBa, rT1; \ + MOVQ rT1, _ma(oState); \ + M_RT1_RCA; \ + \ + XORQ rDi, rBo; \ + ROLQ $15, rBo; \ + MOVQ rBi, rT1; \ + ORQ rBo, rT1; \ + XORQ rBe, rT1; \ + MOVQ rT1, _me(oState); \ + M_RT1_RCE; \ + \ + XORQ rDo, rBu; \ + ROLQ $56, rBu; \ + NOTQ rBo; \ + MOVQ rBo, rT1; \ + ORQ rBu, rT1; \ + XORQ rBi, rT1; \ + MOVQ rT1, _mi(oState); \ + \ + ORQ rBa, rBe; \ + XORQ rBu, rBe; \ + MOVQ rBe, _mu(oState); \ + \ + ANDQ rBa, rBu; \ + XORQ rBo, rBu; \ + MOVQ rBu, _mo(oState); \ + M_RBE_RCU; \ + \ + /* Result s */ \ + MOVQ _bi(iState), rBa; \ + MOVQ _go(iState), rBe; \ + MOVQ _ku(iState), rBi; \ + XORQ rDi, rBa; \ + MOVQ _ma(iState), rBo; \ + ROLQ $62, rBa; \ + XORQ rDo, rBe; \ + MOVQ _se(iState), rBu; \ + ROLQ $55, rBe; \ + \ + XORQ rDu, rBi; \ + MOVQ rBa, rDu; \ + XORQ rDe, rBu; \ + ROLQ $2, rBu; \ + ANDQ rBe, rDu; \ + XORQ rBu, rDu; \ + MOVQ rDu, _su(oState); \ + \ + ROLQ $39, rBi; \ + S_RDU_RCU; \ + NOTQ rBe; \ + XORQ rDa, rBo; \ + MOVQ rBe, rDa; \ + ANDQ rBi, rDa; \ + XORQ rBa, rDa; \ + MOVQ rDa, _sa(oState); \ + S_RDA_RCA; \ + \ + ROLQ $41, rBo; \ + MOVQ rBi, rDe; \ + ORQ rBo, rDe; \ + XORQ rBe, rDe; \ + MOVQ rDe, _se(oState); \ + S_RDE_RCE; \ + \ + MOVQ rBo, rDi; \ + MOVQ rBu, rDo; \ + ANDQ rBu, rDi; \ + ORQ rBa, rDo; \ + XORQ rBi, rDi; \ + XORQ rBo, rDo; \ + MOVQ rDi, _si(oState); \ + MOVQ rDo, _so(oState) \ + +// func keccakF1600(state *[25]uint64) +TEXT ·keccakF1600(SB), 0, $200-8 + MOVQ state+0(FP), rpState + + // Convert the user state into an internal state + NOTQ _be(rpState) + NOTQ _bi(rpState) + NOTQ _go(rpState) + NOTQ _ki(rpState) + NOTQ _mi(rpState) + NOTQ _sa(rpState) + + // Execute the KeccakF permutation + MOVQ _ba(rpState), rCa + MOVQ _be(rpState), rCe + MOVQ _bu(rpState), rCu + + XORQ _ga(rpState), rCa + XORQ _ge(rpState), rCe + XORQ _gu(rpState), rCu + + XORQ _ka(rpState), rCa + XORQ _ke(rpState), rCe + XORQ _ku(rpState), rCu + + XORQ _ma(rpState), rCa + XORQ _me(rpState), rCe + XORQ _mu(rpState), rCu + + XORQ _sa(rpState), rCa + XORQ _se(rpState), rCe + MOVQ _si(rpState), rDi + MOVQ _so(rpState), rDo + XORQ _su(rpState), rCu + + mKeccakRound(rpState, rpStack, $0x0000000000000001, MOVQ_RBI_RCE, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBE_RCU, XORQ_RDU_RCU, XORQ_RDA_RCA, XORQ_RDE_RCE) + mKeccakRound(rpStack, rpState, $0x0000000000008082, MOVQ_RBI_RCE, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBE_RCU, XORQ_RDU_RCU, XORQ_RDA_RCA, XORQ_RDE_RCE) + mKeccakRound(rpState, rpStack, $0x800000000000808a, MOVQ_RBI_RCE, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBE_RCU, XORQ_RDU_RCU, XORQ_RDA_RCA, XORQ_RDE_RCE) + mKeccakRound(rpStack, rpState, $0x8000000080008000, MOVQ_RBI_RCE, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBE_RCU, XORQ_RDU_RCU, XORQ_RDA_RCA, XORQ_RDE_RCE) + mKeccakRound(rpState, rpStack, $0x000000000000808b, MOVQ_RBI_RCE, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBE_RCU, XORQ_RDU_RCU, XORQ_RDA_RCA, XORQ_RDE_RCE) + mKeccakRound(rpStack, rpState, $0x0000000080000001, MOVQ_RBI_RCE, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBE_RCU, XORQ_RDU_RCU, XORQ_RDA_RCA, XORQ_RDE_RCE) + mKeccakRound(rpState, rpStack, $0x8000000080008081, MOVQ_RBI_RCE, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBE_RCU, XORQ_RDU_RCU, XORQ_RDA_RCA, XORQ_RDE_RCE) + mKeccakRound(rpStack, rpState, $0x8000000000008009, MOVQ_RBI_RCE, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBE_RCU, XORQ_RDU_RCU, XORQ_RDA_RCA, XORQ_RDE_RCE) + mKeccakRound(rpState, rpStack, $0x000000000000008a, MOVQ_RBI_RCE, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBE_RCU, XORQ_RDU_RCU, XORQ_RDA_RCA, XORQ_RDE_RCE) + mKeccakRound(rpStack, rpState, $0x0000000000000088, MOVQ_RBI_RCE, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBE_RCU, XORQ_RDU_RCU, XORQ_RDA_RCA, XORQ_RDE_RCE) + mKeccakRound(rpState, rpStack, $0x0000000080008009, MOVQ_RBI_RCE, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBE_RCU, XORQ_RDU_RCU, XORQ_RDA_RCA, XORQ_RDE_RCE) + mKeccakRound(rpStack, rpState, $0x000000008000000a, MOVQ_RBI_RCE, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBE_RCU, XORQ_RDU_RCU, XORQ_RDA_RCA, XORQ_RDE_RCE) + mKeccakRound(rpState, rpStack, $0x000000008000808b, MOVQ_RBI_RCE, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBE_RCU, XORQ_RDU_RCU, XORQ_RDA_RCA, XORQ_RDE_RCE) + mKeccakRound(rpStack, rpState, $0x800000000000008b, MOVQ_RBI_RCE, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBE_RCU, XORQ_RDU_RCU, XORQ_RDA_RCA, XORQ_RDE_RCE) + mKeccakRound(rpState, rpStack, $0x8000000000008089, MOVQ_RBI_RCE, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBE_RCU, XORQ_RDU_RCU, XORQ_RDA_RCA, XORQ_RDE_RCE) + mKeccakRound(rpStack, rpState, $0x8000000000008003, MOVQ_RBI_RCE, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBE_RCU, XORQ_RDU_RCU, XORQ_RDA_RCA, XORQ_RDE_RCE) + mKeccakRound(rpState, rpStack, $0x8000000000008002, MOVQ_RBI_RCE, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBE_RCU, XORQ_RDU_RCU, XORQ_RDA_RCA, XORQ_RDE_RCE) + mKeccakRound(rpStack, rpState, $0x8000000000000080, MOVQ_RBI_RCE, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBE_RCU, XORQ_RDU_RCU, XORQ_RDA_RCA, XORQ_RDE_RCE) + mKeccakRound(rpState, rpStack, $0x000000000000800a, MOVQ_RBI_RCE, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBE_RCU, XORQ_RDU_RCU, XORQ_RDA_RCA, XORQ_RDE_RCE) + mKeccakRound(rpStack, rpState, $0x800000008000000a, MOVQ_RBI_RCE, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBE_RCU, XORQ_RDU_RCU, XORQ_RDA_RCA, XORQ_RDE_RCE) + mKeccakRound(rpState, rpStack, $0x8000000080008081, MOVQ_RBI_RCE, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBE_RCU, XORQ_RDU_RCU, XORQ_RDA_RCA, XORQ_RDE_RCE) + mKeccakRound(rpStack, rpState, $0x8000000000008080, MOVQ_RBI_RCE, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBE_RCU, XORQ_RDU_RCU, XORQ_RDA_RCA, XORQ_RDE_RCE) + mKeccakRound(rpState, rpStack, $0x0000000080000001, MOVQ_RBI_RCE, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBA_RCU, XORQ_RT1_RCA, XORQ_RT1_RCE, XORQ_RBE_RCU, XORQ_RDU_RCU, XORQ_RDA_RCA, XORQ_RDE_RCE) + mKeccakRound(rpStack, rpState, $0x8000000080008008, NOP, NOP, NOP, NOP, NOP, NOP, NOP, NOP, NOP, NOP, NOP, NOP, NOP) + + // Revert the internal state to the user state + NOTQ _be(rpState) + NOTQ _bi(rpState) + NOTQ _go(rpState) + NOTQ _ki(rpState) + NOTQ _mi(rpState) + NOTQ _sa(rpState) + + RET diff --git a/vendor/golang.org/x/crypto/sha3/register.go b/vendor/golang.org/x/crypto/sha3/register.go new file mode 100644 index 0000000..3cf6a22 --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/register.go @@ -0,0 +1,18 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build go1.4 + +package sha3 + +import ( + "crypto" +) + +func init() { + crypto.RegisterHash(crypto.SHA3_224, New224) + crypto.RegisterHash(crypto.SHA3_256, New256) + crypto.RegisterHash(crypto.SHA3_384, New384) + crypto.RegisterHash(crypto.SHA3_512, New512) +} diff --git a/vendor/golang.org/x/crypto/sha3/sha3.go b/vendor/golang.org/x/crypto/sha3/sha3.go new file mode 100644 index 0000000..ba269a0 --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/sha3.go @@ -0,0 +1,193 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package sha3 + +// spongeDirection indicates the direction bytes are flowing through the sponge. +type spongeDirection int + +const ( + // spongeAbsorbing indicates that the sponge is absorbing input. + spongeAbsorbing spongeDirection = iota + // spongeSqueezing indicates that the sponge is being squeezed. + spongeSqueezing +) + +const ( + // maxRate is the maximum size of the internal buffer. SHAKE-256 + // currently needs the largest buffer. + maxRate = 168 +) + +type state struct { + // Generic sponge components. + a [25]uint64 // main state of the hash + buf []byte // points into storage + rate int // the number of bytes of state to use + + // dsbyte contains the "domain separation" bits and the first bit of + // the padding. Sections 6.1 and 6.2 of [1] separate the outputs of the + // SHA-3 and SHAKE functions by appending bitstrings to the message. + // Using a little-endian bit-ordering convention, these are "01" for SHA-3 + // and "1111" for SHAKE, or 00000010b and 00001111b, respectively. Then the + // padding rule from section 5.1 is applied to pad the message to a multiple + // of the rate, which involves adding a "1" bit, zero or more "0" bits, and + // a final "1" bit. We merge the first "1" bit from the padding into dsbyte, + // giving 00000110b (0x06) and 00011111b (0x1f). + // [1] http://csrc.nist.gov/publications/drafts/fips-202/fips_202_draft.pdf + // "Draft FIPS 202: SHA-3 Standard: Permutation-Based Hash and + // Extendable-Output Functions (May 2014)" + dsbyte byte + + storage storageBuf + + // Specific to SHA-3 and SHAKE. + outputLen int // the default output size in bytes + state spongeDirection // whether the sponge is absorbing or squeezing +} + +// BlockSize returns the rate of sponge underlying this hash function. +func (d *state) BlockSize() int { return d.rate } + +// Size returns the output size of the hash function in bytes. +func (d *state) Size() int { return d.outputLen } + +// Reset clears the internal state by zeroing the sponge state and +// the byte buffer, and setting Sponge.state to absorbing. +func (d *state) Reset() { + // Zero the permutation's state. + for i := range d.a { + d.a[i] = 0 + } + d.state = spongeAbsorbing + d.buf = d.storage.asBytes()[:0] +} + +func (d *state) clone() *state { + ret := *d + if ret.state == spongeAbsorbing { + ret.buf = ret.storage.asBytes()[:len(ret.buf)] + } else { + ret.buf = ret.storage.asBytes()[d.rate-cap(d.buf) : d.rate] + } + + return &ret +} + +// permute applies the KeccakF-1600 permutation. It handles +// any input-output buffering. +func (d *state) permute() { + switch d.state { + case spongeAbsorbing: + // If we're absorbing, we need to xor the input into the state + // before applying the permutation. + xorIn(d, d.buf) + d.buf = d.storage.asBytes()[:0] + keccakF1600(&d.a) + case spongeSqueezing: + // If we're squeezing, we need to apply the permutatin before + // copying more output. + keccakF1600(&d.a) + d.buf = d.storage.asBytes()[:d.rate] + copyOut(d, d.buf) + } +} + +// pads appends the domain separation bits in dsbyte, applies +// the multi-bitrate 10..1 padding rule, and permutes the state. +func (d *state) padAndPermute(dsbyte byte) { + if d.buf == nil { + d.buf = d.storage.asBytes()[:0] + } + // Pad with this instance's domain-separator bits. We know that there's + // at least one byte of space in d.buf because, if it were full, + // permute would have been called to empty it. dsbyte also contains the + // first one bit for the padding. See the comment in the state struct. + d.buf = append(d.buf, dsbyte) + zerosStart := len(d.buf) + d.buf = d.storage.asBytes()[:d.rate] + for i := zerosStart; i < d.rate; i++ { + d.buf[i] = 0 + } + // This adds the final one bit for the padding. Because of the way that + // bits are numbered from the LSB upwards, the final bit is the MSB of + // the last byte. + d.buf[d.rate-1] ^= 0x80 + // Apply the permutation + d.permute() + d.state = spongeSqueezing + d.buf = d.storage.asBytes()[:d.rate] + copyOut(d, d.buf) +} + +// Write absorbs more data into the hash's state. It produces an error +// if more data is written to the ShakeHash after writing +func (d *state) Write(p []byte) (written int, err error) { + if d.state != spongeAbsorbing { + panic("sha3: write to sponge after read") + } + if d.buf == nil { + d.buf = d.storage.asBytes()[:0] + } + written = len(p) + + for len(p) > 0 { + if len(d.buf) == 0 && len(p) >= d.rate { + // The fast path; absorb a full "rate" bytes of input and apply the permutation. + xorIn(d, p[:d.rate]) + p = p[d.rate:] + keccakF1600(&d.a) + } else { + // The slow path; buffer the input until we can fill the sponge, and then xor it in. + todo := d.rate - len(d.buf) + if todo > len(p) { + todo = len(p) + } + d.buf = append(d.buf, p[:todo]...) + p = p[todo:] + + // If the sponge is full, apply the permutation. + if len(d.buf) == d.rate { + d.permute() + } + } + } + + return +} + +// Read squeezes an arbitrary number of bytes from the sponge. +func (d *state) Read(out []byte) (n int, err error) { + // If we're still absorbing, pad and apply the permutation. + if d.state == spongeAbsorbing { + d.padAndPermute(d.dsbyte) + } + + n = len(out) + + // Now, do the squeezing. + for len(out) > 0 { + n := copy(out, d.buf) + d.buf = d.buf[n:] + out = out[n:] + + // Apply the permutation if we've squeezed the sponge dry. + if len(d.buf) == 0 { + d.permute() + } + } + + return +} + +// Sum applies padding to the hash state and then squeezes out the desired +// number of output bytes. +func (d *state) Sum(in []byte) []byte { + // Make a copy of the original hash so that caller can keep writing + // and summing. + dup := d.clone() + hash := make([]byte, dup.outputLen) + dup.Read(hash) + return append(in, hash...) +} diff --git a/vendor/golang.org/x/crypto/sha3/sha3_s390x.go b/vendor/golang.org/x/crypto/sha3/sha3_s390x.go new file mode 100644 index 0000000..259ff4d --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/sha3_s390x.go @@ -0,0 +1,284 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build !gccgo,!appengine + +package sha3 + +// This file contains code for using the 'compute intermediate +// message digest' (KIMD) and 'compute last message digest' (KLMD) +// instructions to compute SHA-3 and SHAKE hashes on IBM Z. + +import ( + "hash" + + "golang.org/x/sys/cpu" +) + +// codes represent 7-bit KIMD/KLMD function codes as defined in +// the Principles of Operation. +type code uint64 + +const ( + // function codes for KIMD/KLMD + sha3_224 code = 32 + sha3_256 = 33 + sha3_384 = 34 + sha3_512 = 35 + shake_128 = 36 + shake_256 = 37 + nopad = 0x100 +) + +// kimd is a wrapper for the 'compute intermediate message digest' instruction. +// src must be a multiple of the rate for the given function code. +//go:noescape +func kimd(function code, chain *[200]byte, src []byte) + +// klmd is a wrapper for the 'compute last message digest' instruction. +// src padding is handled by the instruction. +//go:noescape +func klmd(function code, chain *[200]byte, dst, src []byte) + +type asmState struct { + a [200]byte // 1600 bit state + buf []byte // care must be taken to ensure cap(buf) is a multiple of rate + rate int // equivalent to block size + storage [3072]byte // underlying storage for buf + outputLen int // output length if fixed, 0 if not + function code // KIMD/KLMD function code + state spongeDirection // whether the sponge is absorbing or squeezing +} + +func newAsmState(function code) *asmState { + var s asmState + s.function = function + switch function { + case sha3_224: + s.rate = 144 + s.outputLen = 28 + case sha3_256: + s.rate = 136 + s.outputLen = 32 + case sha3_384: + s.rate = 104 + s.outputLen = 48 + case sha3_512: + s.rate = 72 + s.outputLen = 64 + case shake_128: + s.rate = 168 + case shake_256: + s.rate = 136 + default: + panic("sha3: unrecognized function code") + } + + // limit s.buf size to a multiple of s.rate + s.resetBuf() + return &s +} + +func (s *asmState) clone() *asmState { + c := *s + c.buf = c.storage[:len(s.buf):cap(s.buf)] + return &c +} + +// copyIntoBuf copies b into buf. It will panic if there is not enough space to +// store all of b. +func (s *asmState) copyIntoBuf(b []byte) { + bufLen := len(s.buf) + s.buf = s.buf[:len(s.buf)+len(b)] + copy(s.buf[bufLen:], b) +} + +// resetBuf points buf at storage, sets the length to 0 and sets cap to be a +// multiple of the rate. +func (s *asmState) resetBuf() { + max := (cap(s.storage) / s.rate) * s.rate + s.buf = s.storage[:0:max] +} + +// Write (via the embedded io.Writer interface) adds more data to the running hash. +// It never returns an error. +func (s *asmState) Write(b []byte) (int, error) { + if s.state != spongeAbsorbing { + panic("sha3: write to sponge after read") + } + length := len(b) + for len(b) > 0 { + if len(s.buf) == 0 && len(b) >= cap(s.buf) { + // Hash the data directly and push any remaining bytes + // into the buffer. + remainder := len(b) % s.rate + kimd(s.function, &s.a, b[:len(b)-remainder]) + if remainder != 0 { + s.copyIntoBuf(b[len(b)-remainder:]) + } + return length, nil + } + + if len(s.buf) == cap(s.buf) { + // flush the buffer + kimd(s.function, &s.a, s.buf) + s.buf = s.buf[:0] + } + + // copy as much as we can into the buffer + n := len(b) + if len(b) > cap(s.buf)-len(s.buf) { + n = cap(s.buf) - len(s.buf) + } + s.copyIntoBuf(b[:n]) + b = b[n:] + } + return length, nil +} + +// Read squeezes an arbitrary number of bytes from the sponge. +func (s *asmState) Read(out []byte) (n int, err error) { + n = len(out) + + // need to pad if we were absorbing + if s.state == spongeAbsorbing { + s.state = spongeSqueezing + + // write hash directly into out if possible + if len(out)%s.rate == 0 { + klmd(s.function, &s.a, out, s.buf) // len(out) may be 0 + s.buf = s.buf[:0] + return + } + + // write hash into buffer + max := cap(s.buf) + if max > len(out) { + max = (len(out)/s.rate)*s.rate + s.rate + } + klmd(s.function, &s.a, s.buf[:max], s.buf) + s.buf = s.buf[:max] + } + + for len(out) > 0 { + // flush the buffer + if len(s.buf) != 0 { + c := copy(out, s.buf) + out = out[c:] + s.buf = s.buf[c:] + continue + } + + // write hash directly into out if possible + if len(out)%s.rate == 0 { + klmd(s.function|nopad, &s.a, out, nil) + return + } + + // write hash into buffer + s.resetBuf() + if cap(s.buf) > len(out) { + s.buf = s.buf[:(len(out)/s.rate)*s.rate+s.rate] + } + klmd(s.function|nopad, &s.a, s.buf, nil) + } + return +} + +// Sum appends the current hash to b and returns the resulting slice. +// It does not change the underlying hash state. +func (s *asmState) Sum(b []byte) []byte { + if s.outputLen == 0 { + panic("sha3: cannot call Sum on SHAKE functions") + } + + // Copy the state to preserve the original. + a := s.a + + // Hash the buffer. Note that we don't clear it because we + // aren't updating the state. + klmd(s.function, &a, nil, s.buf) + return append(b, a[:s.outputLen]...) +} + +// Reset resets the Hash to its initial state. +func (s *asmState) Reset() { + for i := range s.a { + s.a[i] = 0 + } + s.resetBuf() + s.state = spongeAbsorbing +} + +// Size returns the number of bytes Sum will return. +func (s *asmState) Size() int { + return s.outputLen +} + +// BlockSize returns the hash's underlying block size. +// The Write method must be able to accept any amount +// of data, but it may operate more efficiently if all writes +// are a multiple of the block size. +func (s *asmState) BlockSize() int { + return s.rate +} + +// Clone returns a copy of the ShakeHash in its current state. +func (s *asmState) Clone() ShakeHash { + return s.clone() +} + +// new224Asm returns an assembly implementation of SHA3-224 if available, +// otherwise it returns nil. +func new224Asm() hash.Hash { + if cpu.S390X.HasSHA3 { + return newAsmState(sha3_224) + } + return nil +} + +// new256Asm returns an assembly implementation of SHA3-256 if available, +// otherwise it returns nil. +func new256Asm() hash.Hash { + if cpu.S390X.HasSHA3 { + return newAsmState(sha3_256) + } + return nil +} + +// new384Asm returns an assembly implementation of SHA3-384 if available, +// otherwise it returns nil. +func new384Asm() hash.Hash { + if cpu.S390X.HasSHA3 { + return newAsmState(sha3_384) + } + return nil +} + +// new512Asm returns an assembly implementation of SHA3-512 if available, +// otherwise it returns nil. +func new512Asm() hash.Hash { + if cpu.S390X.HasSHA3 { + return newAsmState(sha3_512) + } + return nil +} + +// newShake128Asm returns an assembly implementation of SHAKE-128 if available, +// otherwise it returns nil. +func newShake128Asm() ShakeHash { + if cpu.S390X.HasSHA3 { + return newAsmState(shake_128) + } + return nil +} + +// newShake256Asm returns an assembly implementation of SHAKE-256 if available, +// otherwise it returns nil. +func newShake256Asm() ShakeHash { + if cpu.S390X.HasSHA3 { + return newAsmState(shake_256) + } + return nil +} diff --git a/vendor/golang.org/x/crypto/sha3/sha3_s390x.s b/vendor/golang.org/x/crypto/sha3/sha3_s390x.s new file mode 100644 index 0000000..8a4458f --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/sha3_s390x.s @@ -0,0 +1,33 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build !gccgo,!appengine + +#include "textflag.h" + +// func kimd(function code, chain *[200]byte, src []byte) +TEXT ·kimd(SB), NOFRAME|NOSPLIT, $0-40 + MOVD function+0(FP), R0 + MOVD chain+8(FP), R1 + LMG src+16(FP), R2, R3 // R2=base, R3=len + +continue: + WORD $0xB93E0002 // KIMD --, R2 + BVS continue // continue if interrupted + MOVD $0, R0 // reset R0 for pre-go1.8 compilers + RET + +// func klmd(function code, chain *[200]byte, dst, src []byte) +TEXT ·klmd(SB), NOFRAME|NOSPLIT, $0-64 + // TODO: SHAKE support + MOVD function+0(FP), R0 + MOVD chain+8(FP), R1 + LMG dst+16(FP), R2, R3 // R2=base, R3=len + LMG src+40(FP), R4, R5 // R4=base, R5=len + +continue: + WORD $0xB93F0024 // KLMD R2, R4 + BVS continue // continue if interrupted + MOVD $0, R0 // reset R0 for pre-go1.8 compilers + RET diff --git a/vendor/golang.org/x/crypto/sha3/shake.go b/vendor/golang.org/x/crypto/sha3/shake.go new file mode 100644 index 0000000..d7be295 --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/shake.go @@ -0,0 +1,173 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package sha3 + +// This file defines the ShakeHash interface, and provides +// functions for creating SHAKE and cSHAKE instances, as well as utility +// functions for hashing bytes to arbitrary-length output. +// +// +// SHAKE implementation is based on FIPS PUB 202 [1] +// cSHAKE implementations is based on NIST SP 800-185 [2] +// +// [1] https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.202.pdf +// [2] https://doi.org/10.6028/NIST.SP.800-185 + +import ( + "encoding/binary" + "io" +) + +// ShakeHash defines the interface to hash functions that +// support arbitrary-length output. +type ShakeHash interface { + // Write absorbs more data into the hash's state. It panics if input is + // written to it after output has been read from it. + io.Writer + + // Read reads more output from the hash; reading affects the hash's + // state. (ShakeHash.Read is thus very different from Hash.Sum) + // It never returns an error. + io.Reader + + // Clone returns a copy of the ShakeHash in its current state. + Clone() ShakeHash + + // Reset resets the ShakeHash to its initial state. + Reset() +} + +// cSHAKE specific context +type cshakeState struct { + *state // SHA-3 state context and Read/Write operations + + // initBlock is the cSHAKE specific initialization set of bytes. It is initialized + // by newCShake function and stores concatenation of N followed by S, encoded + // by the method specified in 3.3 of [1]. + // It is stored here in order for Reset() to be able to put context into + // initial state. + initBlock []byte +} + +// Consts for configuring initial SHA-3 state +const ( + dsbyteShake = 0x1f + dsbyteCShake = 0x04 + rate128 = 168 + rate256 = 136 +) + +func bytepad(input []byte, w int) []byte { + // leftEncode always returns max 9 bytes + buf := make([]byte, 0, 9+len(input)+w) + buf = append(buf, leftEncode(uint64(w))...) + buf = append(buf, input...) + padlen := w - (len(buf) % w) + return append(buf, make([]byte, padlen)...) +} + +func leftEncode(value uint64) []byte { + var b [9]byte + binary.BigEndian.PutUint64(b[1:], value) + // Trim all but last leading zero bytes + i := byte(1) + for i < 8 && b[i] == 0 { + i++ + } + // Prepend number of encoded bytes + b[i-1] = 9 - i + return b[i-1:] +} + +func newCShake(N, S []byte, rate int, dsbyte byte) ShakeHash { + c := cshakeState{state: &state{rate: rate, dsbyte: dsbyte}} + + // leftEncode returns max 9 bytes + c.initBlock = make([]byte, 0, 9*2+len(N)+len(S)) + c.initBlock = append(c.initBlock, leftEncode(uint64(len(N)*8))...) + c.initBlock = append(c.initBlock, N...) + c.initBlock = append(c.initBlock, leftEncode(uint64(len(S)*8))...) + c.initBlock = append(c.initBlock, S...) + c.Write(bytepad(c.initBlock, c.rate)) + return &c +} + +// Reset resets the hash to initial state. +func (c *cshakeState) Reset() { + c.state.Reset() + c.Write(bytepad(c.initBlock, c.rate)) +} + +// Clone returns copy of a cSHAKE context within its current state. +func (c *cshakeState) Clone() ShakeHash { + b := make([]byte, len(c.initBlock)) + copy(b, c.initBlock) + return &cshakeState{state: c.clone(), initBlock: b} +} + +// Clone returns copy of SHAKE context within its current state. +func (c *state) Clone() ShakeHash { + return c.clone() +} + +// NewShake128 creates a new SHAKE128 variable-output-length ShakeHash. +// Its generic security strength is 128 bits against all attacks if at +// least 32 bytes of its output are used. +func NewShake128() ShakeHash { + if h := newShake128Asm(); h != nil { + return h + } + return &state{rate: rate128, dsbyte: dsbyteShake} +} + +// NewShake256 creates a new SHAKE256 variable-output-length ShakeHash. +// Its generic security strength is 256 bits against all attacks if +// at least 64 bytes of its output are used. +func NewShake256() ShakeHash { + if h := newShake256Asm(); h != nil { + return h + } + return &state{rate: rate256, dsbyte: dsbyteShake} +} + +// NewCShake128 creates a new instance of cSHAKE128 variable-output-length ShakeHash, +// a customizable variant of SHAKE128. +// N is used to define functions based on cSHAKE, it can be empty when plain cSHAKE is +// desired. S is a customization byte string used for domain separation - two cSHAKE +// computations on same input with different S yield unrelated outputs. +// When N and S are both empty, this is equivalent to NewShake128. +func NewCShake128(N, S []byte) ShakeHash { + if len(N) == 0 && len(S) == 0 { + return NewShake128() + } + return newCShake(N, S, rate128, dsbyteCShake) +} + +// NewCShake256 creates a new instance of cSHAKE256 variable-output-length ShakeHash, +// a customizable variant of SHAKE256. +// N is used to define functions based on cSHAKE, it can be empty when plain cSHAKE is +// desired. S is a customization byte string used for domain separation - two cSHAKE +// computations on same input with different S yield unrelated outputs. +// When N and S are both empty, this is equivalent to NewShake256. +func NewCShake256(N, S []byte) ShakeHash { + if len(N) == 0 && len(S) == 0 { + return NewShake256() + } + return newCShake(N, S, rate256, dsbyteCShake) +} + +// ShakeSum128 writes an arbitrary-length digest of data into hash. +func ShakeSum128(hash, data []byte) { + h := NewShake128() + h.Write(data) + h.Read(hash) +} + +// ShakeSum256 writes an arbitrary-length digest of data into hash. +func ShakeSum256(hash, data []byte) { + h := NewShake256() + h.Write(data) + h.Read(hash) +} diff --git a/vendor/golang.org/x/crypto/sha3/shake_generic.go b/vendor/golang.org/x/crypto/sha3/shake_generic.go new file mode 100644 index 0000000..add4e73 --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/shake_generic.go @@ -0,0 +1,19 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build gccgo appengine !s390x + +package sha3 + +// newShake128Asm returns an assembly implementation of SHAKE-128 if available, +// otherwise it returns nil. +func newShake128Asm() ShakeHash { + return nil +} + +// newShake256Asm returns an assembly implementation of SHAKE-256 if available, +// otherwise it returns nil. +func newShake256Asm() ShakeHash { + return nil +} diff --git a/vendor/golang.org/x/crypto/sha3/xor.go b/vendor/golang.org/x/crypto/sha3/xor.go new file mode 100644 index 0000000..079b650 --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/xor.go @@ -0,0 +1,23 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build !amd64,!386,!ppc64le appengine + +package sha3 + +// A storageBuf is an aligned array of maxRate bytes. +type storageBuf [maxRate]byte + +func (b *storageBuf) asBytes() *[maxRate]byte { + return (*[maxRate]byte)(b) +} + +var ( + xorIn = xorInGeneric + copyOut = copyOutGeneric + xorInUnaligned = xorInGeneric + copyOutUnaligned = copyOutGeneric +) + +const xorImplementationUnaligned = "generic" diff --git a/vendor/golang.org/x/crypto/sha3/xor_generic.go b/vendor/golang.org/x/crypto/sha3/xor_generic.go new file mode 100644 index 0000000..fd35f02 --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/xor_generic.go @@ -0,0 +1,28 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package sha3 + +import "encoding/binary" + +// xorInGeneric xors the bytes in buf into the state; it +// makes no non-portable assumptions about memory layout +// or alignment. +func xorInGeneric(d *state, buf []byte) { + n := len(buf) / 8 + + for i := 0; i < n; i++ { + a := binary.LittleEndian.Uint64(buf) + d.a[i] ^= a + buf = buf[8:] + } +} + +// copyOutGeneric copies ulint64s to a byte buffer. +func copyOutGeneric(d *state, b []byte) { + for i := 0; len(b) >= 8; i++ { + binary.LittleEndian.PutUint64(b, d.a[i]) + b = b[8:] + } +} diff --git a/vendor/golang.org/x/crypto/sha3/xor_unaligned.go b/vendor/golang.org/x/crypto/sha3/xor_unaligned.go new file mode 100644 index 0000000..5ede2c6 --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/xor_unaligned.go @@ -0,0 +1,76 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build amd64 386 ppc64le +// +build !appengine + +package sha3 + +import "unsafe" + +// A storageBuf is an aligned array of maxRate bytes. +type storageBuf [maxRate / 8]uint64 + +func (b *storageBuf) asBytes() *[maxRate]byte { + return (*[maxRate]byte)(unsafe.Pointer(b)) +} + +//go:nocheckptr +// +// xorInUnaligned intentionally reads the input buffer as an unaligned slice of +// integers. The language spec is not clear on whether that is allowed. +// See: +// https://golang.org/issue/37644 +// https://golang.org/issue/37298 +// https://golang.org/issue/35381 + +// xorInUnaligned uses unaligned reads and writes to update d.a to contain d.a +// XOR buf. +func xorInUnaligned(d *state, buf []byte) { + n := len(buf) + bw := (*[maxRate / 8]uint64)(unsafe.Pointer(&buf[0]))[: n/8 : n/8] + if n >= 72 { + d.a[0] ^= bw[0] + d.a[1] ^= bw[1] + d.a[2] ^= bw[2] + d.a[3] ^= bw[3] + d.a[4] ^= bw[4] + d.a[5] ^= bw[5] + d.a[6] ^= bw[6] + d.a[7] ^= bw[7] + d.a[8] ^= bw[8] + } + if n >= 104 { + d.a[9] ^= bw[9] + d.a[10] ^= bw[10] + d.a[11] ^= bw[11] + d.a[12] ^= bw[12] + } + if n >= 136 { + d.a[13] ^= bw[13] + d.a[14] ^= bw[14] + d.a[15] ^= bw[15] + d.a[16] ^= bw[16] + } + if n >= 144 { + d.a[17] ^= bw[17] + } + if n >= 168 { + d.a[18] ^= bw[18] + d.a[19] ^= bw[19] + d.a[20] ^= bw[20] + } +} + +func copyOutUnaligned(d *state, buf []byte) { + ab := (*[maxRate]uint8)(unsafe.Pointer(&d.a[0])) + copy(buf, ab[:]) +} + +var ( + xorIn = xorInUnaligned + copyOut = copyOutUnaligned +) + +const xorImplementationUnaligned = "unaligned" diff --git a/vendor/golang.org/x/sys/cpu/asm_aix_ppc64.s b/vendor/golang.org/x/sys/cpu/asm_aix_ppc64.s new file mode 100644 index 0000000..06f84b8 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/asm_aix_ppc64.s @@ -0,0 +1,17 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build !gccgo + +#include "textflag.h" + +// +// System calls for ppc64, AIX are implemented in runtime/syscall_aix.go +// + +TEXT ·syscall6(SB),NOSPLIT,$0-88 + JMP syscall·syscall6(SB) + +TEXT ·rawSyscall6(SB),NOSPLIT,$0-88 + JMP syscall·rawSyscall6(SB) diff --git a/vendor/golang.org/x/sys/cpu/byteorder.go b/vendor/golang.org/x/sys/cpu/byteorder.go new file mode 100644 index 0000000..ed8da8d --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/byteorder.go @@ -0,0 +1,60 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cpu + +import ( + "runtime" +) + +// byteOrder is a subset of encoding/binary.ByteOrder. +type byteOrder interface { + Uint32([]byte) uint32 + Uint64([]byte) uint64 +} + +type littleEndian struct{} +type bigEndian struct{} + +func (littleEndian) Uint32(b []byte) uint32 { + _ = b[3] // bounds check hint to compiler; see golang.org/issue/14808 + return uint32(b[0]) | uint32(b[1])<<8 | uint32(b[2])<<16 | uint32(b[3])<<24 +} + +func (littleEndian) Uint64(b []byte) uint64 { + _ = b[7] // bounds check hint to compiler; see golang.org/issue/14808 + return uint64(b[0]) | uint64(b[1])<<8 | uint64(b[2])<<16 | uint64(b[3])<<24 | + uint64(b[4])<<32 | uint64(b[5])<<40 | uint64(b[6])<<48 | uint64(b[7])<<56 +} + +func (bigEndian) Uint32(b []byte) uint32 { + _ = b[3] // bounds check hint to compiler; see golang.org/issue/14808 + return uint32(b[3]) | uint32(b[2])<<8 | uint32(b[1])<<16 | uint32(b[0])<<24 +} + +func (bigEndian) Uint64(b []byte) uint64 { + _ = b[7] // bounds check hint to compiler; see golang.org/issue/14808 + return uint64(b[7]) | uint64(b[6])<<8 | uint64(b[5])<<16 | uint64(b[4])<<24 | + uint64(b[3])<<32 | uint64(b[2])<<40 | uint64(b[1])<<48 | uint64(b[0])<<56 +} + +// hostByteOrder returns binary.LittleEndian on little-endian machines and +// binary.BigEndian on big-endian machines. +func hostByteOrder() byteOrder { + switch runtime.GOARCH { + case "386", "amd64", "amd64p32", + "arm", "arm64", + "mipsle", "mips64le", "mips64p32le", + "ppc64le", + "riscv", "riscv64": + return littleEndian{} + case "armbe", "arm64be", + "mips", "mips64", "mips64p32", + "ppc", "ppc64", + "s390", "s390x", + "sparc", "sparc64": + return bigEndian{} + } + panic("unknown architecture") +} diff --git a/vendor/golang.org/x/sys/cpu/cpu.go b/vendor/golang.org/x/sys/cpu/cpu.go new file mode 100644 index 0000000..b4e6ecb --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu.go @@ -0,0 +1,162 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package cpu implements processor feature detection for +// various CPU architectures. +package cpu + +// Initialized reports whether the CPU features were initialized. +// +// For some GOOS/GOARCH combinations initialization of the CPU features depends +// on reading an operating specific file, e.g. /proc/self/auxv on linux/arm +// Initialized will report false if reading the file fails. +var Initialized bool + +// CacheLinePad is used to pad structs to avoid false sharing. +type CacheLinePad struct{ _ [cacheLineSize]byte } + +// X86 contains the supported CPU features of the +// current X86/AMD64 platform. If the current platform +// is not X86/AMD64 then all feature flags are false. +// +// X86 is padded to avoid false sharing. Further the HasAVX +// and HasAVX2 are only set if the OS supports XMM and YMM +// registers in addition to the CPUID feature bit being set. +var X86 struct { + _ CacheLinePad + HasAES bool // AES hardware implementation (AES NI) + HasADX bool // Multi-precision add-carry instruction extensions + HasAVX bool // Advanced vector extension + HasAVX2 bool // Advanced vector extension 2 + HasBMI1 bool // Bit manipulation instruction set 1 + HasBMI2 bool // Bit manipulation instruction set 2 + HasERMS bool // Enhanced REP for MOVSB and STOSB + HasFMA bool // Fused-multiply-add instructions + HasOSXSAVE bool // OS supports XSAVE/XRESTOR for saving/restoring XMM registers. + HasPCLMULQDQ bool // PCLMULQDQ instruction - most often used for AES-GCM + HasPOPCNT bool // Hamming weight instruction POPCNT. + HasRDRAND bool // RDRAND instruction (on-chip random number generator) + HasRDSEED bool // RDSEED instruction (on-chip random number generator) + HasSSE2 bool // Streaming SIMD extension 2 (always available on amd64) + HasSSE3 bool // Streaming SIMD extension 3 + HasSSSE3 bool // Supplemental streaming SIMD extension 3 + HasSSE41 bool // Streaming SIMD extension 4 and 4.1 + HasSSE42 bool // Streaming SIMD extension 4 and 4.2 + _ CacheLinePad +} + +// ARM64 contains the supported CPU features of the +// current ARMv8(aarch64) platform. If the current platform +// is not arm64 then all feature flags are false. +var ARM64 struct { + _ CacheLinePad + HasFP bool // Floating-point instruction set (always available) + HasASIMD bool // Advanced SIMD (always available) + HasEVTSTRM bool // Event stream support + HasAES bool // AES hardware implementation + HasPMULL bool // Polynomial multiplication instruction set + HasSHA1 bool // SHA1 hardware implementation + HasSHA2 bool // SHA2 hardware implementation + HasCRC32 bool // CRC32 hardware implementation + HasATOMICS bool // Atomic memory operation instruction set + HasFPHP bool // Half precision floating-point instruction set + HasASIMDHP bool // Advanced SIMD half precision instruction set + HasCPUID bool // CPUID identification scheme registers + HasASIMDRDM bool // Rounding double multiply add/subtract instruction set + HasJSCVT bool // Javascript conversion from floating-point to integer + HasFCMA bool // Floating-point multiplication and addition of complex numbers + HasLRCPC bool // Release Consistent processor consistent support + HasDCPOP bool // Persistent memory support + HasSHA3 bool // SHA3 hardware implementation + HasSM3 bool // SM3 hardware implementation + HasSM4 bool // SM4 hardware implementation + HasASIMDDP bool // Advanced SIMD double precision instruction set + HasSHA512 bool // SHA512 hardware implementation + HasSVE bool // Scalable Vector Extensions + HasASIMDFHM bool // Advanced SIMD multiplication FP16 to FP32 + _ CacheLinePad +} + +// ARM contains the supported CPU features of the current ARM (32-bit) platform. +// All feature flags are false if: +// 1. the current platform is not arm, or +// 2. the current operating system is not Linux. +var ARM struct { + _ CacheLinePad + HasSWP bool // SWP instruction support + HasHALF bool // Half-word load and store support + HasTHUMB bool // ARM Thumb instruction set + Has26BIT bool // Address space limited to 26-bits + HasFASTMUL bool // 32-bit operand, 64-bit result multiplication support + HasFPA bool // Floating point arithmetic support + HasVFP bool // Vector floating point support + HasEDSP bool // DSP Extensions support + HasJAVA bool // Java instruction set + HasIWMMXT bool // Intel Wireless MMX technology support + HasCRUNCH bool // MaverickCrunch context switching and handling + HasTHUMBEE bool // Thumb EE instruction set + HasNEON bool // NEON instruction set + HasVFPv3 bool // Vector floating point version 3 support + HasVFPv3D16 bool // Vector floating point version 3 D8-D15 + HasTLS bool // Thread local storage support + HasVFPv4 bool // Vector floating point version 4 support + HasIDIVA bool // Integer divide instruction support in ARM mode + HasIDIVT bool // Integer divide instruction support in Thumb mode + HasVFPD32 bool // Vector floating point version 3 D15-D31 + HasLPAE bool // Large Physical Address Extensions + HasEVTSTRM bool // Event stream support + HasAES bool // AES hardware implementation + HasPMULL bool // Polynomial multiplication instruction set + HasSHA1 bool // SHA1 hardware implementation + HasSHA2 bool // SHA2 hardware implementation + HasCRC32 bool // CRC32 hardware implementation + _ CacheLinePad +} + +// PPC64 contains the supported CPU features of the current ppc64/ppc64le platforms. +// If the current platform is not ppc64/ppc64le then all feature flags are false. +// +// For ppc64/ppc64le, it is safe to check only for ISA level starting on ISA v3.00, +// since there are no optional categories. There are some exceptions that also +// require kernel support to work (DARN, SCV), so there are feature bits for +// those as well. The minimum processor requirement is POWER8 (ISA 2.07). +// The struct is padded to avoid false sharing. +var PPC64 struct { + _ CacheLinePad + HasDARN bool // Hardware random number generator (requires kernel enablement) + HasSCV bool // Syscall vectored (requires kernel enablement) + IsPOWER8 bool // ISA v2.07 (POWER8) + IsPOWER9 bool // ISA v3.00 (POWER9) + _ CacheLinePad +} + +// S390X contains the supported CPU features of the current IBM Z +// (s390x) platform. If the current platform is not IBM Z then all +// feature flags are false. +// +// S390X is padded to avoid false sharing. Further HasVX is only set +// if the OS supports vector registers in addition to the STFLE +// feature bit being set. +var S390X struct { + _ CacheLinePad + HasZARCH bool // z/Architecture mode is active [mandatory] + HasSTFLE bool // store facility list extended + HasLDISP bool // long (20-bit) displacements + HasEIMM bool // 32-bit immediates + HasDFP bool // decimal floating point + HasETF3EH bool // ETF-3 enhanced + HasMSA bool // message security assist (CPACF) + HasAES bool // KM-AES{128,192,256} functions + HasAESCBC bool // KMC-AES{128,192,256} functions + HasAESCTR bool // KMCTR-AES{128,192,256} functions + HasAESGCM bool // KMA-GCM-AES{128,192,256} functions + HasGHASH bool // KIMD-GHASH function + HasSHA1 bool // K{I,L}MD-SHA-1 functions + HasSHA256 bool // K{I,L}MD-SHA-256 functions + HasSHA512 bool // K{I,L}MD-SHA-512 functions + HasSHA3 bool // K{I,L}MD-SHA3-{224,256,384,512} and K{I,L}MD-SHAKE-{128,256} functions + HasVX bool // vector facility + HasVXE bool // vector-enhancements facility 1 + _ CacheLinePad +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_aix_ppc64.go b/vendor/golang.org/x/sys/cpu/cpu_aix_ppc64.go new file mode 100644 index 0000000..be60272 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_aix_ppc64.go @@ -0,0 +1,34 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build aix,ppc64 + +package cpu + +const cacheLineSize = 128 + +const ( + // getsystemcfg constants + _SC_IMPL = 2 + _IMPL_POWER8 = 0x10000 + _IMPL_POWER9 = 0x20000 +) + +func init() { + impl := getsystemcfg(_SC_IMPL) + if impl&_IMPL_POWER8 != 0 { + PPC64.IsPOWER8 = true + } + if impl&_IMPL_POWER9 != 0 { + PPC64.IsPOWER9 = true + } + + Initialized = true +} + +func getsystemcfg(label int) (n uint64) { + r0, _ := callgetsystemcfg(label) + n = uint64(r0) + return +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_arm.go b/vendor/golang.org/x/sys/cpu/cpu_arm.go new file mode 100644 index 0000000..981af68 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_arm.go @@ -0,0 +1,40 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cpu + +const cacheLineSize = 32 + +// HWCAP/HWCAP2 bits. +// These are specific to Linux. +const ( + hwcap_SWP = 1 << 0 + hwcap_HALF = 1 << 1 + hwcap_THUMB = 1 << 2 + hwcap_26BIT = 1 << 3 + hwcap_FAST_MULT = 1 << 4 + hwcap_FPA = 1 << 5 + hwcap_VFP = 1 << 6 + hwcap_EDSP = 1 << 7 + hwcap_JAVA = 1 << 8 + hwcap_IWMMXT = 1 << 9 + hwcap_CRUNCH = 1 << 10 + hwcap_THUMBEE = 1 << 11 + hwcap_NEON = 1 << 12 + hwcap_VFPv3 = 1 << 13 + hwcap_VFPv3D16 = 1 << 14 + hwcap_TLS = 1 << 15 + hwcap_VFPv4 = 1 << 16 + hwcap_IDIVA = 1 << 17 + hwcap_IDIVT = 1 << 18 + hwcap_VFPD32 = 1 << 19 + hwcap_LPAE = 1 << 20 + hwcap_EVTSTRM = 1 << 21 + + hwcap2_AES = 1 << 0 + hwcap2_PMULL = 1 << 1 + hwcap2_SHA1 = 1 << 2 + hwcap2_SHA2 = 1 << 3 + hwcap2_CRC32 = 1 << 4 +) diff --git a/vendor/golang.org/x/sys/cpu/cpu_gc_s390x.go b/vendor/golang.org/x/sys/cpu/cpu_gc_s390x.go new file mode 100644 index 0000000..568bcd0 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_gc_s390x.go @@ -0,0 +1,21 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build !gccgo + +package cpu + +// haveAsmFunctions reports whether the other functions in this file can +// be safely called. +func haveAsmFunctions() bool { return true } + +// The following feature detection functions are defined in cpu_s390x.s. +// They are likely to be expensive to call so the results should be cached. +func stfle() facilityList +func kmQuery() queryResult +func kmcQuery() queryResult +func kmctrQuery() queryResult +func kmaQuery() queryResult +func kimdQuery() queryResult +func klmdQuery() queryResult diff --git a/vendor/golang.org/x/sys/cpu/cpu_gc_x86.go b/vendor/golang.org/x/sys/cpu/cpu_gc_x86.go new file mode 100644 index 0000000..f7cb469 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_gc_x86.go @@ -0,0 +1,16 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build 386 amd64 amd64p32 +// +build !gccgo + +package cpu + +// cpuid is implemented in cpu_x86.s for gc compiler +// and in cpu_gccgo.c for gccgo. +func cpuid(eaxArg, ecxArg uint32) (eax, ebx, ecx, edx uint32) + +// xgetbv with ecx = 0 is implemented in cpu_x86.s for gc compiler +// and in cpu_gccgo.c for gccgo. +func xgetbv() (eax, edx uint32) diff --git a/vendor/golang.org/x/sys/cpu/cpu_gccgo.c b/vendor/golang.org/x/sys/cpu/cpu_gccgo.c new file mode 100644 index 0000000..e363c7d --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_gccgo.c @@ -0,0 +1,43 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build 386 amd64 amd64p32 +// +build gccgo + +#include +#include + +// Need to wrap __get_cpuid_count because it's declared as static. +int +gccgoGetCpuidCount(uint32_t leaf, uint32_t subleaf, + uint32_t *eax, uint32_t *ebx, + uint32_t *ecx, uint32_t *edx) +{ + return __get_cpuid_count(leaf, subleaf, eax, ebx, ecx, edx); +} + +// xgetbv reads the contents of an XCR (Extended Control Register) +// specified in the ECX register into registers EDX:EAX. +// Currently, the only supported value for XCR is 0. +// +// TODO: Replace with a better alternative: +// +// #include +// +// #pragma GCC target("xsave") +// +// void gccgoXgetbv(uint32_t *eax, uint32_t *edx) { +// unsigned long long x = _xgetbv(0); +// *eax = x & 0xffffffff; +// *edx = (x >> 32) & 0xffffffff; +// } +// +// Note that _xgetbv is defined starting with GCC 8. +void +gccgoXgetbv(uint32_t *eax, uint32_t *edx) +{ + __asm(" xorl %%ecx, %%ecx\n" + " xgetbv" + : "=a"(*eax), "=d"(*edx)); +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_gccgo.go b/vendor/golang.org/x/sys/cpu/cpu_gccgo.go new file mode 100644 index 0000000..ba49b91 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_gccgo.go @@ -0,0 +1,26 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build 386 amd64 amd64p32 +// +build gccgo + +package cpu + +//extern gccgoGetCpuidCount +func gccgoGetCpuidCount(eaxArg, ecxArg uint32, eax, ebx, ecx, edx *uint32) + +func cpuid(eaxArg, ecxArg uint32) (eax, ebx, ecx, edx uint32) { + var a, b, c, d uint32 + gccgoGetCpuidCount(eaxArg, ecxArg, &a, &b, &c, &d) + return a, b, c, d +} + +//extern gccgoXgetbv +func gccgoXgetbv(eax, edx *uint32) + +func xgetbv() (eax, edx uint32) { + var a, d uint32 + gccgoXgetbv(&a, &d) + return a, d +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_gccgo_s390x.go b/vendor/golang.org/x/sys/cpu/cpu_gccgo_s390x.go new file mode 100644 index 0000000..aa986f7 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_gccgo_s390x.go @@ -0,0 +1,22 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build gccgo + +package cpu + +// haveAsmFunctions reports whether the other functions in this file can +// be safely called. +func haveAsmFunctions() bool { return false } + +// TODO(mundaym): the following feature detection functions are currently +// stubs. See https://golang.org/cl/162887 for how to fix this. +// They are likely to be expensive to call so the results should be cached. +func stfle() facilityList { panic("not implemented for gccgo") } +func kmQuery() queryResult { panic("not implemented for gccgo") } +func kmcQuery() queryResult { panic("not implemented for gccgo") } +func kmctrQuery() queryResult { panic("not implemented for gccgo") } +func kmaQuery() queryResult { panic("not implemented for gccgo") } +func kimdQuery() queryResult { panic("not implemented for gccgo") } +func klmdQuery() queryResult { panic("not implemented for gccgo") } diff --git a/vendor/golang.org/x/sys/cpu/cpu_linux.go b/vendor/golang.org/x/sys/cpu/cpu_linux.go new file mode 100644 index 0000000..10e712d --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_linux.go @@ -0,0 +1,59 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build !amd64,!amd64p32,!386 + +package cpu + +import ( + "io/ioutil" +) + +const ( + _AT_HWCAP = 16 + _AT_HWCAP2 = 26 + + procAuxv = "/proc/self/auxv" + + uintSize = int(32 << (^uint(0) >> 63)) +) + +// For those platforms don't have a 'cpuid' equivalent we use HWCAP/HWCAP2 +// These are initialized in cpu_$GOARCH.go +// and should not be changed after they are initialized. +var hwCap uint +var hwCap2 uint + +func init() { + buf, err := ioutil.ReadFile(procAuxv) + if err != nil { + // e.g. on android /proc/self/auxv is not accessible, so silently + // ignore the error and leave Initialized = false + return + } + + bo := hostByteOrder() + for len(buf) >= 2*(uintSize/8) { + var tag, val uint + switch uintSize { + case 32: + tag = uint(bo.Uint32(buf[0:])) + val = uint(bo.Uint32(buf[4:])) + buf = buf[8:] + case 64: + tag = uint(bo.Uint64(buf[0:])) + val = uint(bo.Uint64(buf[8:])) + buf = buf[16:] + } + switch tag { + case _AT_HWCAP: + hwCap = val + case _AT_HWCAP2: + hwCap2 = val + } + } + doinit() + + Initialized = true +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_linux_arm.go b/vendor/golang.org/x/sys/cpu/cpu_linux_arm.go new file mode 100644 index 0000000..2057006 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_linux_arm.go @@ -0,0 +1,39 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cpu + +func doinit() { + ARM.HasSWP = isSet(hwCap, hwcap_SWP) + ARM.HasHALF = isSet(hwCap, hwcap_HALF) + ARM.HasTHUMB = isSet(hwCap, hwcap_THUMB) + ARM.Has26BIT = isSet(hwCap, hwcap_26BIT) + ARM.HasFASTMUL = isSet(hwCap, hwcap_FAST_MULT) + ARM.HasFPA = isSet(hwCap, hwcap_FPA) + ARM.HasVFP = isSet(hwCap, hwcap_VFP) + ARM.HasEDSP = isSet(hwCap, hwcap_EDSP) + ARM.HasJAVA = isSet(hwCap, hwcap_JAVA) + ARM.HasIWMMXT = isSet(hwCap, hwcap_IWMMXT) + ARM.HasCRUNCH = isSet(hwCap, hwcap_CRUNCH) + ARM.HasTHUMBEE = isSet(hwCap, hwcap_THUMBEE) + ARM.HasNEON = isSet(hwCap, hwcap_NEON) + ARM.HasVFPv3 = isSet(hwCap, hwcap_VFPv3) + ARM.HasVFPv3D16 = isSet(hwCap, hwcap_VFPv3D16) + ARM.HasTLS = isSet(hwCap, hwcap_TLS) + ARM.HasVFPv4 = isSet(hwCap, hwcap_VFPv4) + ARM.HasIDIVA = isSet(hwCap, hwcap_IDIVA) + ARM.HasIDIVT = isSet(hwCap, hwcap_IDIVT) + ARM.HasVFPD32 = isSet(hwCap, hwcap_VFPD32) + ARM.HasLPAE = isSet(hwCap, hwcap_LPAE) + ARM.HasEVTSTRM = isSet(hwCap, hwcap_EVTSTRM) + ARM.HasAES = isSet(hwCap2, hwcap2_AES) + ARM.HasPMULL = isSet(hwCap2, hwcap2_PMULL) + ARM.HasSHA1 = isSet(hwCap2, hwcap2_SHA1) + ARM.HasSHA2 = isSet(hwCap2, hwcap2_SHA2) + ARM.HasCRC32 = isSet(hwCap2, hwcap2_CRC32) +} + +func isSet(hwc uint, value uint) bool { + return hwc&value != 0 +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_linux_arm64.go b/vendor/golang.org/x/sys/cpu/cpu_linux_arm64.go new file mode 100644 index 0000000..fa7fb1b --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_linux_arm64.go @@ -0,0 +1,67 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cpu + +const cacheLineSize = 64 + +// HWCAP/HWCAP2 bits. These are exposed by Linux. +const ( + hwcap_FP = 1 << 0 + hwcap_ASIMD = 1 << 1 + hwcap_EVTSTRM = 1 << 2 + hwcap_AES = 1 << 3 + hwcap_PMULL = 1 << 4 + hwcap_SHA1 = 1 << 5 + hwcap_SHA2 = 1 << 6 + hwcap_CRC32 = 1 << 7 + hwcap_ATOMICS = 1 << 8 + hwcap_FPHP = 1 << 9 + hwcap_ASIMDHP = 1 << 10 + hwcap_CPUID = 1 << 11 + hwcap_ASIMDRDM = 1 << 12 + hwcap_JSCVT = 1 << 13 + hwcap_FCMA = 1 << 14 + hwcap_LRCPC = 1 << 15 + hwcap_DCPOP = 1 << 16 + hwcap_SHA3 = 1 << 17 + hwcap_SM3 = 1 << 18 + hwcap_SM4 = 1 << 19 + hwcap_ASIMDDP = 1 << 20 + hwcap_SHA512 = 1 << 21 + hwcap_SVE = 1 << 22 + hwcap_ASIMDFHM = 1 << 23 +) + +func doinit() { + // HWCAP feature bits + ARM64.HasFP = isSet(hwCap, hwcap_FP) + ARM64.HasASIMD = isSet(hwCap, hwcap_ASIMD) + ARM64.HasEVTSTRM = isSet(hwCap, hwcap_EVTSTRM) + ARM64.HasAES = isSet(hwCap, hwcap_AES) + ARM64.HasPMULL = isSet(hwCap, hwcap_PMULL) + ARM64.HasSHA1 = isSet(hwCap, hwcap_SHA1) + ARM64.HasSHA2 = isSet(hwCap, hwcap_SHA2) + ARM64.HasCRC32 = isSet(hwCap, hwcap_CRC32) + ARM64.HasATOMICS = isSet(hwCap, hwcap_ATOMICS) + ARM64.HasFPHP = isSet(hwCap, hwcap_FPHP) + ARM64.HasASIMDHP = isSet(hwCap, hwcap_ASIMDHP) + ARM64.HasCPUID = isSet(hwCap, hwcap_CPUID) + ARM64.HasASIMDRDM = isSet(hwCap, hwcap_ASIMDRDM) + ARM64.HasJSCVT = isSet(hwCap, hwcap_JSCVT) + ARM64.HasFCMA = isSet(hwCap, hwcap_FCMA) + ARM64.HasLRCPC = isSet(hwCap, hwcap_LRCPC) + ARM64.HasDCPOP = isSet(hwCap, hwcap_DCPOP) + ARM64.HasSHA3 = isSet(hwCap, hwcap_SHA3) + ARM64.HasSM3 = isSet(hwCap, hwcap_SM3) + ARM64.HasSM4 = isSet(hwCap, hwcap_SM4) + ARM64.HasASIMDDP = isSet(hwCap, hwcap_ASIMDDP) + ARM64.HasSHA512 = isSet(hwCap, hwcap_SHA512) + ARM64.HasSVE = isSet(hwCap, hwcap_SVE) + ARM64.HasASIMDFHM = isSet(hwCap, hwcap_ASIMDFHM) +} + +func isSet(hwc uint, value uint) bool { + return hwc&value != 0 +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_linux_ppc64x.go b/vendor/golang.org/x/sys/cpu/cpu_linux_ppc64x.go new file mode 100644 index 0000000..6c8d975 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_linux_ppc64x.go @@ -0,0 +1,33 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build linux +// +build ppc64 ppc64le + +package cpu + +const cacheLineSize = 128 + +// HWCAP/HWCAP2 bits. These are exposed by the kernel. +const ( + // ISA Level + _PPC_FEATURE2_ARCH_2_07 = 0x80000000 + _PPC_FEATURE2_ARCH_3_00 = 0x00800000 + + // CPU features + _PPC_FEATURE2_DARN = 0x00200000 + _PPC_FEATURE2_SCV = 0x00100000 +) + +func doinit() { + // HWCAP2 feature bits + PPC64.IsPOWER8 = isSet(hwCap2, _PPC_FEATURE2_ARCH_2_07) + PPC64.IsPOWER9 = isSet(hwCap2, _PPC_FEATURE2_ARCH_3_00) + PPC64.HasDARN = isSet(hwCap2, _PPC_FEATURE2_DARN) + PPC64.HasSCV = isSet(hwCap2, _PPC_FEATURE2_SCV) +} + +func isSet(hwc uint, value uint) bool { + return hwc&value != 0 +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_linux_s390x.go b/vendor/golang.org/x/sys/cpu/cpu_linux_s390x.go new file mode 100644 index 0000000..d579eae --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_linux_s390x.go @@ -0,0 +1,161 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cpu + +const cacheLineSize = 256 + +const ( + // bit mask values from /usr/include/bits/hwcap.h + hwcap_ZARCH = 2 + hwcap_STFLE = 4 + hwcap_MSA = 8 + hwcap_LDISP = 16 + hwcap_EIMM = 32 + hwcap_DFP = 64 + hwcap_ETF3EH = 256 + hwcap_VX = 2048 + hwcap_VXE = 8192 +) + +// bitIsSet reports whether the bit at index is set. The bit index +// is in big endian order, so bit index 0 is the leftmost bit. +func bitIsSet(bits []uint64, index uint) bool { + return bits[index/64]&((1<<63)>>(index%64)) != 0 +} + +// function is the code for the named cryptographic function. +type function uint8 + +const ( + // KM{,A,C,CTR} function codes + aes128 function = 18 // AES-128 + aes192 function = 19 // AES-192 + aes256 function = 20 // AES-256 + + // K{I,L}MD function codes + sha1 function = 1 // SHA-1 + sha256 function = 2 // SHA-256 + sha512 function = 3 // SHA-512 + sha3_224 function = 32 // SHA3-224 + sha3_256 function = 33 // SHA3-256 + sha3_384 function = 34 // SHA3-384 + sha3_512 function = 35 // SHA3-512 + shake128 function = 36 // SHAKE-128 + shake256 function = 37 // SHAKE-256 + + // KLMD function codes + ghash function = 65 // GHASH +) + +// queryResult contains the result of a Query function +// call. Bits are numbered in big endian order so the +// leftmost bit (the MSB) is at index 0. +type queryResult struct { + bits [2]uint64 +} + +// Has reports whether the given functions are present. +func (q *queryResult) Has(fns ...function) bool { + if len(fns) == 0 { + panic("no function codes provided") + } + for _, f := range fns { + if !bitIsSet(q.bits[:], uint(f)) { + return false + } + } + return true +} + +// facility is a bit index for the named facility. +type facility uint8 + +const ( + // cryptography facilities + msa4 facility = 77 // message-security-assist extension 4 + msa8 facility = 146 // message-security-assist extension 8 +) + +// facilityList contains the result of an STFLE call. +// Bits are numbered in big endian order so the +// leftmost bit (the MSB) is at index 0. +type facilityList struct { + bits [4]uint64 +} + +// Has reports whether the given facilities are present. +func (s *facilityList) Has(fs ...facility) bool { + if len(fs) == 0 { + panic("no facility bits provided") + } + for _, f := range fs { + if !bitIsSet(s.bits[:], uint(f)) { + return false + } + } + return true +} + +func doinit() { + // test HWCAP bit vector + has := func(featureMask uint) bool { + return hwCap&featureMask == featureMask + } + + // mandatory + S390X.HasZARCH = has(hwcap_ZARCH) + + // optional + S390X.HasSTFLE = has(hwcap_STFLE) + S390X.HasLDISP = has(hwcap_LDISP) + S390X.HasEIMM = has(hwcap_EIMM) + S390X.HasETF3EH = has(hwcap_ETF3EH) + S390X.HasDFP = has(hwcap_DFP) + S390X.HasMSA = has(hwcap_MSA) + S390X.HasVX = has(hwcap_VX) + if S390X.HasVX { + S390X.HasVXE = has(hwcap_VXE) + } + + // We need implementations of stfle, km and so on + // to detect cryptographic features. + if !haveAsmFunctions() { + return + } + + // optional cryptographic functions + if S390X.HasMSA { + aes := []function{aes128, aes192, aes256} + + // cipher message + km, kmc := kmQuery(), kmcQuery() + S390X.HasAES = km.Has(aes...) + S390X.HasAESCBC = kmc.Has(aes...) + if S390X.HasSTFLE { + facilities := stfle() + if facilities.Has(msa4) { + kmctr := kmctrQuery() + S390X.HasAESCTR = kmctr.Has(aes...) + } + if facilities.Has(msa8) { + kma := kmaQuery() + S390X.HasAESGCM = kma.Has(aes...) + } + } + + // compute message digest + kimd := kimdQuery() // intermediate (no padding) + klmd := klmdQuery() // last (padding) + S390X.HasSHA1 = kimd.Has(sha1) && klmd.Has(sha1) + S390X.HasSHA256 = kimd.Has(sha256) && klmd.Has(sha256) + S390X.HasSHA512 = kimd.Has(sha512) && klmd.Has(sha512) + S390X.HasGHASH = kimd.Has(ghash) // KLMD-GHASH does not exist + sha3 := []function{ + sha3_224, sha3_256, sha3_384, sha3_512, + shake128, shake256, + } + S390X.HasSHA3 = kimd.Has(sha3...) && klmd.Has(sha3...) + } +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_mips64x.go b/vendor/golang.org/x/sys/cpu/cpu_mips64x.go new file mode 100644 index 0000000..f55e0c8 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_mips64x.go @@ -0,0 +1,11 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build mips64 mips64le + +package cpu + +const cacheLineSize = 32 + +func doinit() {} diff --git a/vendor/golang.org/x/sys/cpu/cpu_mipsx.go b/vendor/golang.org/x/sys/cpu/cpu_mipsx.go new file mode 100644 index 0000000..cda87b1 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_mipsx.go @@ -0,0 +1,11 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build mips mipsle + +package cpu + +const cacheLineSize = 32 + +func doinit() {} diff --git a/vendor/golang.org/x/sys/cpu/cpu_other_arm64.go b/vendor/golang.org/x/sys/cpu/cpu_other_arm64.go new file mode 100644 index 0000000..dd1e76d --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_other_arm64.go @@ -0,0 +1,11 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build !linux,arm64 + +package cpu + +const cacheLineSize = 64 + +func doinit() {} diff --git a/vendor/golang.org/x/sys/cpu/cpu_s390x.s b/vendor/golang.org/x/sys/cpu/cpu_s390x.s new file mode 100644 index 0000000..e5037d9 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_s390x.s @@ -0,0 +1,57 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build !gccgo + +#include "textflag.h" + +// func stfle() facilityList +TEXT ·stfle(SB), NOSPLIT|NOFRAME, $0-32 + MOVD $ret+0(FP), R1 + MOVD $3, R0 // last doubleword index to store + XC $32, (R1), (R1) // clear 4 doublewords (32 bytes) + WORD $0xb2b01000 // store facility list extended (STFLE) + RET + +// func kmQuery() queryResult +TEXT ·kmQuery(SB), NOSPLIT|NOFRAME, $0-16 + MOVD $0, R0 // set function code to 0 (KM-Query) + MOVD $ret+0(FP), R1 // address of 16-byte return value + WORD $0xB92E0024 // cipher message (KM) + RET + +// func kmcQuery() queryResult +TEXT ·kmcQuery(SB), NOSPLIT|NOFRAME, $0-16 + MOVD $0, R0 // set function code to 0 (KMC-Query) + MOVD $ret+0(FP), R1 // address of 16-byte return value + WORD $0xB92F0024 // cipher message with chaining (KMC) + RET + +// func kmctrQuery() queryResult +TEXT ·kmctrQuery(SB), NOSPLIT|NOFRAME, $0-16 + MOVD $0, R0 // set function code to 0 (KMCTR-Query) + MOVD $ret+0(FP), R1 // address of 16-byte return value + WORD $0xB92D4024 // cipher message with counter (KMCTR) + RET + +// func kmaQuery() queryResult +TEXT ·kmaQuery(SB), NOSPLIT|NOFRAME, $0-16 + MOVD $0, R0 // set function code to 0 (KMA-Query) + MOVD $ret+0(FP), R1 // address of 16-byte return value + WORD $0xb9296024 // cipher message with authentication (KMA) + RET + +// func kimdQuery() queryResult +TEXT ·kimdQuery(SB), NOSPLIT|NOFRAME, $0-16 + MOVD $0, R0 // set function code to 0 (KIMD-Query) + MOVD $ret+0(FP), R1 // address of 16-byte return value + WORD $0xB93E0024 // compute intermediate message digest (KIMD) + RET + +// func klmdQuery() queryResult +TEXT ·klmdQuery(SB), NOSPLIT|NOFRAME, $0-16 + MOVD $0, R0 // set function code to 0 (KLMD-Query) + MOVD $ret+0(FP), R1 // address of 16-byte return value + WORD $0xB93F0024 // compute last message digest (KLMD) + RET diff --git a/vendor/golang.org/x/sys/cpu/cpu_wasm.go b/vendor/golang.org/x/sys/cpu/cpu_wasm.go new file mode 100644 index 0000000..bd9bbda --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_wasm.go @@ -0,0 +1,15 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build wasm + +package cpu + +// We're compiling the cpu package for an unknown (software-abstracted) CPU. +// Make CacheLinePad an empty struct and hope that the usual struct alignment +// rules are good enough. + +const cacheLineSize = 0 + +func doinit() {} diff --git a/vendor/golang.org/x/sys/cpu/cpu_x86.go b/vendor/golang.org/x/sys/cpu/cpu_x86.go new file mode 100644 index 0000000..d70d317 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_x86.go @@ -0,0 +1,59 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build 386 amd64 amd64p32 + +package cpu + +const cacheLineSize = 64 + +func init() { + Initialized = true + + maxID, _, _, _ := cpuid(0, 0) + + if maxID < 1 { + return + } + + _, _, ecx1, edx1 := cpuid(1, 0) + X86.HasSSE2 = isSet(26, edx1) + + X86.HasSSE3 = isSet(0, ecx1) + X86.HasPCLMULQDQ = isSet(1, ecx1) + X86.HasSSSE3 = isSet(9, ecx1) + X86.HasFMA = isSet(12, ecx1) + X86.HasSSE41 = isSet(19, ecx1) + X86.HasSSE42 = isSet(20, ecx1) + X86.HasPOPCNT = isSet(23, ecx1) + X86.HasAES = isSet(25, ecx1) + X86.HasOSXSAVE = isSet(27, ecx1) + X86.HasRDRAND = isSet(30, ecx1) + + osSupportsAVX := false + // For XGETBV, OSXSAVE bit is required and sufficient. + if X86.HasOSXSAVE { + eax, _ := xgetbv() + // Check if XMM and YMM registers have OS support. + osSupportsAVX = isSet(1, eax) && isSet(2, eax) + } + + X86.HasAVX = isSet(28, ecx1) && osSupportsAVX + + if maxID < 7 { + return + } + + _, ebx7, _, _ := cpuid(7, 0) + X86.HasBMI1 = isSet(3, ebx7) + X86.HasAVX2 = isSet(5, ebx7) && osSupportsAVX + X86.HasBMI2 = isSet(8, ebx7) + X86.HasERMS = isSet(9, ebx7) + X86.HasRDSEED = isSet(18, ebx7) + X86.HasADX = isSet(19, ebx7) +} + +func isSet(bitpos uint, value uint32) bool { + return value&(1< langNoIndexOffset { + return 0, false + } + cci |= CompactCoreInfo(t.LangID) << (8 + 12) + cci |= CompactCoreInfo(t.ScriptID) << 12 + cci |= CompactCoreInfo(t.RegionID) + return cci, true +} + +// Tag generates a tag from c. +func (c CompactCoreInfo) Tag() Tag { + return Tag{ + LangID: Language(c >> 20), + RegionID: Region(c & 0x3ff), + ScriptID: Script(c>>12) & 0xff, + } +} diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go new file mode 100644 index 0000000..1b36935 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/compact.go @@ -0,0 +1,61 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package compact defines a compact representation of language tags. +// +// Common language tags (at least all for which locale information is defined +// in CLDR) are assigned a unique index. Each Tag is associated with such an +// ID for selecting language-related resources (such as translations) as well +// as one for selecting regional defaults (currency, number formatting, etc.) +// +// It may want to export this functionality at some point, but at this point +// this is only available for use within x/text. +package compact // import "golang.org/x/text/internal/language/compact" + +import ( + "sort" + "strings" + + "golang.org/x/text/internal/language" +) + +// ID is an integer identifying a single tag. +type ID uint16 + +func getCoreIndex(t language.Tag) (id ID, ok bool) { + cci, ok := language.GetCompactCore(t) + if !ok { + return 0, false + } + i := sort.Search(len(coreTags), func(i int) bool { + return cci <= coreTags[i] + }) + if i == len(coreTags) || coreTags[i] != cci { + return 0, false + } + return ID(i), true +} + +// Parent returns the ID of the parent or the root ID if id is already the root. +func (id ID) Parent() ID { + return parents[id] +} + +// Tag converts id to an internal language Tag. +func (id ID) Tag() language.Tag { + if int(id) >= len(coreTags) { + return specialTags[int(id)-len(coreTags)] + } + return coreTags[id].Tag() +} + +var specialTags []language.Tag + +func init() { + tags := strings.Split(specialTagsStr, " ") + specialTags = make([]language.Tag, len(tags)) + for i, t := range tags { + specialTags[i] = language.MustParse(t) + } +} diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go new file mode 100644 index 0000000..83816a7 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/language.go @@ -0,0 +1,260 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_index.go -output tables.go +//go:generate go run gen_parents.go + +package compact + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "strings" + + "golang.org/x/text/internal/language" +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. +type Tag struct { + // NOTE: exported tags will become part of the public API. + language ID + locale ID + full fullTag // always a language.Tag for now. +} + +const _und = 0 + +type fullTag interface { + IsRoot() bool + Parent() language.Tag +} + +// Make a compact Tag from a fully specified internal language Tag. +func Make(t language.Tag) (tag Tag) { + if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" { + if r, err := language.ParseRegion(region[:2]); err == nil { + tFull := t + t, _ = t.SetTypeForKey("rg", "") + // TODO: should we not consider "va" for the language tag? + var exact1, exact2 bool + tag.language, exact1 = FromTag(t) + t.RegionID = r + tag.locale, exact2 = FromTag(t) + if !exact1 || !exact2 { + tag.full = tFull + } + return tag + } + } + lang, ok := FromTag(t) + tag.language = lang + tag.locale = lang + if !ok { + tag.full = t + } + return tag +} + +// Tag returns an internal language Tag version of this tag. +func (t Tag) Tag() language.Tag { + if t.full != nil { + return t.full.(language.Tag) + } + tag := t.language.Tag() + if t.language != t.locale { + loc := t.locale.Tag() + tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz") + } + return tag +} + +// IsCompact reports whether this tag is fully defined in terms of ID. +func (t *Tag) IsCompact() bool { + return t.full == nil +} + +// MayHaveVariants reports whether a tag may have variants. If it returns false +// it is guaranteed the tag does not have variants. +func (t Tag) MayHaveVariants() bool { + return t.full != nil || int(t.language) >= len(coreTags) +} + +// MayHaveExtensions reports whether a tag may have extensions. If it returns +// false it is guaranteed the tag does not have them. +func (t Tag) MayHaveExtensions() bool { + return t.full != nil || + int(t.language) >= len(coreTags) || + t.language != t.locale +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if t.full != nil { + return t.full.IsRoot() + } + return t.language == _und +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.full != nil { + return Make(t.full.Parent()) + } + if t.language != t.locale { + // Simulate stripping -u-rg-xxxxxx + return Tag{language: t.language, locale: t.language} + } + // TODO: use parent lookup table once cycle from internal package is + // removed. Probably by internalizing the table and declaring this fast + // enough. + // lang := compactID(internal.Parent(uint16(t.language))) + lang, _ := FromTag(t.language.Tag().Parent()) + return Tag{language: lang, locale: lang} +} + +// returns token t and the rest of the string. +func nextToken(s string) (t, tail string) { + p := strings.Index(s[1:], "-") + if p == -1 { + return s[1:], "" + } + p++ + return s[1:p], s[p:] +} + +// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags +// for which data exists in the text repository.The index will change over time +// and should not be stored in persistent storage. If t does not match a compact +// index, exact will be false and the compact index will be returned for the +// first match after repeatedly taking the Parent of t. +func LanguageID(t Tag) (id ID, exact bool) { + return t.language, t.full == nil +} + +// RegionalID returns the ID for the regional variant of this tag. This index is +// used to indicate region-specific overrides, such as default currency, default +// calendar and week data, default time cycle, and default measurement system +// and unit preferences. +// +// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US +// settings for currency, number formatting, etc. The CompactIndex for this tag +// will be that for en-GB, while the RegionalID will be the one corresponding to +// en-US. +func RegionalID(t Tag) (id ID, exact bool) { + return t.locale, t.full == nil +} + +// LanguageTag returns t stripped of regional variant indicators. +// +// At the moment this means it is stripped of a regional and variant subtag "rg" +// and "va" in the "u" extension. +func (t Tag) LanguageTag() Tag { + if t.full == nil { + return Tag{language: t.language, locale: t.language} + } + tt := t.Tag() + tt.SetTypeForKey("rg", "") + tt.SetTypeForKey("va", "") + return Make(tt) +} + +// RegionalTag returns the regional variant of the tag. +// +// At the moment this means that the region is set from the regional subtag +// "rg" in the "u" extension. +func (t Tag) RegionalTag() Tag { + rt := Tag{language: t.locale, locale: t.locale} + if t.full == nil { + return rt + } + b := language.Builder{} + tag := t.Tag() + // tag, _ = tag.SetTypeForKey("rg", "") + b.SetTag(t.locale.Tag()) + if v := tag.Variants(); v != "" { + for _, v := range strings.Split(v, "-") { + b.AddVariant(v) + } + } + for _, e := range tag.Extensions() { + b.AddExt(e) + } + return t +} + +// FromTag reports closest matching ID for an internal language Tag. +func FromTag(t language.Tag) (id ID, exact bool) { + // TODO: perhaps give more frequent tags a lower index. + // TODO: we could make the indexes stable. This will excluded some + // possibilities for optimization, so don't do this quite yet. + exact = true + + b, s, r := t.Raw() + if t.HasString() { + if t.IsPrivateUse() { + // We have no entries for user-defined tags. + return 0, false + } + hasExtra := false + if t.HasVariants() { + if t.HasExtensions() { + build := language.Builder{} + build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r}) + build.AddVariant(t.Variants()) + exact = false + t = build.Make() + } + hasExtra = true + } else if _, ok := t.Extension('u'); ok { + // TODO: va may mean something else. Consider not considering it. + // Strip all but the 'va' entry. + old := t + variant := t.TypeForKey("va") + t = language.Tag{LangID: b, ScriptID: s, RegionID: r} + if variant != "" { + t, _ = t.SetTypeForKey("va", variant) + hasExtra = true + } + exact = old == t + } else { + exact = false + } + if hasExtra { + // We have some variants. + for i, s := range specialTags { + if s == t { + return ID(i + len(coreTags)), exact + } + } + exact = false + } + } + if x, ok := getCoreIndex(t); ok { + return x, exact + } + exact = false + if r != 0 && s == 0 { + // Deal with cases where an extra script is inserted for the region. + t, _ := t.Maximize() + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + for t = t.Parent(); t != root; t = t.Parent() { + // No variants specified: just compare core components. + // The key has the form lllssrrr, where l, s, and r are nibbles for + // respectively the langID, scriptID, and regionID. + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + return 0, exact +} + +var root = language.Tag{} diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go new file mode 100644 index 0000000..8d81072 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/parents.go @@ -0,0 +1,120 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +// parents maps a compact index of a tag to the compact index of the parent of +// this tag. +var parents = []ID{ // 775 elements + // Entry 0 - 3F + 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006, + 0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000, + 0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000, + 0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000, + 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e, + // Entry 40 - 7F + 0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046, + 0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000, + 0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000, + 0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d, + 0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066, + 0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b, + 0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000, + 0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e, + // Entry 80 - BF + 0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086, + // Entry C0 - FF + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087, + 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000, + 0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1, + // Entry 100 - 13F + 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e, + 0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000, + 0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e, + 0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + // Entry 140 - 17F + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156, + 0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c, + 0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000, + 0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000, + 0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176, + 0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e, + // Entry 180 - 1BF + 0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184, + 0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e, + 0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000, + 0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000, + 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000, + 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000, + 0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6, + 0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000, + // Entry 1C0 - 1FF + 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000, + 0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb, + 0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000, + 0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000, + 0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6, + 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee, + 0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5, + 0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000, + // Entry 200 - 23F + 0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000, + 0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000, + 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000, + 0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226, + 0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000, + 0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236, + 0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244, + // Entry 240 - 27F + 0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000, + 0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000, + 0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254, + 0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000, + 0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000, + 0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e, + 0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273, + 0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000, + // Entry 280 - 2BF + 0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286, + 0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000, + 0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295, + 0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d, + 0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000, + 0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae, + 0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5, + 0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000, + // Entry 2C0 - 2FF + 0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000, + 0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd, + 0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000, + 0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000, + 0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6, + 0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000, + 0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000, + 0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000, + // Entry 300 - 33F + 0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6, +} // Size: 1574 bytes + +// Total table size 1574 bytes (1KiB); checksum: 895AAF0B diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go new file mode 100644 index 0000000..554ca35 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -0,0 +1,1015 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +import "golang.org/x/text/internal/language" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +// NumCompactTags is the number of common tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = 775 +const ( + undIndex ID = 0 + afIndex ID = 1 + afNAIndex ID = 2 + afZAIndex ID = 3 + agqIndex ID = 4 + agqCMIndex ID = 5 + akIndex ID = 6 + akGHIndex ID = 7 + amIndex ID = 8 + amETIndex ID = 9 + arIndex ID = 10 + ar001Index ID = 11 + arAEIndex ID = 12 + arBHIndex ID = 13 + arDJIndex ID = 14 + arDZIndex ID = 15 + arEGIndex ID = 16 + arEHIndex ID = 17 + arERIndex ID = 18 + arILIndex ID = 19 + arIQIndex ID = 20 + arJOIndex ID = 21 + arKMIndex ID = 22 + arKWIndex ID = 23 + arLBIndex ID = 24 + arLYIndex ID = 25 + arMAIndex ID = 26 + arMRIndex ID = 27 + arOMIndex ID = 28 + arPSIndex ID = 29 + arQAIndex ID = 30 + arSAIndex ID = 31 + arSDIndex ID = 32 + arSOIndex ID = 33 + arSSIndex ID = 34 + arSYIndex ID = 35 + arTDIndex ID = 36 + arTNIndex ID = 37 + arYEIndex ID = 38 + arsIndex ID = 39 + asIndex ID = 40 + asINIndex ID = 41 + asaIndex ID = 42 + asaTZIndex ID = 43 + astIndex ID = 44 + astESIndex ID = 45 + azIndex ID = 46 + azCyrlIndex ID = 47 + azCyrlAZIndex ID = 48 + azLatnIndex ID = 49 + azLatnAZIndex ID = 50 + basIndex ID = 51 + basCMIndex ID = 52 + beIndex ID = 53 + beBYIndex ID = 54 + bemIndex ID = 55 + bemZMIndex ID = 56 + bezIndex ID = 57 + bezTZIndex ID = 58 + bgIndex ID = 59 + bgBGIndex ID = 60 + bhIndex ID = 61 + bmIndex ID = 62 + bmMLIndex ID = 63 + bnIndex ID = 64 + bnBDIndex ID = 65 + bnINIndex ID = 66 + boIndex ID = 67 + boCNIndex ID = 68 + boINIndex ID = 69 + brIndex ID = 70 + brFRIndex ID = 71 + brxIndex ID = 72 + brxINIndex ID = 73 + bsIndex ID = 74 + bsCyrlIndex ID = 75 + bsCyrlBAIndex ID = 76 + bsLatnIndex ID = 77 + bsLatnBAIndex ID = 78 + caIndex ID = 79 + caADIndex ID = 80 + caESIndex ID = 81 + caFRIndex ID = 82 + caITIndex ID = 83 + ccpIndex ID = 84 + ccpBDIndex ID = 85 + ccpINIndex ID = 86 + ceIndex ID = 87 + ceRUIndex ID = 88 + cggIndex ID = 89 + cggUGIndex ID = 90 + chrIndex ID = 91 + chrUSIndex ID = 92 + ckbIndex ID = 93 + ckbIQIndex ID = 94 + ckbIRIndex ID = 95 + csIndex ID = 96 + csCZIndex ID = 97 + cuIndex ID = 98 + cuRUIndex ID = 99 + cyIndex ID = 100 + cyGBIndex ID = 101 + daIndex ID = 102 + daDKIndex ID = 103 + daGLIndex ID = 104 + davIndex ID = 105 + davKEIndex ID = 106 + deIndex ID = 107 + deATIndex ID = 108 + deBEIndex ID = 109 + deCHIndex ID = 110 + deDEIndex ID = 111 + deITIndex ID = 112 + deLIIndex ID = 113 + deLUIndex ID = 114 + djeIndex ID = 115 + djeNEIndex ID = 116 + dsbIndex ID = 117 + dsbDEIndex ID = 118 + duaIndex ID = 119 + duaCMIndex ID = 120 + dvIndex ID = 121 + dyoIndex ID = 122 + dyoSNIndex ID = 123 + dzIndex ID = 124 + dzBTIndex ID = 125 + ebuIndex ID = 126 + ebuKEIndex ID = 127 + eeIndex ID = 128 + eeGHIndex ID = 129 + eeTGIndex ID = 130 + elIndex ID = 131 + elCYIndex ID = 132 + elGRIndex ID = 133 + enIndex ID = 134 + en001Index ID = 135 + en150Index ID = 136 + enAGIndex ID = 137 + enAIIndex ID = 138 + enASIndex ID = 139 + enATIndex ID = 140 + enAUIndex ID = 141 + enBBIndex ID = 142 + enBEIndex ID = 143 + enBIIndex ID = 144 + enBMIndex ID = 145 + enBSIndex ID = 146 + enBWIndex ID = 147 + enBZIndex ID = 148 + enCAIndex ID = 149 + enCCIndex ID = 150 + enCHIndex ID = 151 + enCKIndex ID = 152 + enCMIndex ID = 153 + enCXIndex ID = 154 + enCYIndex ID = 155 + enDEIndex ID = 156 + enDGIndex ID = 157 + enDKIndex ID = 158 + enDMIndex ID = 159 + enERIndex ID = 160 + enFIIndex ID = 161 + enFJIndex ID = 162 + enFKIndex ID = 163 + enFMIndex ID = 164 + enGBIndex ID = 165 + enGDIndex ID = 166 + enGGIndex ID = 167 + enGHIndex ID = 168 + enGIIndex ID = 169 + enGMIndex ID = 170 + enGUIndex ID = 171 + enGYIndex ID = 172 + enHKIndex ID = 173 + enIEIndex ID = 174 + enILIndex ID = 175 + enIMIndex ID = 176 + enINIndex ID = 177 + enIOIndex ID = 178 + enJEIndex ID = 179 + enJMIndex ID = 180 + enKEIndex ID = 181 + enKIIndex ID = 182 + enKNIndex ID = 183 + enKYIndex ID = 184 + enLCIndex ID = 185 + enLRIndex ID = 186 + enLSIndex ID = 187 + enMGIndex ID = 188 + enMHIndex ID = 189 + enMOIndex ID = 190 + enMPIndex ID = 191 + enMSIndex ID = 192 + enMTIndex ID = 193 + enMUIndex ID = 194 + enMWIndex ID = 195 + enMYIndex ID = 196 + enNAIndex ID = 197 + enNFIndex ID = 198 + enNGIndex ID = 199 + enNLIndex ID = 200 + enNRIndex ID = 201 + enNUIndex ID = 202 + enNZIndex ID = 203 + enPGIndex ID = 204 + enPHIndex ID = 205 + enPKIndex ID = 206 + enPNIndex ID = 207 + enPRIndex ID = 208 + enPWIndex ID = 209 + enRWIndex ID = 210 + enSBIndex ID = 211 + enSCIndex ID = 212 + enSDIndex ID = 213 + enSEIndex ID = 214 + enSGIndex ID = 215 + enSHIndex ID = 216 + enSIIndex ID = 217 + enSLIndex ID = 218 + enSSIndex ID = 219 + enSXIndex ID = 220 + enSZIndex ID = 221 + enTCIndex ID = 222 + enTKIndex ID = 223 + enTOIndex ID = 224 + enTTIndex ID = 225 + enTVIndex ID = 226 + enTZIndex ID = 227 + enUGIndex ID = 228 + enUMIndex ID = 229 + enUSIndex ID = 230 + enVCIndex ID = 231 + enVGIndex ID = 232 + enVIIndex ID = 233 + enVUIndex ID = 234 + enWSIndex ID = 235 + enZAIndex ID = 236 + enZMIndex ID = 237 + enZWIndex ID = 238 + eoIndex ID = 239 + eo001Index ID = 240 + esIndex ID = 241 + es419Index ID = 242 + esARIndex ID = 243 + esBOIndex ID = 244 + esBRIndex ID = 245 + esBZIndex ID = 246 + esCLIndex ID = 247 + esCOIndex ID = 248 + esCRIndex ID = 249 + esCUIndex ID = 250 + esDOIndex ID = 251 + esEAIndex ID = 252 + esECIndex ID = 253 + esESIndex ID = 254 + esGQIndex ID = 255 + esGTIndex ID = 256 + esHNIndex ID = 257 + esICIndex ID = 258 + esMXIndex ID = 259 + esNIIndex ID = 260 + esPAIndex ID = 261 + esPEIndex ID = 262 + esPHIndex ID = 263 + esPRIndex ID = 264 + esPYIndex ID = 265 + esSVIndex ID = 266 + esUSIndex ID = 267 + esUYIndex ID = 268 + esVEIndex ID = 269 + etIndex ID = 270 + etEEIndex ID = 271 + euIndex ID = 272 + euESIndex ID = 273 + ewoIndex ID = 274 + ewoCMIndex ID = 275 + faIndex ID = 276 + faAFIndex ID = 277 + faIRIndex ID = 278 + ffIndex ID = 279 + ffCMIndex ID = 280 + ffGNIndex ID = 281 + ffMRIndex ID = 282 + ffSNIndex ID = 283 + fiIndex ID = 284 + fiFIIndex ID = 285 + filIndex ID = 286 + filPHIndex ID = 287 + foIndex ID = 288 + foDKIndex ID = 289 + foFOIndex ID = 290 + frIndex ID = 291 + frBEIndex ID = 292 + frBFIndex ID = 293 + frBIIndex ID = 294 + frBJIndex ID = 295 + frBLIndex ID = 296 + frCAIndex ID = 297 + frCDIndex ID = 298 + frCFIndex ID = 299 + frCGIndex ID = 300 + frCHIndex ID = 301 + frCIIndex ID = 302 + frCMIndex ID = 303 + frDJIndex ID = 304 + frDZIndex ID = 305 + frFRIndex ID = 306 + frGAIndex ID = 307 + frGFIndex ID = 308 + frGNIndex ID = 309 + frGPIndex ID = 310 + frGQIndex ID = 311 + frHTIndex ID = 312 + frKMIndex ID = 313 + frLUIndex ID = 314 + frMAIndex ID = 315 + frMCIndex ID = 316 + frMFIndex ID = 317 + frMGIndex ID = 318 + frMLIndex ID = 319 + frMQIndex ID = 320 + frMRIndex ID = 321 + frMUIndex ID = 322 + frNCIndex ID = 323 + frNEIndex ID = 324 + frPFIndex ID = 325 + frPMIndex ID = 326 + frREIndex ID = 327 + frRWIndex ID = 328 + frSCIndex ID = 329 + frSNIndex ID = 330 + frSYIndex ID = 331 + frTDIndex ID = 332 + frTGIndex ID = 333 + frTNIndex ID = 334 + frVUIndex ID = 335 + frWFIndex ID = 336 + frYTIndex ID = 337 + furIndex ID = 338 + furITIndex ID = 339 + fyIndex ID = 340 + fyNLIndex ID = 341 + gaIndex ID = 342 + gaIEIndex ID = 343 + gdIndex ID = 344 + gdGBIndex ID = 345 + glIndex ID = 346 + glESIndex ID = 347 + gswIndex ID = 348 + gswCHIndex ID = 349 + gswFRIndex ID = 350 + gswLIIndex ID = 351 + guIndex ID = 352 + guINIndex ID = 353 + guwIndex ID = 354 + guzIndex ID = 355 + guzKEIndex ID = 356 + gvIndex ID = 357 + gvIMIndex ID = 358 + haIndex ID = 359 + haGHIndex ID = 360 + haNEIndex ID = 361 + haNGIndex ID = 362 + hawIndex ID = 363 + hawUSIndex ID = 364 + heIndex ID = 365 + heILIndex ID = 366 + hiIndex ID = 367 + hiINIndex ID = 368 + hrIndex ID = 369 + hrBAIndex ID = 370 + hrHRIndex ID = 371 + hsbIndex ID = 372 + hsbDEIndex ID = 373 + huIndex ID = 374 + huHUIndex ID = 375 + hyIndex ID = 376 + hyAMIndex ID = 377 + idIndex ID = 378 + idIDIndex ID = 379 + igIndex ID = 380 + igNGIndex ID = 381 + iiIndex ID = 382 + iiCNIndex ID = 383 + inIndex ID = 384 + ioIndex ID = 385 + isIndex ID = 386 + isISIndex ID = 387 + itIndex ID = 388 + itCHIndex ID = 389 + itITIndex ID = 390 + itSMIndex ID = 391 + itVAIndex ID = 392 + iuIndex ID = 393 + iwIndex ID = 394 + jaIndex ID = 395 + jaJPIndex ID = 396 + jboIndex ID = 397 + jgoIndex ID = 398 + jgoCMIndex ID = 399 + jiIndex ID = 400 + jmcIndex ID = 401 + jmcTZIndex ID = 402 + jvIndex ID = 403 + jwIndex ID = 404 + kaIndex ID = 405 + kaGEIndex ID = 406 + kabIndex ID = 407 + kabDZIndex ID = 408 + kajIndex ID = 409 + kamIndex ID = 410 + kamKEIndex ID = 411 + kcgIndex ID = 412 + kdeIndex ID = 413 + kdeTZIndex ID = 414 + keaIndex ID = 415 + keaCVIndex ID = 416 + khqIndex ID = 417 + khqMLIndex ID = 418 + kiIndex ID = 419 + kiKEIndex ID = 420 + kkIndex ID = 421 + kkKZIndex ID = 422 + kkjIndex ID = 423 + kkjCMIndex ID = 424 + klIndex ID = 425 + klGLIndex ID = 426 + klnIndex ID = 427 + klnKEIndex ID = 428 + kmIndex ID = 429 + kmKHIndex ID = 430 + knIndex ID = 431 + knINIndex ID = 432 + koIndex ID = 433 + koKPIndex ID = 434 + koKRIndex ID = 435 + kokIndex ID = 436 + kokINIndex ID = 437 + ksIndex ID = 438 + ksINIndex ID = 439 + ksbIndex ID = 440 + ksbTZIndex ID = 441 + ksfIndex ID = 442 + ksfCMIndex ID = 443 + kshIndex ID = 444 + kshDEIndex ID = 445 + kuIndex ID = 446 + kwIndex ID = 447 + kwGBIndex ID = 448 + kyIndex ID = 449 + kyKGIndex ID = 450 + lagIndex ID = 451 + lagTZIndex ID = 452 + lbIndex ID = 453 + lbLUIndex ID = 454 + lgIndex ID = 455 + lgUGIndex ID = 456 + lktIndex ID = 457 + lktUSIndex ID = 458 + lnIndex ID = 459 + lnAOIndex ID = 460 + lnCDIndex ID = 461 + lnCFIndex ID = 462 + lnCGIndex ID = 463 + loIndex ID = 464 + loLAIndex ID = 465 + lrcIndex ID = 466 + lrcIQIndex ID = 467 + lrcIRIndex ID = 468 + ltIndex ID = 469 + ltLTIndex ID = 470 + luIndex ID = 471 + luCDIndex ID = 472 + luoIndex ID = 473 + luoKEIndex ID = 474 + luyIndex ID = 475 + luyKEIndex ID = 476 + lvIndex ID = 477 + lvLVIndex ID = 478 + masIndex ID = 479 + masKEIndex ID = 480 + masTZIndex ID = 481 + merIndex ID = 482 + merKEIndex ID = 483 + mfeIndex ID = 484 + mfeMUIndex ID = 485 + mgIndex ID = 486 + mgMGIndex ID = 487 + mghIndex ID = 488 + mghMZIndex ID = 489 + mgoIndex ID = 490 + mgoCMIndex ID = 491 + mkIndex ID = 492 + mkMKIndex ID = 493 + mlIndex ID = 494 + mlINIndex ID = 495 + mnIndex ID = 496 + mnMNIndex ID = 497 + moIndex ID = 498 + mrIndex ID = 499 + mrINIndex ID = 500 + msIndex ID = 501 + msBNIndex ID = 502 + msMYIndex ID = 503 + msSGIndex ID = 504 + mtIndex ID = 505 + mtMTIndex ID = 506 + muaIndex ID = 507 + muaCMIndex ID = 508 + myIndex ID = 509 + myMMIndex ID = 510 + mznIndex ID = 511 + mznIRIndex ID = 512 + nahIndex ID = 513 + naqIndex ID = 514 + naqNAIndex ID = 515 + nbIndex ID = 516 + nbNOIndex ID = 517 + nbSJIndex ID = 518 + ndIndex ID = 519 + ndZWIndex ID = 520 + ndsIndex ID = 521 + ndsDEIndex ID = 522 + ndsNLIndex ID = 523 + neIndex ID = 524 + neINIndex ID = 525 + neNPIndex ID = 526 + nlIndex ID = 527 + nlAWIndex ID = 528 + nlBEIndex ID = 529 + nlBQIndex ID = 530 + nlCWIndex ID = 531 + nlNLIndex ID = 532 + nlSRIndex ID = 533 + nlSXIndex ID = 534 + nmgIndex ID = 535 + nmgCMIndex ID = 536 + nnIndex ID = 537 + nnNOIndex ID = 538 + nnhIndex ID = 539 + nnhCMIndex ID = 540 + noIndex ID = 541 + nqoIndex ID = 542 + nrIndex ID = 543 + nsoIndex ID = 544 + nusIndex ID = 545 + nusSSIndex ID = 546 + nyIndex ID = 547 + nynIndex ID = 548 + nynUGIndex ID = 549 + omIndex ID = 550 + omETIndex ID = 551 + omKEIndex ID = 552 + orIndex ID = 553 + orINIndex ID = 554 + osIndex ID = 555 + osGEIndex ID = 556 + osRUIndex ID = 557 + paIndex ID = 558 + paArabIndex ID = 559 + paArabPKIndex ID = 560 + paGuruIndex ID = 561 + paGuruINIndex ID = 562 + papIndex ID = 563 + plIndex ID = 564 + plPLIndex ID = 565 + prgIndex ID = 566 + prg001Index ID = 567 + psIndex ID = 568 + psAFIndex ID = 569 + ptIndex ID = 570 + ptAOIndex ID = 571 + ptBRIndex ID = 572 + ptCHIndex ID = 573 + ptCVIndex ID = 574 + ptGQIndex ID = 575 + ptGWIndex ID = 576 + ptLUIndex ID = 577 + ptMOIndex ID = 578 + ptMZIndex ID = 579 + ptPTIndex ID = 580 + ptSTIndex ID = 581 + ptTLIndex ID = 582 + quIndex ID = 583 + quBOIndex ID = 584 + quECIndex ID = 585 + quPEIndex ID = 586 + rmIndex ID = 587 + rmCHIndex ID = 588 + rnIndex ID = 589 + rnBIIndex ID = 590 + roIndex ID = 591 + roMDIndex ID = 592 + roROIndex ID = 593 + rofIndex ID = 594 + rofTZIndex ID = 595 + ruIndex ID = 596 + ruBYIndex ID = 597 + ruKGIndex ID = 598 + ruKZIndex ID = 599 + ruMDIndex ID = 600 + ruRUIndex ID = 601 + ruUAIndex ID = 602 + rwIndex ID = 603 + rwRWIndex ID = 604 + rwkIndex ID = 605 + rwkTZIndex ID = 606 + sahIndex ID = 607 + sahRUIndex ID = 608 + saqIndex ID = 609 + saqKEIndex ID = 610 + sbpIndex ID = 611 + sbpTZIndex ID = 612 + sdIndex ID = 613 + sdPKIndex ID = 614 + sdhIndex ID = 615 + seIndex ID = 616 + seFIIndex ID = 617 + seNOIndex ID = 618 + seSEIndex ID = 619 + sehIndex ID = 620 + sehMZIndex ID = 621 + sesIndex ID = 622 + sesMLIndex ID = 623 + sgIndex ID = 624 + sgCFIndex ID = 625 + shIndex ID = 626 + shiIndex ID = 627 + shiLatnIndex ID = 628 + shiLatnMAIndex ID = 629 + shiTfngIndex ID = 630 + shiTfngMAIndex ID = 631 + siIndex ID = 632 + siLKIndex ID = 633 + skIndex ID = 634 + skSKIndex ID = 635 + slIndex ID = 636 + slSIIndex ID = 637 + smaIndex ID = 638 + smiIndex ID = 639 + smjIndex ID = 640 + smnIndex ID = 641 + smnFIIndex ID = 642 + smsIndex ID = 643 + snIndex ID = 644 + snZWIndex ID = 645 + soIndex ID = 646 + soDJIndex ID = 647 + soETIndex ID = 648 + soKEIndex ID = 649 + soSOIndex ID = 650 + sqIndex ID = 651 + sqALIndex ID = 652 + sqMKIndex ID = 653 + sqXKIndex ID = 654 + srIndex ID = 655 + srCyrlIndex ID = 656 + srCyrlBAIndex ID = 657 + srCyrlMEIndex ID = 658 + srCyrlRSIndex ID = 659 + srCyrlXKIndex ID = 660 + srLatnIndex ID = 661 + srLatnBAIndex ID = 662 + srLatnMEIndex ID = 663 + srLatnRSIndex ID = 664 + srLatnXKIndex ID = 665 + ssIndex ID = 666 + ssyIndex ID = 667 + stIndex ID = 668 + svIndex ID = 669 + svAXIndex ID = 670 + svFIIndex ID = 671 + svSEIndex ID = 672 + swIndex ID = 673 + swCDIndex ID = 674 + swKEIndex ID = 675 + swTZIndex ID = 676 + swUGIndex ID = 677 + syrIndex ID = 678 + taIndex ID = 679 + taINIndex ID = 680 + taLKIndex ID = 681 + taMYIndex ID = 682 + taSGIndex ID = 683 + teIndex ID = 684 + teINIndex ID = 685 + teoIndex ID = 686 + teoKEIndex ID = 687 + teoUGIndex ID = 688 + tgIndex ID = 689 + tgTJIndex ID = 690 + thIndex ID = 691 + thTHIndex ID = 692 + tiIndex ID = 693 + tiERIndex ID = 694 + tiETIndex ID = 695 + tigIndex ID = 696 + tkIndex ID = 697 + tkTMIndex ID = 698 + tlIndex ID = 699 + tnIndex ID = 700 + toIndex ID = 701 + toTOIndex ID = 702 + trIndex ID = 703 + trCYIndex ID = 704 + trTRIndex ID = 705 + tsIndex ID = 706 + ttIndex ID = 707 + ttRUIndex ID = 708 + twqIndex ID = 709 + twqNEIndex ID = 710 + tzmIndex ID = 711 + tzmMAIndex ID = 712 + ugIndex ID = 713 + ugCNIndex ID = 714 + ukIndex ID = 715 + ukUAIndex ID = 716 + urIndex ID = 717 + urINIndex ID = 718 + urPKIndex ID = 719 + uzIndex ID = 720 + uzArabIndex ID = 721 + uzArabAFIndex ID = 722 + uzCyrlIndex ID = 723 + uzCyrlUZIndex ID = 724 + uzLatnIndex ID = 725 + uzLatnUZIndex ID = 726 + vaiIndex ID = 727 + vaiLatnIndex ID = 728 + vaiLatnLRIndex ID = 729 + vaiVaiiIndex ID = 730 + vaiVaiiLRIndex ID = 731 + veIndex ID = 732 + viIndex ID = 733 + viVNIndex ID = 734 + voIndex ID = 735 + vo001Index ID = 736 + vunIndex ID = 737 + vunTZIndex ID = 738 + waIndex ID = 739 + waeIndex ID = 740 + waeCHIndex ID = 741 + woIndex ID = 742 + woSNIndex ID = 743 + xhIndex ID = 744 + xogIndex ID = 745 + xogUGIndex ID = 746 + yavIndex ID = 747 + yavCMIndex ID = 748 + yiIndex ID = 749 + yi001Index ID = 750 + yoIndex ID = 751 + yoBJIndex ID = 752 + yoNGIndex ID = 753 + yueIndex ID = 754 + yueHansIndex ID = 755 + yueHansCNIndex ID = 756 + yueHantIndex ID = 757 + yueHantHKIndex ID = 758 + zghIndex ID = 759 + zghMAIndex ID = 760 + zhIndex ID = 761 + zhHansIndex ID = 762 + zhHansCNIndex ID = 763 + zhHansHKIndex ID = 764 + zhHansMOIndex ID = 765 + zhHansSGIndex ID = 766 + zhHantIndex ID = 767 + zhHantHKIndex ID = 768 + zhHantMOIndex ID = 769 + zhHantTWIndex ID = 770 + zuIndex ID = 771 + zuZAIndex ID = 772 + caESvalenciaIndex ID = 773 + enUSuvaposixIndex ID = 774 +) + +var coreTags = []language.CompactCoreInfo{ // 773 elements + // Entry 0 - 1F + 0x00000000, 0x01600000, 0x016000d2, 0x01600161, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100080, + 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067, + 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097, + 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac, + 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9, + 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108, + // Entry 20 - 3F + 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c, + 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000, + 0x04300000, 0x04300099, 0x04400000, 0x0440012f, + 0x04800000, 0x0480006e, 0x05800000, 0x0581f000, + 0x0581f032, 0x05857000, 0x05857032, 0x05e00000, + 0x05e00052, 0x07100000, 0x07100047, 0x07500000, + 0x07500162, 0x07900000, 0x0790012f, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3, + // Entry 40 - 5F + 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000, + 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078, + 0x0b500000, 0x0b500099, 0x0b700000, 0x0b71f000, + 0x0b71f033, 0x0b757000, 0x0b757033, 0x0d700000, + 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e, + 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000, + 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000, + 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c, + // Entry 60 - 7F + 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106, + 0x10000000, 0x1000007b, 0x10100000, 0x10100063, + 0x10100082, 0x10800000, 0x108000a4, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060, + 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000, + 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00114, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4, + // Entry 80 - 9F + 0x13000000, 0x13000080, 0x13000122, 0x13600000, + 0x1360005d, 0x13600087, 0x13900000, 0x13900001, + 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, + 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, + 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, + 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, + 0x13900050, 0x13900052, 0x1390005c, 0x1390005d, + 0x13900060, 0x13900061, 0x13900063, 0x13900064, + // Entry A0 - BF + 0x1390006d, 0x13900072, 0x13900073, 0x13900074, + 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f, + 0x13900080, 0x13900081, 0x13900083, 0x1390008a, + 0x1390008c, 0x1390008d, 0x13900096, 0x13900097, + 0x13900098, 0x13900099, 0x1390009a, 0x1390009f, + 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9, + 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5, + 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7, + // Entry C0 - DF + 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce, + 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6, + 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0, + 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb, + 0x139000ec, 0x139000f0, 0x13900107, 0x13900109, + 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d, + 0x1390010e, 0x1390010f, 0x13900112, 0x13900117, + 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125, + // Entry E0 - FF + 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f, + 0x13900131, 0x13900133, 0x13900135, 0x13900139, + 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142, + 0x13900161, 0x13900162, 0x13900164, 0x13c00000, + 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, + 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, + 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065, + 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086, + // Entry 100 - 11F + 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf, + 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7, + 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135, + 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a, + 0x14500000, 0x1450006e, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009c, 0x14e00000, + 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114, + 0x15100000, 0x15100072, 0x15300000, 0x153000e7, + // Entry 120 - 13F + 0x15800000, 0x15800063, 0x15800076, 0x15e00000, + 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, + 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, + 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, + 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a, + 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086, + 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba, + 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3, + // Entry 140 - 15F + 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3, + 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102, + 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c, + 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f, + 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e, + 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096, + 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e, + 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2, + // Entry 160 - 17F + 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000, + 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000, + 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000, + 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000, + 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090, + 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095, + 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053, + // Entry 180 - 19F + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d, + 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113, + 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a2, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007d, 0x21200000, + 0x21200067, 0x21600000, 0x21700000, 0x217000a4, + 0x21f00000, 0x22300000, 0x2230012f, 0x22700000, + // Entry 1A0 - 1BF + 0x2270005a, 0x23400000, 0x234000c3, 0x23900000, + 0x239000a4, 0x24200000, 0x242000ae, 0x24400000, + 0x24400052, 0x24500000, 0x24500082, 0x24600000, + 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000, + 0x25100099, 0x25400000, 0x254000aa, 0x254000ab, + 0x25600000, 0x25600099, 0x26a00000, 0x26a00099, + 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00060, 0x27400000, 0x28100000, + // Entry 1C0 - 1DF + 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000, + 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000, + 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000, + 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, + 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b, + 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000, + 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000, + // Entry 1E0 - 1FF + 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4, + 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf, + 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099, + 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000, + 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0, + 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000, + 0x32500052, 0x33100000, 0x331000c4, 0x33a00000, + // Entry 200 - 21F + 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2, + 0x34700000, 0x347000da, 0x34700110, 0x34e00000, + 0x34e00164, 0x35000000, 0x35000060, 0x350000d9, + 0x35100000, 0x35100099, 0x351000db, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005b, + 0x367000d9, 0x36700116, 0x3670011b, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000, + 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, + // Entry 220 - 23F + 0x37a00000, 0x38000000, 0x38000117, 0x38700000, + 0x38900000, 0x38900131, 0x39000000, 0x3900006f, + 0x390000a4, 0x39500000, 0x39500099, 0x39800000, + 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000, + 0x39d050e8, 0x39d33000, 0x39d33099, 0x3a100000, + 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001, + 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, + 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086, + // Entry 240 - 25F + 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1, + 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000, + 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000, + 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, + 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f, + 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae, + 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000, + 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000, + // Entry 260 - 27F + 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000, + 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000, + 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c, + 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3, + 0x40200000, 0x4020004c, 0x40700000, 0x40800000, + 0x40857000, 0x408570ba, 0x408dc000, 0x408dc0ba, + 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111, + 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000, + // Entry 280 - 29F + 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000, + 0x42300000, 0x42300164, 0x42900000, 0x42900062, + 0x4290006f, 0x429000a4, 0x42900115, 0x43100000, + 0x43100027, 0x431000c2, 0x4310014d, 0x43200000, + 0x4321f000, 0x4321f033, 0x4321f0bd, 0x4321f105, + 0x4321f14d, 0x43257000, 0x43257033, 0x432570bd, + 0x43257105, 0x4325714d, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400072, + // Entry 2A0 - 2BF + 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4, + 0x4450012f, 0x44500131, 0x44e00000, 0x45000000, + 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d, + 0x46100000, 0x46100099, 0x46400000, 0x464000a4, + 0x46400131, 0x46700000, 0x46700124, 0x46b00000, + 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f, + 0x47100000, 0x47600000, 0x47600127, 0x47a00000, + 0x48000000, 0x48200000, 0x48200129, 0x48a00000, + // Entry 2C0 - 2DF + 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000, + 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000, + 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8, + 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc1f000, + 0x4bc1f137, 0x4bc57000, 0x4bc57137, 0x4be00000, + 0x4be57000, 0x4be570b4, 0x4bee3000, 0x4bee30b4, + 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000, + // Entry 2E0 - 2FF + 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114, + 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000, + 0x50900052, 0x51200000, 0x51200001, 0x51800000, + 0x5180003b, 0x518000d6, 0x51f00000, 0x51f38000, + 0x51f38053, 0x51f39000, 0x51f3908d, 0x52800000, + 0x528000ba, 0x52900000, 0x52938000, 0x52938053, + 0x5293808d, 0x529380c6, 0x5293810d, 0x52939000, + // Entry 300 - 31F + 0x5293908d, 0x529390c6, 0x5293912e, 0x52f00000, + 0x52f00161, +} // Size: 3116 bytes + +const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" + +// Total table size 3147 bytes (3KiB); checksum: F4E57D15 diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go new file mode 100644 index 0000000..ca135d2 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/tags.go @@ -0,0 +1,91 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package compact + +var ( + und = Tag{} + + Und Tag = Tag{} + + Afrikaans Tag = Tag{language: afIndex, locale: afIndex} + Amharic Tag = Tag{language: amIndex, locale: amIndex} + Arabic Tag = Tag{language: arIndex, locale: arIndex} + ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index} + Azerbaijani Tag = Tag{language: azIndex, locale: azIndex} + Bulgarian Tag = Tag{language: bgIndex, locale: bgIndex} + Bengali Tag = Tag{language: bnIndex, locale: bnIndex} + Catalan Tag = Tag{language: caIndex, locale: caIndex} + Czech Tag = Tag{language: csIndex, locale: csIndex} + Danish Tag = Tag{language: daIndex, locale: daIndex} + German Tag = Tag{language: deIndex, locale: deIndex} + Greek Tag = Tag{language: elIndex, locale: elIndex} + English Tag = Tag{language: enIndex, locale: enIndex} + AmericanEnglish Tag = Tag{language: enUSIndex, locale: enUSIndex} + BritishEnglish Tag = Tag{language: enGBIndex, locale: enGBIndex} + Spanish Tag = Tag{language: esIndex, locale: esIndex} + EuropeanSpanish Tag = Tag{language: esESIndex, locale: esESIndex} + LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index} + Estonian Tag = Tag{language: etIndex, locale: etIndex} + Persian Tag = Tag{language: faIndex, locale: faIndex} + Finnish Tag = Tag{language: fiIndex, locale: fiIndex} + Filipino Tag = Tag{language: filIndex, locale: filIndex} + French Tag = Tag{language: frIndex, locale: frIndex} + CanadianFrench Tag = Tag{language: frCAIndex, locale: frCAIndex} + Gujarati Tag = Tag{language: guIndex, locale: guIndex} + Hebrew Tag = Tag{language: heIndex, locale: heIndex} + Hindi Tag = Tag{language: hiIndex, locale: hiIndex} + Croatian Tag = Tag{language: hrIndex, locale: hrIndex} + Hungarian Tag = Tag{language: huIndex, locale: huIndex} + Armenian Tag = Tag{language: hyIndex, locale: hyIndex} + Indonesian Tag = Tag{language: idIndex, locale: idIndex} + Icelandic Tag = Tag{language: isIndex, locale: isIndex} + Italian Tag = Tag{language: itIndex, locale: itIndex} + Japanese Tag = Tag{language: jaIndex, locale: jaIndex} + Georgian Tag = Tag{language: kaIndex, locale: kaIndex} + Kazakh Tag = Tag{language: kkIndex, locale: kkIndex} + Khmer Tag = Tag{language: kmIndex, locale: kmIndex} + Kannada Tag = Tag{language: knIndex, locale: knIndex} + Korean Tag = Tag{language: koIndex, locale: koIndex} + Kirghiz Tag = Tag{language: kyIndex, locale: kyIndex} + Lao Tag = Tag{language: loIndex, locale: loIndex} + Lithuanian Tag = Tag{language: ltIndex, locale: ltIndex} + Latvian Tag = Tag{language: lvIndex, locale: lvIndex} + Macedonian Tag = Tag{language: mkIndex, locale: mkIndex} + Malayalam Tag = Tag{language: mlIndex, locale: mlIndex} + Mongolian Tag = Tag{language: mnIndex, locale: mnIndex} + Marathi Tag = Tag{language: mrIndex, locale: mrIndex} + Malay Tag = Tag{language: msIndex, locale: msIndex} + Burmese Tag = Tag{language: myIndex, locale: myIndex} + Nepali Tag = Tag{language: neIndex, locale: neIndex} + Dutch Tag = Tag{language: nlIndex, locale: nlIndex} + Norwegian Tag = Tag{language: noIndex, locale: noIndex} + Punjabi Tag = Tag{language: paIndex, locale: paIndex} + Polish Tag = Tag{language: plIndex, locale: plIndex} + Portuguese Tag = Tag{language: ptIndex, locale: ptIndex} + BrazilianPortuguese Tag = Tag{language: ptBRIndex, locale: ptBRIndex} + EuropeanPortuguese Tag = Tag{language: ptPTIndex, locale: ptPTIndex} + Romanian Tag = Tag{language: roIndex, locale: roIndex} + Russian Tag = Tag{language: ruIndex, locale: ruIndex} + Sinhala Tag = Tag{language: siIndex, locale: siIndex} + Slovak Tag = Tag{language: skIndex, locale: skIndex} + Slovenian Tag = Tag{language: slIndex, locale: slIndex} + Albanian Tag = Tag{language: sqIndex, locale: sqIndex} + Serbian Tag = Tag{language: srIndex, locale: srIndex} + SerbianLatin Tag = Tag{language: srLatnIndex, locale: srLatnIndex} + Swedish Tag = Tag{language: svIndex, locale: svIndex} + Swahili Tag = Tag{language: swIndex, locale: swIndex} + Tamil Tag = Tag{language: taIndex, locale: taIndex} + Telugu Tag = Tag{language: teIndex, locale: teIndex} + Thai Tag = Tag{language: thIndex, locale: thIndex} + Turkish Tag = Tag{language: trIndex, locale: trIndex} + Ukrainian Tag = Tag{language: ukIndex, locale: ukIndex} + Urdu Tag = Tag{language: urIndex, locale: urIndex} + Uzbek Tag = Tag{language: uzIndex, locale: uzIndex} + Vietnamese Tag = Tag{language: viIndex, locale: viIndex} + Chinese Tag = Tag{language: zhIndex, locale: zhIndex} + SimplifiedChinese Tag = Tag{language: zhHansIndex, locale: zhHansIndex} + TraditionalChinese Tag = Tag{language: zhHantIndex, locale: zhHantIndex} + Zulu Tag = Tag{language: zuIndex, locale: zuIndex} +) diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go new file mode 100644 index 0000000..4ae78e0 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compose.go @@ -0,0 +1,167 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "sort" + "strings" +) + +// A Builder allows constructing a Tag from individual components. +// Its main user is Compose in the top-level language package. +type Builder struct { + Tag Tag + + private string // the x extension + variants []string + extensions []string +} + +// Make returns a new Tag from the current settings. +func (b *Builder) Make() Tag { + t := b.Tag + + if len(b.extensions) > 0 || len(b.variants) > 0 { + sort.Sort(sortVariants(b.variants)) + sort.Strings(b.extensions) + + if b.private != "" { + b.extensions = append(b.extensions, b.private) + } + n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...) + buf := make([]byte, n) + p := t.genCoreBytes(buf) + t.pVariant = byte(p) + p += appendTokens(buf[p:], b.variants...) + t.pExt = uint16(p) + p += appendTokens(buf[p:], b.extensions...) + t.str = string(buf[:p]) + // We may not always need to remake the string, but when or when not + // to do so is rather tricky. + scan := makeScanner(buf[:p]) + t, _ = parse(&scan, "") + return t + + } else if b.private != "" { + t.str = b.private + t.RemakeString() + } + return t +} + +// SetTag copies all the settings from a given Tag. Any previously set values +// are discarded. +func (b *Builder) SetTag(t Tag) { + b.Tag.LangID = t.LangID + b.Tag.RegionID = t.RegionID + b.Tag.ScriptID = t.ScriptID + // TODO: optimize + b.variants = b.variants[:0] + if variants := t.Variants(); variants != "" { + for _, vr := range strings.Split(variants[1:], "-") { + b.variants = append(b.variants, vr) + } + } + b.extensions, b.private = b.extensions[:0], "" + for _, e := range t.Extensions() { + b.AddExt(e) + } +} + +// AddExt adds extension e to the tag. e must be a valid extension as returned +// by Tag.Extension. If the extension already exists, it will be discarded, +// except for a -u extension, where non-existing key-type pairs will added. +func (b *Builder) AddExt(e string) { + if e[0] == 'x' { + if b.private == "" { + b.private = e + } + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] += e[1:] + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// SetExt sets the extension e to the tag. e must be a valid extension as +// returned by Tag.Extension. If the extension already exists, it will be +// overwritten, except for a -u extension, where the individual key-type pairs +// will be set. +func (b *Builder) SetExt(e string) { + if e[0] == 'x' { + b.private = e + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] = e + s[1:] + } else { + b.extensions[i] = e + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// AddVariant adds any number of variants. +func (b *Builder) AddVariant(v ...string) { + for _, v := range v { + if v != "" { + b.variants = append(b.variants, v) + } + } +} + +// ClearVariants removes any variants previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearVariants() { + b.variants = b.variants[:0] +} + +// ClearExtensions removes any extensions previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearExtensions() { + b.private = "" + b.extensions = b.extensions[:0] +} + +func tokenLen(token ...string) (n int) { + for _, t := range token { + n += len(t) + 1 + } + return +} + +func appendTokens(b []byte, token ...string) int { + p := 0 + for _, t := range token { + b[p] = '-' + copy(b[p+1:], t) + p += 1 + len(t) + } + return p +} + +type sortVariants []string + +func (s sortVariants) Len() int { + return len(s) +} + +func (s sortVariants) Swap(i, j int) { + s[j], s[i] = s[i], s[j] +} + +func (s sortVariants) Less(i, j int) bool { + return variantIndex[s[i]] < variantIndex[s[j]] +} diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go new file mode 100644 index 0000000..9b20b88 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/coverage.go @@ -0,0 +1,28 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// BaseLanguages returns the list of all supported base languages. It generates +// the list by traversing the internal structures. +func BaseLanguages() []Language { + base := make([]Language, 0, NumLanguages) + for i := 0; i < langNoIndexOffset; i++ { + // We included "und" already for the value 0. + if i != nonCanonicalUnd { + base = append(base, Language(i)) + } + } + i := langNoIndexOffset + for _, v := range langNoIndex { + for k := 0; k < 8; k++ { + if v&1 == 1 { + base = append(base, Language(i)) + } + v >>= 1 + i++ + } + } + return base +} diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go new file mode 100644 index 0000000..1e74d1a --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/language.go @@ -0,0 +1,596 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_common.go -output tables.go + +package language // import "golang.org/x/text/internal/language" + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "errors" + "fmt" + "strings" +) + +const ( + // maxCoreSize is the maximum size of a BCP 47 tag without variants and + // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes. + maxCoreSize = 12 + + // max99thPercentileSize is a somewhat arbitrary buffer size that presumably + // is large enough to hold at least 99% of the BCP 47 tags. + max99thPercentileSize = 32 + + // maxSimpleUExtensionSize is the maximum size of a -u extension with one + // key-type pair. Equals len("-u-") + key (2) + dash + max value (8). + maxSimpleUExtensionSize = 14 +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. The zero value of Tag is Und. +type Tag struct { + // TODO: the following fields have the form TagTypeID. This name is chosen + // to allow refactoring the public package without conflicting with its + // Base, Script, and Region methods. Once the transition is fully completed + // the ID can be stripped from the name. + + LangID Language + RegionID Region + // TODO: we will soon run out of positions for ScriptID. Idea: instead of + // storing lang, region, and ScriptID codes, store only the compact index and + // have a lookup table from this code to its expansion. This greatly speeds + // up table lookup, speed up common variant cases. + // This will also immediately free up 3 extra bytes. Also, the pVariant + // field can now be moved to the lookup table, as the compact index uniquely + // determines the offset of a possible variant. + ScriptID Script + pVariant byte // offset in str, includes preceding '-' + pExt uint16 // offset of first extension, includes preceding '-' + + // str is the string representation of the Tag. It will only be used if the + // tag has variants or extensions. + str string +} + +// Make is a convenience wrapper for Parse that omits the error. +// In case of an error, a sensible default is returned. +func Make(s string) Tag { + t, _ := Parse(s) + return t +} + +// Raw returns the raw base language, script and region, without making an +// attempt to infer their values. +// TODO: consider removing +func (t Tag) Raw() (b Language, s Script, r Region) { + return t.LangID, t.ScriptID, t.RegionID +} + +// equalTags compares language, script and region subtags only. +func (t Tag) equalTags(a Tag) bool { + return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if int(t.pVariant) < len(t.str) { + return false + } + return t.equalTags(Und) +} + +// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use +// tag. +func (t Tag) IsPrivateUse() bool { + return t.str != "" && t.pVariant == 0 +} + +// RemakeString is used to update t.str in case lang, script or region changed. +// It is assumed that pExt and pVariant still point to the start of the +// respective parts. +func (t *Tag) RemakeString() { + if t.str == "" { + return + } + extra := t.str[t.pVariant:] + if t.pVariant > 0 { + extra = extra[1:] + } + if t.equalTags(Und) && strings.HasPrefix(extra, "x-") { + t.str = extra + t.pVariant = 0 + t.pExt = 0 + return + } + var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases. + b := buf[:t.genCoreBytes(buf[:])] + if extra != "" { + diff := len(b) - int(t.pVariant) + b = append(b, '-') + b = append(b, extra...) + t.pVariant = uint8(int(t.pVariant) + diff) + t.pExt = uint16(int(t.pExt) + diff) + } else { + t.pVariant = uint8(len(b)) + t.pExt = uint16(len(b)) + } + t.str = string(b) +} + +// genCoreBytes writes a string for the base languages, script and region tags +// to the given buffer and returns the number of bytes written. It will never +// write more than maxCoreSize bytes. +func (t *Tag) genCoreBytes(buf []byte) int { + n := t.LangID.StringToBuf(buf[:]) + if t.ScriptID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.ScriptID.String()) + } + if t.RegionID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.RegionID.String()) + } + return n +} + +// String returns the canonical string representation of the language tag. +func (t Tag) String() string { + if t.str != "" { + return t.str + } + if t.ScriptID == 0 && t.RegionID == 0 { + return t.LangID.String() + } + buf := [maxCoreSize]byte{} + return string(buf[:t.genCoreBytes(buf[:])]) +} + +// MarshalText implements encoding.TextMarshaler. +func (t Tag) MarshalText() (text []byte, err error) { + if t.str != "" { + text = append(text, t.str...) + } else if t.ScriptID == 0 && t.RegionID == 0 { + text = append(text, t.LangID.String()...) + } else { + buf := [maxCoreSize]byte{} + text = buf[:t.genCoreBytes(buf[:])] + } + return text, nil +} + +// UnmarshalText implements encoding.TextUnmarshaler. +func (t *Tag) UnmarshalText(text []byte) error { + tag, err := Parse(string(text)) + *t = tag + return err +} + +// Variants returns the part of the tag holding all variants or the empty string +// if there are no variants defined. +func (t Tag) Variants() string { + if t.pVariant == 0 { + return "" + } + return t.str[t.pVariant:t.pExt] +} + +// VariantOrPrivateUseTags returns variants or private use tags. +func (t Tag) VariantOrPrivateUseTags() string { + if t.pExt > 0 { + return t.str[t.pVariant:t.pExt] + } + return t.str[t.pVariant:] +} + +// HasString reports whether this tag defines more than just the raw +// components. +func (t Tag) HasString() bool { + return t.str != "" +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.str != "" { + // Strip the variants and extensions. + b, s, r := t.Raw() + t = Tag{LangID: b, ScriptID: s, RegionID: r} + if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 { + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID == t.ScriptID { + return Tag{LangID: t.LangID} + } + } + return t + } + if t.LangID != 0 { + if t.RegionID != 0 { + maxScript := t.ScriptID + if maxScript == 0 { + max, _ := addTags(t) + maxScript = max.ScriptID + } + + for i := range parents { + if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript { + for _, r := range parents[i].fromRegion { + if Region(r) == t.RegionID { + return Tag{ + LangID: t.LangID, + ScriptID: Script(parents[i].script), + RegionID: Region(parents[i].toRegion), + } + } + } + } + } + + // Strip the script if it is the default one. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != maxScript { + return Tag{LangID: t.LangID, ScriptID: maxScript} + } + return Tag{LangID: t.LangID} + } else if t.ScriptID != 0 { + // The parent for an base-script pair with a non-default script is + // "und" instead of the base language. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != t.ScriptID { + return Und + } + return Tag{LangID: t.LangID} + } + } + return Und +} + +// ParseExtension parses s as an extension and returns it on success. +func ParseExtension(s string) (ext string, err error) { + scan := makeScannerString(s) + var end int + if n := len(scan.token); n != 1 { + return "", ErrSyntax + } + scan.toLower(0, len(scan.b)) + end = parseExtension(&scan) + if end != len(s) { + return "", ErrSyntax + } + return string(scan.b), nil +} + +// HasVariants reports whether t has variants. +func (t Tag) HasVariants() bool { + return uint16(t.pVariant) < t.pExt +} + +// HasExtensions reports whether t has extensions. +func (t Tag) HasExtensions() bool { + return int(t.pExt) < len(t.str) +} + +// Extension returns the extension of type x for tag t. It will return +// false for ok if t does not have the requested extension. The returned +// extension will be invalid in this case. +func (t Tag) Extension(x byte) (ext string, ok bool) { + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + if ext[0] == x { + return ext, true + } + } + return "", false +} + +// Extensions returns all extensions of t. +func (t Tag) Extensions() []string { + e := []string{} + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + e = append(e, ext) + } + return e +} + +// TypeForKey returns the type associated with the given key, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// TypeForKey will traverse the inheritance chain to get the correct value. +func (t Tag) TypeForKey(key string) string { + if start, end, _ := t.findTypeForKey(key); end != start { + return t.str[start:end] + } + return "" +} + +var ( + errPrivateUse = errors.New("cannot set a key on a private use tag") + errInvalidArguments = errors.New("invalid key or type") +) + +// SetTypeForKey returns a new Tag with the key set to type, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// An empty value removes an existing pair with the same key. +func (t Tag) SetTypeForKey(key, value string) (Tag, error) { + if t.IsPrivateUse() { + return t, errPrivateUse + } + if len(key) != 2 { + return t, errInvalidArguments + } + + // Remove the setting if value is "". + if value == "" { + start, end, _ := t.findTypeForKey(key) + if start != end { + // Remove key tag and leading '-'. + start -= 4 + + // Remove a possible empty extension. + if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' { + start -= 2 + } + if start == int(t.pVariant) && end == len(t.str) { + t.str = "" + t.pVariant, t.pExt = 0, 0 + } else { + t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:]) + } + } + return t, nil + } + + if len(value) < 3 || len(value) > 8 { + return t, errInvalidArguments + } + + var ( + buf [maxCoreSize + maxSimpleUExtensionSize]byte + uStart int // start of the -u extension. + ) + + // Generate the tag string if needed. + if t.str == "" { + uStart = t.genCoreBytes(buf[:]) + buf[uStart] = '-' + uStart++ + } + + // Create new key-type pair and parse it to verify. + b := buf[uStart:] + copy(b, "u-") + copy(b[2:], key) + b[4] = '-' + b = b[:5+copy(b[5:], value)] + scan := makeScanner(b) + if parseExtensions(&scan); scan.err != nil { + return t, scan.err + } + + // Assemble the replacement string. + if t.str == "" { + t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1) + t.str = string(buf[:uStart+len(b)]) + } else { + s := t.str + start, end, hasExt := t.findTypeForKey(key) + if start == end { + if hasExt { + b = b[2:] + } + t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:]) + } else { + t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:]) + } + } + return t, nil +} + +// findKeyAndType returns the start and end position for the type corresponding +// to key or the point at which to insert the key-value pair if the type +// wasn't found. The hasExt return value reports whether an -u extension was present. +// Note: the extensions are typically very small and are likely to contain +// only one key-type pair. +func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) { + p := int(t.pExt) + if len(key) != 2 || p == len(t.str) || p == 0 { + return p, p, false + } + s := t.str + + // Find the correct extension. + for p++; s[p] != 'u'; p++ { + if s[p] > 'u' { + p-- + return p, p, false + } + if p = nextExtension(s, p); p == len(s) { + return len(s), len(s), false + } + } + // Proceed to the hyphen following the extension name. + p++ + + // curKey is the key currently being processed. + curKey := "" + + // Iterate over keys until we get the end of a section. + for { + // p points to the hyphen preceding the current token. + if p3 := p + 3; s[p3] == '-' { + // Found a key. + // Check whether we just processed the key that was requested. + if curKey == key { + return start, p, true + } + // Set to the next key and continue scanning type tokens. + curKey = s[p+1 : p3] + if curKey > key { + return p, p, true + } + // Start of the type token sequence. + start = p + 4 + // A type is at least 3 characters long. + p += 7 // 4 + 3 + } else { + // Attribute or type, which is at least 3 characters long. + p += 4 + } + // p points past the third character of a type or attribute. + max := p + 5 // maximum length of token plus hyphen. + if len(s) < max { + max = len(s) + } + for ; p < max && s[p] != '-'; p++ { + } + // Bail if we have exhausted all tokens or if the next token starts + // a new extension. + if p == len(s) || s[p+2] == '-' { + if curKey == key { + return start, p, true + } + return p, p, true + } + } +} + +// ParseBase parses a 2- or 3-letter ISO 639 code. +// It returns a ValueError if s is a well-formed but unknown language identifier +// or another error if another error occurred. +func ParseBase(s string) (Language, error) { + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getLangID(buf[:copy(buf[:], s)]) +} + +// ParseScript parses a 4-letter ISO 15924 code. +// It returns a ValueError if s is a well-formed but unknown script identifier +// or another error if another error occurred. +func ParseScript(s string) (Script, error) { + if len(s) != 4 { + return 0, ErrSyntax + } + var buf [4]byte + return getScriptID(script, buf[:copy(buf[:], s)]) +} + +// EncodeM49 returns the Region for the given UN M.49 code. +// It returns an error if r is not a valid code. +func EncodeM49(r int) (Region, error) { + return getRegionM49(r) +} + +// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. +// It returns a ValueError if s is a well-formed but unknown region identifier +// or another error if another error occurred. +func ParseRegion(s string) (Region, error) { + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getRegionID(buf[:copy(buf[:], s)]) +} + +// IsCountry returns whether this region is a country or autonomous area. This +// includes non-standard definitions from CLDR. +func (r Region) IsCountry() bool { + if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK { + return false + } + return true +} + +// IsGroup returns whether this region defines a collection of regions. This +// includes non-standard definitions from CLDR. +func (r Region) IsGroup() bool { + if r == 0 { + return false + } + return int(regionInclusion[r]) < len(regionContainment) +} + +// Contains returns whether Region c is contained by Region r. It returns true +// if c == r. +func (r Region) Contains(c Region) bool { + if r == c { + return true + } + g := regionInclusion[r] + if g >= nRegionGroups { + return false + } + m := regionContainment[g] + + d := regionInclusion[c] + b := regionInclusionBits[d] + + // A contained country may belong to multiple disjoint groups. Matching any + // of these indicates containment. If the contained region is a group, it + // must strictly be a subset. + if d >= nRegionGroups { + return b&m != 0 + } + return b&^m == 0 +} + +var errNoTLD = errors.New("language: region is not a valid ccTLD") + +// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. +// In all other cases it returns either the region itself or an error. +// +// This method may return an error for a region for which there exists a +// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The +// region will already be canonicalized it was obtained from a Tag that was +// obtained using any of the default methods. +func (r Region) TLD() (Region, error) { + // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the + // difference between ISO 3166-1 and IANA ccTLD. + if r == _GB { + r = _UK + } + if (r.typ() & ccTLD) == 0 { + return 0, errNoTLD + } + return r, nil +} + +// Canonicalize returns the region or a possible replacement if the region is +// deprecated. It will not return a replacement for deprecated regions that +// are split into multiple regions. +func (r Region) Canonicalize() Region { + if cr := normRegion(r); cr != 0 { + return cr + } + return r +} + +// Variant represents a registered variant of a language as defined by BCP 47. +type Variant struct { + ID uint8 + str string +} + +// ParseVariant parses and returns a Variant. An error is returned if s is not +// a valid variant. +func ParseVariant(s string) (Variant, error) { + s = strings.ToLower(s) + if id, ok := variantIndex[s]; ok { + return Variant{id, s}, nil + } + return Variant{}, NewValueError([]byte(s)) +} + +// String returns the string representation of the variant. +func (v Variant) String() string { + return v.str +} diff --git a/vendor/golang.org/x/text/internal/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go new file mode 100644 index 0000000..6294b81 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/lookup.go @@ -0,0 +1,412 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "bytes" + "fmt" + "sort" + "strconv" + + "golang.org/x/text/internal/tag" +) + +// findIndex tries to find the given tag in idx and returns a standardized error +// if it could not be found. +func findIndex(idx tag.Index, key []byte, form string) (index int, err error) { + if !tag.FixCase(form, key) { + return 0, ErrSyntax + } + i := idx.Index(key) + if i == -1 { + return 0, NewValueError(key) + } + return i, nil +} + +func searchUint(imap []uint16, key uint16) int { + return sort.Search(len(imap), func(i int) bool { + return imap[i] >= key + }) +} + +type Language uint16 + +// getLangID returns the langID of s if s is a canonical subtag +// or langUnknown if s is not a canonical subtag. +func getLangID(s []byte) (Language, error) { + if len(s) == 2 { + return getLangISO2(s) + } + return getLangISO3(s) +} + +// TODO language normalization as well as the AliasMaps could be moved to the +// higher level package, but it is a bit tricky to separate the generation. + +func (id Language) Canonicalize() (Language, AliasType) { + return normLang(id) +} + +// mapLang returns the mapped langID of id according to mapping m. +func normLang(id Language) (Language, AliasType) { + k := sort.Search(len(AliasMap), func(i int) bool { + return AliasMap[i].From >= uint16(id) + }) + if k < len(AliasMap) && AliasMap[k].From == uint16(id) { + return Language(AliasMap[k].To), AliasTypes[k] + } + return id, AliasTypeUnknown +} + +// getLangISO2 returns the langID for the given 2-letter ISO language code +// or unknownLang if this does not exist. +func getLangISO2(s []byte) (Language, error) { + if !tag.FixCase("zz", s) { + return 0, ErrSyntax + } + if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 { + return Language(i), nil + } + return 0, NewValueError(s) +} + +const base = 'z' - 'a' + 1 + +func strToInt(s []byte) uint { + v := uint(0) + for i := 0; i < len(s); i++ { + v *= base + v += uint(s[i] - 'a') + } + return v +} + +// converts the given integer to the original ASCII string passed to strToInt. +// len(s) must match the number of characters obtained. +func intToStr(v uint, s []byte) { + for i := len(s) - 1; i >= 0; i-- { + s[i] = byte(v%base) + 'a' + v /= base + } +} + +// getLangISO3 returns the langID for the given 3-letter ISO language code +// or unknownLang if this does not exist. +func getLangISO3(s []byte) (Language, error) { + if tag.FixCase("und", s) { + // first try to match canonical 3-letter entries + for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) { + if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] { + // We treat "und" as special and always translate it to "unspecified". + // Note that ZZ and Zzzz are private use and are not treated as + // unspecified by default. + id := Language(i) + if id == nonCanonicalUnd { + return 0, nil + } + return id, nil + } + } + if i := altLangISO3.Index(s); i != -1 { + return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil + } + n := strToInt(s) + if langNoIndex[n/8]&(1<<(n%8)) != 0 { + return Language(n) + langNoIndexOffset, nil + } + // Check for non-canonical uses of ISO3. + for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) { + if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] { + return Language(i), nil + } + } + return 0, NewValueError(s) + } + return 0, ErrSyntax +} + +// StringToBuf writes the string to b and returns the number of bytes +// written. cap(b) must be >= 3. +func (id Language) StringToBuf(b []byte) int { + if id >= langNoIndexOffset { + intToStr(uint(id)-langNoIndexOffset, b[:3]) + return 3 + } else if id == 0 { + return copy(b, "und") + } + l := lang[id<<2:] + if l[3] == 0 { + return copy(b, l[:3]) + } + return copy(b, l[:2]) +} + +// String returns the BCP 47 representation of the langID. +// Use b as variable name, instead of id, to ensure the variable +// used is consistent with that of Base in which this type is embedded. +func (b Language) String() string { + if b == 0 { + return "und" + } else if b >= langNoIndexOffset { + b -= langNoIndexOffset + buf := [3]byte{} + intToStr(uint(b), buf[:]) + return string(buf[:]) + } + l := lang.Elem(int(b)) + if l[3] == 0 { + return l[:3] + } + return l[:2] +} + +// ISO3 returns the ISO 639-3 language code. +func (b Language) ISO3() string { + if b == 0 || b >= langNoIndexOffset { + return b.String() + } + l := lang.Elem(int(b)) + if l[3] == 0 { + return l[:3] + } else if l[2] == 0 { + return altLangISO3.Elem(int(l[3]))[:3] + } + // This allocation will only happen for 3-letter ISO codes + // that are non-canonical BCP 47 language identifiers. + return l[0:1] + l[2:4] +} + +// IsPrivateUse reports whether this language code is reserved for private use. +func (b Language) IsPrivateUse() bool { + return langPrivateStart <= b && b <= langPrivateEnd +} + +// SuppressScript returns the script marked as SuppressScript in the IANA +// language tag repository, or 0 if there is no such script. +func (b Language) SuppressScript() Script { + if b < langNoIndexOffset { + return Script(suppressScript[b]) + } + return 0 +} + +type Region uint16 + +// getRegionID returns the region id for s if s is a valid 2-letter region code +// or unknownRegion. +func getRegionID(s []byte) (Region, error) { + if len(s) == 3 { + if isAlpha(s[0]) { + return getRegionISO3(s) + } + if i, err := strconv.ParseUint(string(s), 10, 10); err == nil { + return getRegionM49(int(i)) + } + } + return getRegionISO2(s) +} + +// getRegionISO2 returns the regionID for the given 2-letter ISO country code +// or unknownRegion if this does not exist. +func getRegionISO2(s []byte) (Region, error) { + i, err := findIndex(regionISO, s, "ZZ") + if err != nil { + return 0, err + } + return Region(i) + isoRegionOffset, nil +} + +// getRegionISO3 returns the regionID for the given 3-letter ISO country code +// or unknownRegion if this does not exist. +func getRegionISO3(s []byte) (Region, error) { + if tag.FixCase("ZZZ", s) { + for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) { + if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] { + return Region(i) + isoRegionOffset, nil + } + } + for i := 0; i < len(altRegionISO3); i += 3 { + if tag.Compare(altRegionISO3[i:i+3], s) == 0 { + return Region(altRegionIDs[i/3]), nil + } + } + return 0, NewValueError(s) + } + return 0, ErrSyntax +} + +func getRegionM49(n int) (Region, error) { + if 0 < n && n <= 999 { + const ( + searchBits = 7 + regionBits = 9 + regionMask = 1<> searchBits + buf := fromM49[m49Index[idx]:m49Index[idx+1]] + val := uint16(n) << regionBits // we rely on bits shifting out + i := sort.Search(len(buf), func(i int) bool { + return buf[i] >= val + }) + if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val { + return Region(r & regionMask), nil + } + } + var e ValueError + fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n) + return 0, e +} + +// normRegion returns a region if r is deprecated or 0 otherwise. +// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ). +// TODO: consider mapping split up regions to new most populous one (like CLDR). +func normRegion(r Region) Region { + m := regionOldMap + k := sort.Search(len(m), func(i int) bool { + return m[i].From >= uint16(r) + }) + if k < len(m) && m[k].From == uint16(r) { + return Region(m[k].To) + } + return 0 +} + +const ( + iso3166UserAssigned = 1 << iota + ccTLD + bcp47Region +) + +func (r Region) typ() byte { + return regionTypes[r] +} + +// String returns the BCP 47 representation for the region. +// It returns "ZZ" for an unspecified region. +func (r Region) String() string { + if r < isoRegionOffset { + if r == 0 { + return "ZZ" + } + return fmt.Sprintf("%03d", r.M49()) + } + r -= isoRegionOffset + return regionISO.Elem(int(r))[:2] +} + +// ISO3 returns the 3-letter ISO code of r. +// Note that not all regions have a 3-letter ISO code. +// In such cases this method returns "ZZZ". +func (r Region) ISO3() string { + if r < isoRegionOffset { + return "ZZZ" + } + r -= isoRegionOffset + reg := regionISO.Elem(int(r)) + switch reg[2] { + case 0: + return altRegionISO3[reg[3]:][:3] + case ' ': + return "ZZZ" + } + return reg[0:1] + reg[2:4] +} + +// M49 returns the UN M.49 encoding of r, or 0 if this encoding +// is not defined for r. +func (r Region) M49() int { + return int(m49[r]) +} + +// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This +// may include private-use tags that are assigned by CLDR and used in this +// implementation. So IsPrivateUse and IsCountry can be simultaneously true. +func (r Region) IsPrivateUse() bool { + return r.typ()&iso3166UserAssigned != 0 +} + +type Script uint8 + +// getScriptID returns the script id for string s. It assumes that s +// is of the format [A-Z][a-z]{3}. +func getScriptID(idx tag.Index, s []byte) (Script, error) { + i, err := findIndex(idx, s, "Zzzz") + return Script(i), err +} + +// String returns the script code in title case. +// It returns "Zzzz" for an unspecified script. +func (s Script) String() string { + if s == 0 { + return "Zzzz" + } + return script.Elem(int(s)) +} + +// IsPrivateUse reports whether this script code is reserved for private use. +func (s Script) IsPrivateUse() bool { + return _Qaaa <= s && s <= _Qabx +} + +const ( + maxAltTaglen = len("en-US-POSIX") + maxLen = maxAltTaglen +) + +var ( + // grandfatheredMap holds a mapping from legacy and grandfathered tags to + // their base language or index to more elaborate tag. + grandfatheredMap = map[[maxLen]byte]int16{ + [maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban + [maxLen]byte{'i', '-', 'a', 'm', 'i'}: _ami, // i-ami + [maxLen]byte{'i', '-', 'b', 'n', 'n'}: _bnn, // i-bnn + [maxLen]byte{'i', '-', 'h', 'a', 'k'}: _hak, // i-hak + [maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}: _tlh, // i-klingon + [maxLen]byte{'i', '-', 'l', 'u', 'x'}: _lb, // i-lux + [maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}: _nv, // i-navajo + [maxLen]byte{'i', '-', 'p', 'w', 'n'}: _pwn, // i-pwn + [maxLen]byte{'i', '-', 't', 'a', 'o'}: _tao, // i-tao + [maxLen]byte{'i', '-', 't', 'a', 'y'}: _tay, // i-tay + [maxLen]byte{'i', '-', 't', 's', 'u'}: _tsu, // i-tsu + [maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}: _nb, // no-bok + [maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}: _nn, // no-nyn + [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}: _sfb, // sgn-BE-FR + [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}: _vgt, // sgn-BE-NL + [maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}: _sgg, // sgn-CH-DE + [maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}: _cmn, // zh-guoyu + [maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}: _hak, // zh-hakka + [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan + [maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}: _hsn, // zh-xiang + + // Grandfathered tags with no modern replacement will be converted as + // follows: + [maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish + [maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}: -2, // en-GB-oed + [maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}: -3, // i-default + [maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}: -4, // i-enochian + [maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}: -5, // i-mingo + [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}: -6, // zh-min + + // CLDR-specific tag. + [maxLen]byte{'r', 'o', 'o', 't'}: 0, // root + [maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX" + } + + altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102} + + altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix" +) + +func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) { + if v, ok := grandfatheredMap[s]; ok { + if v < 0 { + return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true + } + t.LangID = Language(v) + return t, true + } + return t, false +} diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go new file mode 100644 index 0000000..75a2dbc --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/match.go @@ -0,0 +1,226 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import "errors" + +type scriptRegionFlags uint8 + +const ( + isList = 1 << iota + scriptInFrom + regionInFrom +) + +func (t *Tag) setUndefinedLang(id Language) { + if t.LangID == 0 { + t.LangID = id + } +} + +func (t *Tag) setUndefinedScript(id Script) { + if t.ScriptID == 0 { + t.ScriptID = id + } +} + +func (t *Tag) setUndefinedRegion(id Region) { + if t.RegionID == 0 || t.RegionID.Contains(id) { + t.RegionID = id + } +} + +// ErrMissingLikelyTagsData indicates no information was available +// to compute likely values of missing tags. +var ErrMissingLikelyTagsData = errors.New("missing likely tags data") + +// addLikelySubtags sets subtags to their most likely value, given the locale. +// In most cases this means setting fields for unknown values, but in some +// cases it may alter a value. It returns an ErrMissingLikelyTagsData error +// if the given locale cannot be expanded. +func (t Tag) addLikelySubtags() (Tag, error) { + id, err := addTags(t) + if err != nil { + return t, err + } else if id.equalTags(t) { + return t, nil + } + id.RemakeString() + return id, nil +} + +// specializeRegion attempts to specialize a group region. +func specializeRegion(t *Tag) bool { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID { + t.RegionID = Region(x.region) + } + return true + } + return false +} + +// Maximize returns a new tag with missing tags filled in. +func (t Tag) Maximize() (Tag, error) { + return addTags(t) +} + +func addTags(t Tag) (Tag, error) { + // We leave private use identifiers alone. + if t.IsPrivateUse() { + return t, nil + } + if t.ScriptID != 0 && t.RegionID != 0 { + if t.LangID != 0 { + // already fully specified + specializeRegion(&t) + return t, nil + } + // Search matches for und-script-region. Note that for these cases + // region will never be a group so there is no need to check for this. + list := likelyRegion[t.RegionID : t.RegionID+1] + if x := list[0]; x.flags&isList != 0 { + list = likelyRegionList[x.lang : x.lang+uint16(x.script)] + } + for _, x := range list { + // Deviating from the spec. See match_test.go for details. + if Script(x.script) == t.ScriptID { + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + } + if t.LangID != 0 { + // Search matches for lang-script and lang-region, where lang != und. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + list := likelyLangList[x.region : x.region+uint16(x.script)] + if t.ScriptID != 0 { + for _, x := range list { + if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 { + t.setUndefinedRegion(Region(x.region)) + return t, nil + } + } + } else if t.RegionID != 0 { + count := 0 + goodScript := true + tt := t + for _, x := range list { + // We visit all entries for which the script was not + // defined, including the ones where the region was not + // defined. This allows for proper disambiguation within + // regions. + if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) { + tt.RegionID = Region(x.region) + tt.setUndefinedScript(Script(x.script)) + goodScript = goodScript && tt.ScriptID == Script(x.script) + count++ + } + } + if count == 1 { + return tt, nil + } + // Even if we fail to find a unique Region, we might have + // an unambiguous script. + if goodScript { + t.ScriptID = tt.ScriptID + } + } + } + } + } else { + // Search matches for und-script. + if t.ScriptID != 0 { + x := likelyScript[t.ScriptID] + if x.region != 0 { + t.setUndefinedRegion(Region(x.region)) + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + // Search matches for und-region. If und-script-region exists, it would + // have been found earlier. + if t.RegionID != 0 { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if x.region != 0 { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + t.RegionID = Region(x.region) + } + } else { + x := likelyRegion[t.RegionID] + if x.flags&isList != 0 { + x = likelyRegionList[x.lang] + } + if x.script != 0 && x.flags != scriptInFrom { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + return t, nil + } + } + } + } + + // Search matches for lang. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + x = likelyLangList[x.region] + } + if x.region != 0 { + t.setUndefinedScript(Script(x.script)) + t.setUndefinedRegion(Region(x.region)) + } + specializeRegion(&t) + if t.LangID == 0 { + t.LangID = _en // default language + } + return t, nil + } + return t, ErrMissingLikelyTagsData +} + +func (t *Tag) setTagsFrom(id Tag) { + t.LangID = id.LangID + t.ScriptID = id.ScriptID + t.RegionID = id.RegionID +} + +// minimize removes the region or script subtags from t such that +// t.addLikelySubtags() == t.minimize().addLikelySubtags(). +func (t Tag) minimize() (Tag, error) { + t, err := minimizeTags(t) + if err != nil { + return t, err + } + t.RemakeString() + return t, nil +} + +// minimizeTags mimics the behavior of the ICU 51 C implementation. +func minimizeTags(t Tag) (Tag, error) { + if t.equalTags(Und) { + return t, nil + } + max, err := addTags(t) + if err != nil { + return t, err + } + for _, id := range [...]Tag{ + {LangID: t.LangID}, + {LangID: t.LangID, RegionID: t.RegionID}, + {LangID: t.LangID, ScriptID: t.ScriptID}, + } { + if x, err := addTags(id); err == nil && max.equalTags(x) { + t.setTagsFrom(id) + break + } + } + return t, nil +} diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go new file mode 100644 index 0000000..2be83e1 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/parse.go @@ -0,0 +1,594 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "bytes" + "errors" + "fmt" + "sort" + + "golang.org/x/text/internal/tag" +) + +// isAlpha returns true if the byte is not a digit. +// b must be an ASCII letter or digit. +func isAlpha(b byte) bool { + return b > '9' +} + +// isAlphaNum returns true if the string contains only ASCII letters or digits. +func isAlphaNum(s []byte) bool { + for _, c := range s { + if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') { + return false + } + } + return true +} + +// ErrSyntax is returned by any of the parsing functions when the +// input is not well-formed, according to BCP 47. +// TODO: return the position at which the syntax error occurred? +var ErrSyntax = errors.New("language: tag is not well-formed") + +// ErrDuplicateKey is returned when a tag contains the same key twice with +// different values in the -u section. +var ErrDuplicateKey = errors.New("language: different values for same key in -u extension") + +// ValueError is returned by any of the parsing functions when the +// input is well-formed but the respective subtag is not recognized +// as a valid value. +type ValueError struct { + v [8]byte +} + +// NewValueError creates a new ValueError. +func NewValueError(tag []byte) ValueError { + var e ValueError + copy(e.v[:], tag) + return e +} + +func (e ValueError) tag() []byte { + n := bytes.IndexByte(e.v[:], 0) + if n == -1 { + n = 8 + } + return e.v[:n] +} + +// Error implements the error interface. +func (e ValueError) Error() string { + return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag()) +} + +// Subtag returns the subtag for which the error occurred. +func (e ValueError) Subtag() string { + return string(e.tag()) +} + +// scanner is used to scan BCP 47 tokens, which are separated by _ or -. +type scanner struct { + b []byte + bytes [max99thPercentileSize]byte + token []byte + start int // start position of the current token + end int // end position of the current token + next int // next point for scan + err error + done bool +} + +func makeScannerString(s string) scanner { + scan := scanner{} + if len(s) <= len(scan.bytes) { + scan.b = scan.bytes[:copy(scan.bytes[:], s)] + } else { + scan.b = []byte(s) + } + scan.init() + return scan +} + +// makeScanner returns a scanner using b as the input buffer. +// b is not copied and may be modified by the scanner routines. +func makeScanner(b []byte) scanner { + scan := scanner{b: b} + scan.init() + return scan +} + +func (s *scanner) init() { + for i, c := range s.b { + if c == '_' { + s.b[i] = '-' + } + } + s.scan() +} + +// restToLower converts the string between start and end to lower case. +func (s *scanner) toLower(start, end int) { + for i := start; i < end; i++ { + c := s.b[i] + if 'A' <= c && c <= 'Z' { + s.b[i] += 'a' - 'A' + } + } +} + +func (s *scanner) setError(e error) { + if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) { + s.err = e + } +} + +// resizeRange shrinks or grows the array at position oldStart such that +// a new string of size newSize can fit between oldStart and oldEnd. +// Sets the scan point to after the resized range. +func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) { + s.start = oldStart + if end := oldStart + newSize; end != oldEnd { + diff := end - oldEnd + if end < cap(s.b) { + b := make([]byte, len(s.b)+diff) + copy(b, s.b[:oldStart]) + copy(b[end:], s.b[oldEnd:]) + s.b = b + } else { + s.b = append(s.b[end:], s.b[oldEnd:]...) + } + s.next = end + (s.next - s.end) + s.end = end + } +} + +// replace replaces the current token with repl. +func (s *scanner) replace(repl string) { + s.resizeRange(s.start, s.end, len(repl)) + copy(s.b[s.start:], repl) +} + +// gobble removes the current token from the input. +// Caller must call scan after calling gobble. +func (s *scanner) gobble(e error) { + s.setError(e) + if s.start == 0 { + s.b = s.b[:+copy(s.b, s.b[s.next:])] + s.end = 0 + } else { + s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])] + s.end = s.start - 1 + } + s.next = s.start +} + +// deleteRange removes the given range from s.b before the current token. +func (s *scanner) deleteRange(start, end int) { + s.b = s.b[:start+copy(s.b[start:], s.b[end:])] + diff := end - start + s.next -= diff + s.start -= diff + s.end -= diff +} + +// scan parses the next token of a BCP 47 string. Tokens that are larger +// than 8 characters or include non-alphanumeric characters result in an error +// and are gobbled and removed from the output. +// It returns the end position of the last token consumed. +func (s *scanner) scan() (end int) { + end = s.end + s.token = nil + for s.start = s.next; s.next < len(s.b); { + i := bytes.IndexByte(s.b[s.next:], '-') + if i == -1 { + s.end = len(s.b) + s.next = len(s.b) + i = s.end - s.start + } else { + s.end = s.next + i + s.next = s.end + 1 + } + token := s.b[s.start:s.end] + if i < 1 || i > 8 || !isAlphaNum(token) { + s.gobble(ErrSyntax) + continue + } + s.token = token + return end + } + if n := len(s.b); n > 0 && s.b[n-1] == '-' { + s.setError(ErrSyntax) + s.b = s.b[:len(s.b)-1] + } + s.done = true + return end +} + +// acceptMinSize parses multiple tokens of the given size or greater. +// It returns the end position of the last token consumed. +func (s *scanner) acceptMinSize(min int) (end int) { + end = s.end + s.scan() + for ; len(s.token) >= min; s.scan() { + end = s.end + } + return end +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +func Parse(s string) (t Tag, err error) { + // TODO: consider supporting old-style locale key-value pairs. + if s == "" { + return Und, ErrSyntax + } + if len(s) <= maxAltTaglen { + b := [maxAltTaglen]byte{} + for i, c := range s { + // Generating invalid UTF-8 is okay as it won't match. + if 'A' <= c && c <= 'Z' { + c += 'a' - 'A' + } else if c == '_' { + c = '-' + } + b[i] = byte(c) + } + if t, ok := grandfathered(b); ok { + return t, nil + } + } + scan := makeScannerString(s) + return parse(&scan, s) +} + +func parse(scan *scanner, s string) (t Tag, err error) { + t = Und + var end int + if n := len(scan.token); n <= 1 { + scan.toLower(0, len(scan.b)) + if n == 0 || scan.token[0] != 'x' { + return t, ErrSyntax + } + end = parseExtensions(scan) + } else if n >= 4 { + return Und, ErrSyntax + } else { // the usual case + t, end = parseTag(scan) + if n := len(scan.token); n == 1 { + t.pExt = uint16(end) + end = parseExtensions(scan) + } else if end < len(scan.b) { + scan.setError(ErrSyntax) + scan.b = scan.b[:end] + } + } + if int(t.pVariant) < len(scan.b) { + if end < len(s) { + s = s[:end] + } + if len(s) > 0 && tag.Compare(s, scan.b) == 0 { + t.str = s + } else { + t.str = string(scan.b) + } + } else { + t.pVariant, t.pExt = 0, 0 + } + return t, scan.err +} + +// parseTag parses language, script, region and variants. +// It returns a Tag and the end position in the input that was parsed. +func parseTag(scan *scanner) (t Tag, end int) { + var e error + // TODO: set an error if an unknown lang, script or region is encountered. + t.LangID, e = getLangID(scan.token) + scan.setError(e) + scan.replace(t.LangID.String()) + langStart := scan.start + end = scan.scan() + for len(scan.token) == 3 && isAlpha(scan.token[0]) { + // From http://tools.ietf.org/html/bcp47, - tags are equivalent + // to a tag of the form . + lang, e := getLangID(scan.token) + if lang != 0 { + t.LangID = lang + copy(scan.b[langStart:], lang.String()) + scan.b[langStart+3] = '-' + scan.start = langStart + 4 + } + scan.gobble(e) + end = scan.scan() + } + if len(scan.token) == 4 && isAlpha(scan.token[0]) { + t.ScriptID, e = getScriptID(script, scan.token) + if t.ScriptID == 0 { + scan.gobble(e) + } + end = scan.scan() + } + if n := len(scan.token); n >= 2 && n <= 3 { + t.RegionID, e = getRegionID(scan.token) + if t.RegionID == 0 { + scan.gobble(e) + } else { + scan.replace(t.RegionID.String()) + } + end = scan.scan() + } + scan.toLower(scan.start, len(scan.b)) + t.pVariant = byte(end) + end = parseVariants(scan, end, t) + t.pExt = uint16(end) + return t, end +} + +var separator = []byte{'-'} + +// parseVariants scans tokens as long as each token is a valid variant string. +// Duplicate variants are removed. +func parseVariants(scan *scanner, end int, t Tag) int { + start := scan.start + varIDBuf := [4]uint8{} + variantBuf := [4][]byte{} + varID := varIDBuf[:0] + variant := variantBuf[:0] + last := -1 + needSort := false + for ; len(scan.token) >= 4; scan.scan() { + // TODO: measure the impact of needing this conversion and redesign + // the data structure if there is an issue. + v, ok := variantIndex[string(scan.token)] + if !ok { + // unknown variant + // TODO: allow user-defined variants? + scan.gobble(NewValueError(scan.token)) + continue + } + varID = append(varID, v) + variant = append(variant, scan.token) + if !needSort { + if last < int(v) { + last = int(v) + } else { + needSort = true + // There is no legal combinations of more than 7 variants + // (and this is by no means a useful sequence). + const maxVariants = 8 + if len(varID) > maxVariants { + break + } + } + } + end = scan.end + } + if needSort { + sort.Sort(variantsSort{varID, variant}) + k, l := 0, -1 + for i, v := range varID { + w := int(v) + if l == w { + // Remove duplicates. + continue + } + varID[k] = varID[i] + variant[k] = variant[i] + k++ + l = w + } + if str := bytes.Join(variant[:k], separator); len(str) == 0 { + end = start - 1 + } else { + scan.resizeRange(start, end, len(str)) + copy(scan.b[scan.start:], str) + end = scan.end + } + } + return end +} + +type variantsSort struct { + i []uint8 + v [][]byte +} + +func (s variantsSort) Len() int { + return len(s.i) +} + +func (s variantsSort) Swap(i, j int) { + s.i[i], s.i[j] = s.i[j], s.i[i] + s.v[i], s.v[j] = s.v[j], s.v[i] +} + +func (s variantsSort) Less(i, j int) bool { + return s.i[i] < s.i[j] +} + +type bytesSort struct { + b [][]byte + n int // first n bytes to compare +} + +func (b bytesSort) Len() int { + return len(b.b) +} + +func (b bytesSort) Swap(i, j int) { + b.b[i], b.b[j] = b.b[j], b.b[i] +} + +func (b bytesSort) Less(i, j int) bool { + for k := 0; k < b.n; k++ { + if b.b[i][k] == b.b[j][k] { + continue + } + return b.b[i][k] < b.b[j][k] + } + return false +} + +// parseExtensions parses and normalizes the extensions in the buffer. +// It returns the last position of scan.b that is part of any extension. +// It also trims scan.b to remove excess parts accordingly. +func parseExtensions(scan *scanner) int { + start := scan.start + exts := [][]byte{} + private := []byte{} + end := scan.end + for len(scan.token) == 1 { + extStart := scan.start + ext := scan.token[0] + end = parseExtension(scan) + extension := scan.b[extStart:end] + if len(extension) < 3 || (ext != 'x' && len(extension) < 4) { + scan.setError(ErrSyntax) + end = extStart + continue + } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) { + scan.b = scan.b[:end] + return end + } else if ext == 'x' { + private = extension + break + } + exts = append(exts, extension) + } + sort.Sort(bytesSort{exts, 1}) + if len(private) > 0 { + exts = append(exts, private) + } + scan.b = scan.b[:start] + if len(exts) > 0 { + scan.b = append(scan.b, bytes.Join(exts, separator)...) + } else if start > 0 { + // Strip trailing '-'. + scan.b = scan.b[:start-1] + } + return end +} + +// parseExtension parses a single extension and returns the position of +// the extension end. +func parseExtension(scan *scanner) int { + start, end := scan.start, scan.end + switch scan.token[0] { + case 'u': + attrStart := end + scan.scan() + for last := []byte{}; len(scan.token) > 2; scan.scan() { + if bytes.Compare(scan.token, last) != -1 { + // Attributes are unsorted. Start over from scratch. + p := attrStart + 1 + scan.next = p + attrs := [][]byte{} + for scan.scan(); len(scan.token) > 2; scan.scan() { + attrs = append(attrs, scan.token) + end = scan.end + } + sort.Sort(bytesSort{attrs, 3}) + copy(scan.b[p:], bytes.Join(attrs, separator)) + break + } + last = scan.token + end = scan.end + } + var last, key []byte + for attrEnd := end; len(scan.token) == 2; last = key { + key = scan.token + keyEnd := scan.end + end = scan.acceptMinSize(3) + // TODO: check key value validity + if keyEnd == end || bytes.Compare(key, last) != 1 { + // We have an invalid key or the keys are not sorted. + // Start scanning keys from scratch and reorder. + p := attrEnd + 1 + scan.next = p + keys := [][]byte{} + for scan.scan(); len(scan.token) == 2; { + keyStart, keyEnd := scan.start, scan.end + end = scan.acceptMinSize(3) + if keyEnd != end { + keys = append(keys, scan.b[keyStart:end]) + } else { + scan.setError(ErrSyntax) + end = keyStart + } + } + sort.Stable(bytesSort{keys, 2}) + if n := len(keys); n > 0 { + k := 0 + for i := 1; i < n; i++ { + if !bytes.Equal(keys[k][:2], keys[i][:2]) { + k++ + keys[k] = keys[i] + } else if !bytes.Equal(keys[k], keys[i]) { + scan.setError(ErrDuplicateKey) + } + } + keys = keys[:k+1] + } + reordered := bytes.Join(keys, separator) + if e := p + len(reordered); e < end { + scan.deleteRange(e, end) + end = e + } + copy(scan.b[p:], reordered) + break + } + } + case 't': + scan.scan() + if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) { + _, end = parseTag(scan) + scan.toLower(start, end) + } + for len(scan.token) == 2 && !isAlpha(scan.token[1]) { + end = scan.acceptMinSize(3) + } + case 'x': + end = scan.acceptMinSize(1) + default: + end = scan.acceptMinSize(2) + } + return end +} + +// getExtension returns the name, body and end position of the extension. +func getExtension(s string, p int) (end int, ext string) { + if s[p] == '-' { + p++ + } + if s[p] == 'x' { + return len(s), s[p:] + } + end = nextExtension(s, p) + return end, s[p:end] +} + +// nextExtension finds the next extension within the string, searching +// for the -- pattern from position p. +// In the fast majority of cases, language tags will have at most +// one extension and extensions tend to be small. +func nextExtension(s string, p int) int { + for n := len(s) - 3; p < n; { + if s[p] == '-' { + if s[p+2] == '-' { + return p + } + p += 3 + } else { + p++ + } + } + return len(s) +} diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go new file mode 100644 index 0000000..239e2d2 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/tables.go @@ -0,0 +1,3431 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +import "golang.org/x/text/internal/tag" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +const NumLanguages = 8665 + +const NumScripts = 242 + +const NumRegions = 357 + +type FromTo struct { + From uint16 + To uint16 +} + +const nonCanonicalUnd = 1201 +const ( + _af = 22 + _am = 39 + _ar = 58 + _az = 88 + _bg = 126 + _bn = 165 + _ca = 215 + _cs = 250 + _da = 257 + _de = 269 + _el = 310 + _en = 313 + _es = 318 + _et = 320 + _fa = 328 + _fi = 337 + _fil = 339 + _fr = 350 + _gu = 420 + _he = 444 + _hi = 446 + _hr = 465 + _hu = 469 + _hy = 471 + _id = 481 + _is = 504 + _it = 505 + _ja = 512 + _ka = 528 + _kk = 578 + _km = 586 + _kn = 593 + _ko = 596 + _ky = 650 + _lo = 696 + _lt = 704 + _lv = 711 + _mk = 767 + _ml = 772 + _mn = 779 + _mo = 784 + _mr = 795 + _ms = 799 + _mul = 806 + _my = 817 + _nb = 839 + _ne = 849 + _nl = 871 + _no = 879 + _pa = 925 + _pl = 947 + _pt = 960 + _ro = 988 + _ru = 994 + _sh = 1031 + _si = 1036 + _sk = 1042 + _sl = 1046 + _sq = 1073 + _sr = 1074 + _sv = 1092 + _sw = 1093 + _ta = 1104 + _te = 1121 + _th = 1131 + _tl = 1146 + _tn = 1152 + _tr = 1162 + _uk = 1198 + _ur = 1204 + _uz = 1212 + _vi = 1219 + _zh = 1321 + _zu = 1327 + _jbo = 515 + _ami = 1650 + _bnn = 2357 + _hak = 438 + _tlh = 14467 + _lb = 661 + _nv = 899 + _pwn = 12055 + _tao = 14188 + _tay = 14198 + _tsu = 14662 + _nn = 874 + _sfb = 13629 + _vgt = 15701 + _sgg = 13660 + _cmn = 3007 + _nan = 835 + _hsn = 467 +) + +const langPrivateStart = 0x2f72 + +const langPrivateEnd = 0x3179 + +// lang holds an alphabetically sorted list of ISO-639 language identifiers. +// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. +// For 2-byte language identifiers, the two successive bytes have the following meaning: +// - if the first letter of the 2- and 3-letter ISO codes are the same: +// the second and third letter of the 3-letter ISO code. +// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. +// For 3-byte language identifiers the 4th byte is 0. +const lang tag.Index = "" + // Size: 5324 bytes + "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + + "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" + + "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" + + "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" + + "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" + + "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" + + "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" + + "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" + + "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" + + "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" + + "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" + + "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" + + "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" + + "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" + + "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" + + "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" + + "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" + + "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" + + "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" + + "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" + + "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" + + "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" + + "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" + + "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" + + "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" + + "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" + + "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" + + "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" + + "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" + + "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" + + "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" + + "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" + + "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" + + "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" + + "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" + + "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" + + "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" + + "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" + + "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" + + "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" + + "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" + + "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" + + "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" + + "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" + + "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" + + "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" + + "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" + + "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" + + "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" + + "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" + + "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" + + "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" + + "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" + + "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" + + "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" + + "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" + + "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" + + "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" + + "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" + + "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" + + "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" + + "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" + + "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" + + "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" + + "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" + + "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" + + "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" + + "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" + + "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" + + "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" + + "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" + + "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" + + "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" + + "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" + + "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" + + "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" + + "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" + + "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" + + "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" + + "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" + + "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" + + "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" + + "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" + + "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" + + "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" + + "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" + + "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" + + "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" + + "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" + + "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" + + "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" + + "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" + + "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" + + "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" + + "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" + + "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" + + "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" + + "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" + + "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" + + "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" + + "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" + + "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" + + "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" + + "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" + + "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" + + "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" + + "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" + + "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" + + "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" + + "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" + + "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" + + "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" + + "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" + + "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" + + "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" + + "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" + + "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" + + "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" + + "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" + + "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" + + "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" + + "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" + + "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" + + "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff" + +const langNoIndexOffset = 1330 + +// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index +// in lookup tables. The language ids for these language codes are derived directly +// from the letters and are not consecutive. +// Size: 2197 bytes, 2197 elements +var langNoIndex = [2197]uint8{ + // Entry 0 - 3F + 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, + 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, + 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, + 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, + 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a, + 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, + // Entry 40 - 7F + 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, + 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed, + 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35, + 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff, + 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5, + 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3, + 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, + 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, + // Entry 80 - BF + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff, + 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, + 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, + 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, + 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff, + 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5, + 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c, + 0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, + // Entry C0 - FF + 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, + 0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef, + 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, + 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35, + 0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00, + 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, + 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, + // Entry 100 - 13F + 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, + 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, + 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, + 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c, + 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f, + 0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, + 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, + 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, + // Entry 140 - 17F + 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16, + 0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, + 0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09, + 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, + 0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04, + 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, + 0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03, + // Entry 180 - 1BF + 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, + 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, + 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00, + 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55, + 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40, + 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf, + // Entry 200 - 23F + 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, + 0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, + 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf, + 0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3, + 0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d, + 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, + 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, + // Entry 240 - 27F + 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, + 0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0, + 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, + 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, + 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, + 0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, + 0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66, + // Entry 280 - 2BF + 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, + 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51, + 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, + 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60, + 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80, + 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, + 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, + // Entry 2C0 - 2FF + 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, + 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, + 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, + 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, + 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00, + // Entry 300 - 33F + 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, + 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, + 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, + 0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0, + 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, + 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, + 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, + 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00, + // Entry 340 - 37F + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01, + 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3, + 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb, + 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6, + 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff, + 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff, + 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f, + 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f, + // Entry 380 - 3BF + 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f, + 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d, + 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf, + 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, + 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, + 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, + // Entry 3C0 - 3FF + 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, + 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, + 0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01, + 0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10, + 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, + 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, + // Entry 400 - 43F + 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f, + 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7, + 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f, + 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b, + 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7, + 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe, + 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde, + 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf, + // Entry 440 - 47F + 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d, + 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd, + 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf, + 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7, + 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce, + 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd, + 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, + 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4, + // Entry 480 - 4BF + 0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb, + 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, + 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05, + 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04, + 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, + 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1, + // Entry 4C0 - 4FF + 0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed, + 0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, + 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, + 0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7, + 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, + 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, + 0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, + // Entry 500 - 53F + 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, + 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, + 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7, + 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, + 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9, + 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, + 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, + // Entry 540 - 57F + 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + // Entry 580 - 5BF + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d, + 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80, + 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, + 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, + 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, + 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, + // Entry 5C0 - 5FF + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, + 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, + 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20, + 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, + 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, + 0x1f, 0x98, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe, + // Entry 600 - 63F + 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9, + 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, + 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, + 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, + 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f, + 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, + 0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18, + 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, + // Entry 640 - 67F + 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf1, 0x57, 0x6c, + 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde, + 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98, + 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, + 0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4, + 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, + 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, + // Entry 680 - 6BF + 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, + 0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda, + 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0, + 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, + 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, + 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, + 0x04, 0x00, 0x10, 0xcc, 0x58, 0xd5, 0x0d, 0x0f, + // Entry 6C0 - 6FF + 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08, + 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41, + 0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, + 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab, + 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, + // Entry 700 - 73F + 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, + 0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79, + 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, + 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 740 - 77F + 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, + 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, + 0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55, + 0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03, + 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, + // Entry 780 - 7BF + 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, + 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, + 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, + 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, + 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, + // Entry 7C0 - 7FF + 0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42, + 0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56, + 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, + 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, + 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, + 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, + 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, + // Entry 800 - 83F + 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, + 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, + 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, + 0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, + 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, + 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, + // Entry 840 - 87F + 0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, + 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, + 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, + 0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1, + 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, + 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, + 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, + // Entry 880 - 8BF + 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24, + 0x0a, 0x00, 0x80, 0x00, 0x00, +} + +// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives +// to 2-letter language codes that cannot be derived using the method described above. +// Each 3-letter code is followed by its 1-byte langID. +const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" + +// altLangIndex is used to convert indexes in altLangISO3 to langIDs. +// Size: 12 bytes, 6 elements +var altLangIndex = [6]uint16{ + 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208, +} + +// AliasMap maps langIDs to their suggested replacements. +// Size: 656 bytes, 164 elements +var AliasMap = [164]FromTo{ + 0: {From: 0x82, To: 0x88}, + 1: {From: 0x187, To: 0x1ae}, + 2: {From: 0x1f3, To: 0x1e1}, + 3: {From: 0x1fb, To: 0x1bc}, + 4: {From: 0x208, To: 0x512}, + 5: {From: 0x20f, To: 0x20e}, + 6: {From: 0x310, To: 0x3dc}, + 7: {From: 0x347, To: 0x36f}, + 8: {From: 0x407, To: 0x432}, + 9: {From: 0x47a, To: 0x153}, + 10: {From: 0x490, To: 0x451}, + 11: {From: 0x4a2, To: 0x21}, + 12: {From: 0x53e, To: 0x544}, + 13: {From: 0x58f, To: 0x12d}, + 14: {From: 0x630, To: 0x1eb1}, + 15: {From: 0x651, To: 0x431}, + 16: {From: 0x662, To: 0x431}, + 17: {From: 0x6ed, To: 0x3a}, + 18: {From: 0x6f8, To: 0x1d7}, + 19: {From: 0x73e, To: 0x21a1}, + 20: {From: 0x7b3, To: 0x56}, + 21: {From: 0x7b9, To: 0x299b}, + 22: {From: 0x7c5, To: 0x58}, + 23: {From: 0x7e6, To: 0x145}, + 24: {From: 0x80c, To: 0x5a}, + 25: {From: 0x815, To: 0x8d}, + 26: {From: 0x87e, To: 0x810}, + 27: {From: 0x8c3, To: 0xee3}, + 28: {From: 0x9ef, To: 0x331}, + 29: {From: 0xa36, To: 0x2c5}, + 30: {From: 0xa3d, To: 0xbf}, + 31: {From: 0xabe, To: 0x3322}, + 32: {From: 0xb38, To: 0x529}, + 33: {From: 0xb75, To: 0x265a}, + 34: {From: 0xb7e, To: 0xbc3}, + 35: {From: 0xb9b, To: 0x44e}, + 36: {From: 0xbbc, To: 0x4229}, + 37: {From: 0xbbf, To: 0x529}, + 38: {From: 0xbfe, To: 0x2da7}, + 39: {From: 0xc2e, To: 0x3181}, + 40: {From: 0xcb9, To: 0xf3}, + 41: {From: 0xd08, To: 0xfa}, + 42: {From: 0xdc8, To: 0x11a}, + 43: {From: 0xdd7, To: 0x32d}, + 44: {From: 0xdf8, To: 0xdfb}, + 45: {From: 0xdfe, To: 0x531}, + 46: {From: 0xedf, To: 0x205a}, + 47: {From: 0xeee, To: 0x2e9a}, + 48: {From: 0xf39, To: 0x367}, + 49: {From: 0x10d0, To: 0x140}, + 50: {From: 0x1104, To: 0x2d0}, + 51: {From: 0x11a0, To: 0x1ec}, + 52: {From: 0x1279, To: 0x21}, + 53: {From: 0x1424, To: 0x15e}, + 54: {From: 0x1470, To: 0x14e}, + 55: {From: 0x151f, To: 0xd9b}, + 56: {From: 0x1523, To: 0x390}, + 57: {From: 0x1532, To: 0x19f}, + 58: {From: 0x1580, To: 0x210}, + 59: {From: 0x1583, To: 0x10d}, + 60: {From: 0x15a3, To: 0x3caf}, + 61: {From: 0x166a, To: 0x19b}, + 62: {From: 0x16c8, To: 0x136}, + 63: {From: 0x1700, To: 0x29f8}, + 64: {From: 0x1718, To: 0x194}, + 65: {From: 0x1727, To: 0xf3f}, + 66: {From: 0x177a, To: 0x178}, + 67: {From: 0x1809, To: 0x17b6}, + 68: {From: 0x1816, To: 0x18f3}, + 69: {From: 0x188a, To: 0x436}, + 70: {From: 0x1979, To: 0x1d01}, + 71: {From: 0x1a74, To: 0x2bb0}, + 72: {From: 0x1a8a, To: 0x1f8}, + 73: {From: 0x1b5a, To: 0x1fa}, + 74: {From: 0x1b86, To: 0x1515}, + 75: {From: 0x1d64, To: 0x2c9b}, + 76: {From: 0x2038, To: 0x37b1}, + 77: {From: 0x203d, To: 0x20dd}, + 78: {From: 0x205a, To: 0x30b}, + 79: {From: 0x20e3, To: 0x274}, + 80: {From: 0x20ee, To: 0x263}, + 81: {From: 0x20f2, To: 0x22d}, + 82: {From: 0x20f9, To: 0x256}, + 83: {From: 0x210f, To: 0x21eb}, + 84: {From: 0x2135, To: 0x27d}, + 85: {From: 0x2160, To: 0x913}, + 86: {From: 0x2199, To: 0x121}, + 87: {From: 0x21ce, To: 0x1561}, + 88: {From: 0x21e6, To: 0x504}, + 89: {From: 0x21f4, To: 0x49f}, + 90: {From: 0x222d, To: 0x121}, + 91: {From: 0x2237, To: 0x121}, + 92: {From: 0x2262, To: 0x92a}, + 93: {From: 0x2316, To: 0x3226}, + 94: {From: 0x2382, To: 0x3365}, + 95: {From: 0x2472, To: 0x2c7}, + 96: {From: 0x24e4, To: 0x2ff}, + 97: {From: 0x24f0, To: 0x2fa}, + 98: {From: 0x24fa, To: 0x31f}, + 99: {From: 0x2550, To: 0xb5b}, + 100: {From: 0x25a9, To: 0xe2}, + 101: {From: 0x263e, To: 0x2d0}, + 102: {From: 0x26c9, To: 0x26b4}, + 103: {From: 0x26f9, To: 0x3c8}, + 104: {From: 0x2727, To: 0x3caf}, + 105: {From: 0x2765, To: 0x26b4}, + 106: {From: 0x2789, To: 0x4358}, + 107: {From: 0x28ef, To: 0x2837}, + 108: {From: 0x2914, To: 0x351}, + 109: {From: 0x2986, To: 0x2da7}, + 110: {From: 0x2b1a, To: 0x38d}, + 111: {From: 0x2bfc, To: 0x395}, + 112: {From: 0x2c3f, To: 0x3caf}, + 113: {From: 0x2cfc, To: 0x3be}, + 114: {From: 0x2d13, To: 0x597}, + 115: {From: 0x2d47, To: 0x148}, + 116: {From: 0x2d48, To: 0x148}, + 117: {From: 0x2dff, To: 0x2f1}, + 118: {From: 0x2e08, To: 0x19cc}, + 119: {From: 0x2e1a, To: 0x2d95}, + 120: {From: 0x2e21, To: 0x292}, + 121: {From: 0x2e54, To: 0x7d}, + 122: {From: 0x2e65, To: 0x2282}, + 123: {From: 0x2ea0, To: 0x2e9b}, + 124: {From: 0x2eef, To: 0x2ed7}, + 125: {From: 0x3193, To: 0x3c4}, + 126: {From: 0x3366, To: 0x338e}, + 127: {From: 0x342a, To: 0x3dc}, + 128: {From: 0x34ee, To: 0x18d0}, + 129: {From: 0x35c8, To: 0x2c9b}, + 130: {From: 0x35e6, To: 0x412}, + 131: {From: 0x3658, To: 0x246}, + 132: {From: 0x3676, To: 0x3f4}, + 133: {From: 0x36fd, To: 0x445}, + 134: {From: 0x37c0, To: 0x121}, + 135: {From: 0x3816, To: 0x38f2}, + 136: {From: 0x382b, To: 0x2c9b}, + 137: {From: 0x382f, To: 0xa9}, + 138: {From: 0x3832, To: 0x3228}, + 139: {From: 0x386c, To: 0x39a6}, + 140: {From: 0x3892, To: 0x3fc0}, + 141: {From: 0x38a5, To: 0x39d7}, + 142: {From: 0x38b4, To: 0x1fa4}, + 143: {From: 0x38b5, To: 0x2e9a}, + 144: {From: 0x395c, To: 0x47e}, + 145: {From: 0x3b4e, To: 0xd91}, + 146: {From: 0x3b78, To: 0x137}, + 147: {From: 0x3c99, To: 0x4bc}, + 148: {From: 0x3fbd, To: 0x100}, + 149: {From: 0x4208, To: 0xa91}, + 150: {From: 0x42be, To: 0x573}, + 151: {From: 0x42f9, To: 0x3f60}, + 152: {From: 0x4378, To: 0x25a}, + 153: {From: 0x43cb, To: 0x36cb}, + 154: {From: 0x43cd, To: 0x10f}, + 155: {From: 0x44af, To: 0x3322}, + 156: {From: 0x44e3, To: 0x512}, + 157: {From: 0x45ca, To: 0x2409}, + 158: {From: 0x45dd, To: 0x26dc}, + 159: {From: 0x4610, To: 0x48ae}, + 160: {From: 0x46ae, To: 0x46a0}, + 161: {From: 0x473e, To: 0x4745}, + 162: {From: 0x4916, To: 0x31f}, + 163: {From: 0x49a7, To: 0x523}, +} + +// Size: 164 bytes, 164 elements +var AliasTypes = [164]AliasType{ + // Entry 0 - 3F + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, + 1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0, + 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0, + 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0, + // Entry 40 - 7F + 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 0, 1, 1, + 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, + 2, 2, 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1, + 0, 1, 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, + // Entry 80 - BF + 0, 0, 2, 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, + 1, 1, 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, + 0, 1, 1, 1, +} + +const ( + _Latn = 87 + _Hani = 54 + _Hans = 56 + _Hant = 57 + _Qaaa = 139 + _Qaai = 147 + _Qabx = 188 + _Zinh = 236 + _Zyyy = 241 + _Zzzz = 242 +) + +// script is an alphabetically sorted list of ISO 15924 codes. The index +// of the script in the string, divided by 4, is the internal scriptID. +const script tag.Index = "" + // Size: 976 bytes + "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + + "BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCpmnCprtCyrlCyrsDevaDogrDsrt" + + "DuplEgydEgyhEgypElbaEthiGeokGeorGlagGongGonmGothGranGrekGujrGuruHanbHang" + + "HaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamoJavaJpanJurc" + + "KaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepc" + + "LimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMendMercMeroMlym" + + "ModiMongMoonMrooMteiMultMymrNarbNbatNewaNkdbNkgbNkooNshuOgamOlckOrkhOrya" + + "OsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaae" + + "QaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaaw" + + "QaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabkQablQabmQabnQabo" + + "QabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRoroRunrSamrSaraSarbSaurSgnwShaw" + + "ShrdShuiSiddSindSinhSoraSoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTaml" + + "TangTavtTeluTengTfngTglgThaaThaiTibtTirhUgarVaiiVispWaraWchoWoleXpeoXsux" + + "YiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" + +// suppressScript is an index from langID to the dominant script for that language, +// if it exists. If a script is given, it should be suppressed from the language tag. +// Size: 1330 bytes, 1330 elements +var suppressScript = [1330]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 40 - 7F + 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, + // Entry 80 - BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry C0 - FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xde, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x31, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x57, 0x00, + // Entry 140 - 17F + 0x57, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 180 - 1BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x57, 0x32, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x3b, 0x00, 0x21, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x57, 0x00, 0x57, 0x57, 0x00, 0x08, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x57, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, + // Entry 200 - 23F + 0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x2b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 240 - 27F + 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x00, 0x00, 0x4b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x4f, 0x00, 0x00, 0x50, 0x00, 0x21, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 280 - 2BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x54, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 2C0 - 2FF + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x21, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, + // Entry 300 - 33F + 0x00, 0x00, 0x00, 0x00, 0x6b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x21, 0x00, 0x00, 0x00, 0x57, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x72, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + // Entry 340 - 37F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x57, 0x21, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x78, 0x57, 0x00, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 380 - 3BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x7d, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x33, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, + // Entry 3C0 - 3FF + 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 400 - 43F + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xca, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + // Entry 440 - 47F + 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xd7, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xda, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xdf, 0x00, 0x00, 0x00, 0x29, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, + // Entry 480 - 4BF + 0x57, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 4C0 - 4FF + 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 500 - 53F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, +} + +const ( + _001 = 1 + _419 = 31 + _BR = 65 + _CA = 73 + _ES = 110 + _GB = 123 + _MD = 188 + _PT = 238 + _UK = 306 + _US = 309 + _ZZ = 357 + _XA = 323 + _XC = 325 + _XK = 333 +) + +// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID +// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for +// the UN.M49 codes used for groups.) +const isoRegionOffset = 32 + +// regionTypes defines the status of a region for various standards. +// Size: 358 bytes, 358 elements +var regionTypes = [358]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 40 - 7F + 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, + 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 80 - BF + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry C0 - FF + 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + // Entry 100 - 13F + 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 140 - 17F + 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, + 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, +} + +// regionISO holds a list of alphabetically sorted 2-letter ISO region codes. +// Each 2-letter codes is followed by two bytes with the following meaning: +// - [A-Z}{2}: the first letter of the 2-letter code plus these two +// letters form the 3-letter ISO code. +// - 0, n: index into altRegionISO3. +const regionISO tag.Index = "" + // Size: 1308 bytes + "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + + "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + + "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + + "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + + "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + + "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + + "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + + "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + + "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + + "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + + "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + + "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + + "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + + "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + + "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + + "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + + "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + + "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + +// altRegionISO3 holds a list of 3-letter region codes that cannot be +// mapped to 2-letter codes using the default algorithm. This is a short list. +const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" + +// altRegionIDs holds a list of regionIDs the positions of which match those +// of the 3-letter ISO codes in altRegionISO3. +// Size: 22 bytes, 11 elements +var altRegionIDs = [11]uint16{ + 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, + 0x0121, 0x015f, 0x00dc, +} + +// Size: 80 bytes, 20 elements +var regionOldMap = [20]FromTo{ + 0: {From: 0x44, To: 0xc4}, + 1: {From: 0x58, To: 0xa7}, + 2: {From: 0x5f, To: 0x60}, + 3: {From: 0x66, To: 0x3b}, + 4: {From: 0x79, To: 0x78}, + 5: {From: 0x93, To: 0x37}, + 6: {From: 0xa3, To: 0x133}, + 7: {From: 0xc1, To: 0x133}, + 8: {From: 0xd7, To: 0x13f}, + 9: {From: 0xdc, To: 0x2b}, + 10: {From: 0xef, To: 0x133}, + 11: {From: 0xf2, To: 0xe2}, + 12: {From: 0xfc, To: 0x70}, + 13: {From: 0x103, To: 0x164}, + 14: {From: 0x12a, To: 0x126}, + 15: {From: 0x132, To: 0x7b}, + 16: {From: 0x13a, To: 0x13e}, + 17: {From: 0x141, To: 0x133}, + 18: {From: 0x15d, To: 0x15e}, + 19: {From: 0x163, To: 0x4b}, +} + +// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are +// codes indicating collections of regions. +// Size: 716 bytes, 358 elements +var m49 = [358]int16{ + // Entry 0 - 3F + 0, 1, 2, 3, 5, 9, 11, 13, + 14, 15, 17, 18, 19, 21, 29, 30, + 34, 35, 39, 53, 54, 57, 61, 142, + 143, 145, 150, 151, 154, 155, 202, 419, + 958, 0, 20, 784, 4, 28, 660, 8, + 51, 530, 24, 10, 32, 16, 40, 36, + 533, 248, 31, 70, 52, 50, 56, 854, + 100, 48, 108, 204, 652, 60, 96, 68, + // Entry 40 - 7F + 535, 76, 44, 64, 104, 74, 72, 112, + 84, 124, 166, 180, 140, 178, 756, 384, + 184, 152, 120, 156, 170, 0, 188, 891, + 296, 192, 132, 531, 162, 196, 203, 278, + 276, 0, 262, 208, 212, 214, 204, 12, + 0, 218, 233, 818, 732, 232, 724, 231, + 967, 0, 246, 242, 238, 583, 234, 0, + 250, 249, 266, 826, 308, 268, 254, 831, + // Entry 80 - BF + 288, 292, 304, 270, 324, 312, 226, 300, + 239, 320, 316, 624, 328, 344, 334, 340, + 191, 332, 348, 854, 0, 360, 372, 376, + 833, 356, 86, 368, 364, 352, 380, 832, + 388, 400, 392, 581, 404, 417, 116, 296, + 174, 659, 408, 410, 414, 136, 398, 418, + 422, 662, 438, 144, 430, 426, 440, 442, + 428, 434, 504, 492, 498, 499, 663, 450, + // Entry C0 - FF + 584, 581, 807, 466, 104, 496, 446, 580, + 474, 478, 500, 470, 480, 462, 454, 484, + 458, 508, 516, 540, 562, 574, 566, 548, + 558, 528, 578, 524, 10, 520, 536, 570, + 554, 512, 591, 0, 604, 258, 598, 608, + 586, 616, 666, 612, 630, 275, 620, 581, + 585, 600, 591, 634, 959, 960, 961, 962, + 963, 964, 965, 966, 967, 968, 969, 970, + // Entry 100 - 13F + 971, 972, 638, 716, 642, 688, 643, 646, + 682, 90, 690, 729, 752, 702, 654, 705, + 744, 703, 694, 674, 686, 706, 740, 728, + 678, 810, 222, 534, 760, 748, 0, 796, + 148, 260, 768, 764, 762, 772, 626, 795, + 788, 776, 626, 792, 780, 798, 158, 834, + 804, 800, 826, 581, 0, 840, 858, 860, + 336, 670, 704, 862, 92, 850, 704, 548, + // Entry 140 - 17F + 876, 581, 882, 973, 974, 975, 976, 977, + 978, 979, 980, 981, 982, 983, 984, 985, + 986, 987, 988, 989, 990, 991, 992, 993, + 994, 995, 996, 997, 998, 720, 887, 175, + 891, 710, 894, 180, 716, 999, +} + +// m49Index gives indexes into fromM49 based on the three most significant bits +// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in +// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] +// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. +// The region code is stored in the 9 lsb of the indexed value. +// Size: 18 bytes, 9 elements +var m49Index = [9]int16{ + 0, 59, 108, 143, 181, 220, 259, 291, + 333, +} + +// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details. +// Size: 666 bytes, 333 elements +var fromM49 = [333]uint16{ + // Entry 0 - 3F + 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, + 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, + 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, + 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, + 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, + 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, + 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, + // Entry 40 - 7F + 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, + 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, + 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, + 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, + 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, + 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, + 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, + // Entry 80 - BF + 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, + 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, + 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, + 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, + 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, + 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, + 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, + 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, + // Entry C0 - FF + 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, + 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, + 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, + 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, + 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, + 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, + 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, + 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, + // Entry 100 - 13F + 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, + 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, + 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, + 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, + 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, + 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, + 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, + 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, + // Entry 140 - 17F + 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, + 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, +} + +// Size: 1615 bytes +var variantIndex = map[string]uint8{ + "1606nict": 0x0, + "1694acad": 0x1, + "1901": 0x2, + "1959acad": 0x3, + "1994": 0x4d, + "1996": 0x4, + "abl1943": 0x5, + "akuapem": 0x6, + "alalc97": 0x4f, + "aluku": 0x7, + "ao1990": 0x8, + "arevela": 0x9, + "arevmda": 0xa, + "asante": 0xb, + "baku1926": 0xc, + "balanka": 0xd, + "barla": 0xe, + "basiceng": 0xf, + "bauddha": 0x10, + "biscayan": 0x11, + "biske": 0x48, + "bohoric": 0x12, + "boont": 0x13, + "colb1945": 0x14, + "cornu": 0x15, + "dajnko": 0x16, + "ekavsk": 0x17, + "emodeng": 0x18, + "fonipa": 0x50, + "fonnapa": 0x51, + "fonupa": 0x52, + "fonxsamp": 0x53, + "hepburn": 0x19, + "heploc": 0x4e, + "hognorsk": 0x1a, + "hsistemo": 0x1b, + "ijekavsk": 0x1c, + "itihasa": 0x1d, + "jauer": 0x1e, + "jyutping": 0x1f, + "kkcor": 0x20, + "kociewie": 0x21, + "kscor": 0x22, + "laukika": 0x23, + "lipaw": 0x49, + "luna1918": 0x24, + "metelko": 0x25, + "monoton": 0x26, + "ndyuka": 0x27, + "nedis": 0x28, + "newfound": 0x29, + "njiva": 0x4a, + "nulik": 0x2a, + "osojs": 0x4b, + "oxendict": 0x2b, + "pahawh2": 0x2c, + "pahawh3": 0x2d, + "pahawh4": 0x2e, + "pamaka": 0x2f, + "petr1708": 0x30, + "pinyin": 0x31, + "polyton": 0x32, + "puter": 0x33, + "rigik": 0x34, + "rozaj": 0x35, + "rumgr": 0x36, + "scotland": 0x37, + "scouse": 0x38, + "simple": 0x54, + "solba": 0x4c, + "sotav": 0x39, + "spanglis": 0x3a, + "surmiran": 0x3b, + "sursilv": 0x3c, + "sutsilv": 0x3d, + "tarask": 0x3e, + "uccor": 0x3f, + "ucrcor": 0x40, + "ulster": 0x41, + "unifon": 0x42, + "vaidika": 0x43, + "valencia": 0x44, + "vallader": 0x45, + "wadegile": 0x46, + "xsistemo": 0x47, +} + +// variantNumSpecialized is the number of specialized variants in variants. +const variantNumSpecialized = 79 + +// nRegionGroups is the number of region groups. +const nRegionGroups = 33 + +type likelyLangRegion struct { + lang uint16 + region uint16 +} + +// likelyScript is a lookup table, indexed by scriptID, for the most likely +// languages and regions given a script. +// Size: 976 bytes, 244 elements +var likelyScript = [244]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x84}, + 3: {lang: 0x2a2, region: 0x106}, + 4: {lang: 0x1f, region: 0x99}, + 5: {lang: 0x3a, region: 0x6b}, + 7: {lang: 0x3b, region: 0x9c}, + 8: {lang: 0x1d7, region: 0x28}, + 9: {lang: 0x13, region: 0x9c}, + 10: {lang: 0x5b, region: 0x95}, + 11: {lang: 0x60, region: 0x52}, + 12: {lang: 0xb9, region: 0xb4}, + 13: {lang: 0x63, region: 0x95}, + 14: {lang: 0xa5, region: 0x35}, + 15: {lang: 0x3e9, region: 0x99}, + 17: {lang: 0x529, region: 0x12e}, + 18: {lang: 0x3b1, region: 0x99}, + 19: {lang: 0x15e, region: 0x78}, + 20: {lang: 0xc2, region: 0x95}, + 21: {lang: 0x9d, region: 0xe7}, + 22: {lang: 0xdb, region: 0x35}, + 23: {lang: 0xf3, region: 0x49}, + 24: {lang: 0x4f0, region: 0x12b}, + 25: {lang: 0xe7, region: 0x13e}, + 26: {lang: 0xe5, region: 0x135}, + 28: {lang: 0xf1, region: 0x6b}, + 30: {lang: 0x1a0, region: 0x5d}, + 31: {lang: 0x3e2, region: 0x106}, + 33: {lang: 0x1be, region: 0x99}, + 36: {lang: 0x15e, region: 0x78}, + 39: {lang: 0x133, region: 0x6b}, + 40: {lang: 0x431, region: 0x27}, + 41: {lang: 0x27, region: 0x6f}, + 43: {lang: 0x210, region: 0x7d}, + 44: {lang: 0xfe, region: 0x38}, + 46: {lang: 0x19b, region: 0x99}, + 47: {lang: 0x19e, region: 0x130}, + 48: {lang: 0x3e9, region: 0x99}, + 49: {lang: 0x136, region: 0x87}, + 50: {lang: 0x1a4, region: 0x99}, + 51: {lang: 0x39d, region: 0x99}, + 52: {lang: 0x529, region: 0x12e}, + 53: {lang: 0x254, region: 0xab}, + 54: {lang: 0x529, region: 0x53}, + 55: {lang: 0x1cb, region: 0xe7}, + 56: {lang: 0x529, region: 0x53}, + 57: {lang: 0x529, region: 0x12e}, + 58: {lang: 0x2fd, region: 0x9b}, + 59: {lang: 0x1bc, region: 0x97}, + 60: {lang: 0x200, region: 0xa2}, + 61: {lang: 0x1c5, region: 0x12b}, + 62: {lang: 0x1ca, region: 0xaf}, + 65: {lang: 0x1d5, region: 0x92}, + 67: {lang: 0x142, region: 0x9e}, + 68: {lang: 0x254, region: 0xab}, + 69: {lang: 0x20e, region: 0x95}, + 70: {lang: 0x200, region: 0xa2}, + 72: {lang: 0x135, region: 0xc4}, + 73: {lang: 0x200, region: 0xa2}, + 74: {lang: 0x3bb, region: 0xe8}, + 75: {lang: 0x24a, region: 0xa6}, + 76: {lang: 0x3fa, region: 0x99}, + 79: {lang: 0x251, region: 0x99}, + 80: {lang: 0x254, region: 0xab}, + 82: {lang: 0x88, region: 0x99}, + 83: {lang: 0x370, region: 0x123}, + 84: {lang: 0x2b8, region: 0xaf}, + 89: {lang: 0x29f, region: 0x99}, + 90: {lang: 0x2a8, region: 0x99}, + 91: {lang: 0x28f, region: 0x87}, + 92: {lang: 0x1a0, region: 0x87}, + 93: {lang: 0x2ac, region: 0x53}, + 95: {lang: 0x4f4, region: 0x12b}, + 96: {lang: 0x4f5, region: 0x12b}, + 97: {lang: 0x1be, region: 0x99}, + 99: {lang: 0x337, region: 0x9c}, + 100: {lang: 0x4f7, region: 0x53}, + 101: {lang: 0xa9, region: 0x53}, + 104: {lang: 0x2e8, region: 0x112}, + 105: {lang: 0x4f8, region: 0x10b}, + 106: {lang: 0x4f8, region: 0x10b}, + 107: {lang: 0x304, region: 0x99}, + 108: {lang: 0x31b, region: 0x99}, + 109: {lang: 0x30b, region: 0x53}, + 111: {lang: 0x31e, region: 0x35}, + 112: {lang: 0x30e, region: 0x99}, + 113: {lang: 0x414, region: 0xe8}, + 114: {lang: 0x331, region: 0xc4}, + 115: {lang: 0x4f9, region: 0x108}, + 116: {lang: 0x3b, region: 0xa1}, + 117: {lang: 0x353, region: 0xdb}, + 120: {lang: 0x2d0, region: 0x84}, + 121: {lang: 0x52a, region: 0x53}, + 122: {lang: 0x403, region: 0x96}, + 123: {lang: 0x3ee, region: 0x99}, + 124: {lang: 0x39b, region: 0xc5}, + 125: {lang: 0x395, region: 0x99}, + 126: {lang: 0x399, region: 0x135}, + 127: {lang: 0x429, region: 0x115}, + 128: {lang: 0x3b, region: 0x11c}, + 129: {lang: 0xfd, region: 0xc4}, + 130: {lang: 0x27d, region: 0x106}, + 131: {lang: 0x2c9, region: 0x53}, + 132: {lang: 0x39f, region: 0x9c}, + 133: {lang: 0x39f, region: 0x53}, + 135: {lang: 0x3ad, region: 0xb0}, + 137: {lang: 0x1c6, region: 0x53}, + 138: {lang: 0x4fd, region: 0x9c}, + 189: {lang: 0x3cb, region: 0x95}, + 191: {lang: 0x372, region: 0x10c}, + 192: {lang: 0x420, region: 0x97}, + 194: {lang: 0x4ff, region: 0x15e}, + 195: {lang: 0x3f0, region: 0x99}, + 196: {lang: 0x45, region: 0x135}, + 197: {lang: 0x139, region: 0x7b}, + 198: {lang: 0x3e9, region: 0x99}, + 200: {lang: 0x3e9, region: 0x99}, + 201: {lang: 0x3fa, region: 0x99}, + 202: {lang: 0x40c, region: 0xb3}, + 203: {lang: 0x433, region: 0x99}, + 204: {lang: 0xef, region: 0xc5}, + 205: {lang: 0x43e, region: 0x95}, + 206: {lang: 0x44d, region: 0x35}, + 207: {lang: 0x44e, region: 0x9b}, + 211: {lang: 0x45a, region: 0xe7}, + 212: {lang: 0x11a, region: 0x99}, + 213: {lang: 0x45e, region: 0x53}, + 214: {lang: 0x232, region: 0x53}, + 215: {lang: 0x450, region: 0x99}, + 216: {lang: 0x4a5, region: 0x53}, + 217: {lang: 0x9f, region: 0x13e}, + 218: {lang: 0x461, region: 0x99}, + 220: {lang: 0x528, region: 0xba}, + 221: {lang: 0x153, region: 0xe7}, + 222: {lang: 0x128, region: 0xcd}, + 223: {lang: 0x46b, region: 0x123}, + 224: {lang: 0xa9, region: 0x53}, + 225: {lang: 0x2ce, region: 0x99}, + 226: {lang: 0x4ad, region: 0x11c}, + 227: {lang: 0x4be, region: 0xb4}, + 229: {lang: 0x1ce, region: 0x99}, + 232: {lang: 0x3a9, region: 0x9c}, + 233: {lang: 0x22, region: 0x9b}, + 234: {lang: 0x1ea, region: 0x53}, + 235: {lang: 0xef, region: 0xc5}, +} + +type likelyScriptRegion struct { + region uint16 + script uint8 + flags uint8 +} + +// likelyLang is a lookup table, indexed by langID, for the most likely +// scripts and regions given incomplete information. If more entries exist for a +// given language, region and script are the index and size respectively +// of the list in likelyLangList. +// Size: 5320 bytes, 1330 elements +var likelyLang = [1330]likelyScriptRegion{ + 0: {region: 0x135, script: 0x57, flags: 0x0}, + 1: {region: 0x6f, script: 0x57, flags: 0x0}, + 2: {region: 0x165, script: 0x57, flags: 0x0}, + 3: {region: 0x165, script: 0x57, flags: 0x0}, + 4: {region: 0x165, script: 0x57, flags: 0x0}, + 5: {region: 0x7d, script: 0x1f, flags: 0x0}, + 6: {region: 0x165, script: 0x57, flags: 0x0}, + 7: {region: 0x165, script: 0x1f, flags: 0x0}, + 8: {region: 0x80, script: 0x57, flags: 0x0}, + 9: {region: 0x165, script: 0x57, flags: 0x0}, + 10: {region: 0x165, script: 0x57, flags: 0x0}, + 11: {region: 0x165, script: 0x57, flags: 0x0}, + 12: {region: 0x95, script: 0x57, flags: 0x0}, + 13: {region: 0x131, script: 0x57, flags: 0x0}, + 14: {region: 0x80, script: 0x57, flags: 0x0}, + 15: {region: 0x165, script: 0x57, flags: 0x0}, + 16: {region: 0x165, script: 0x57, flags: 0x0}, + 17: {region: 0x106, script: 0x1f, flags: 0x0}, + 18: {region: 0x165, script: 0x57, flags: 0x0}, + 19: {region: 0x9c, script: 0x9, flags: 0x0}, + 20: {region: 0x128, script: 0x5, flags: 0x0}, + 21: {region: 0x165, script: 0x57, flags: 0x0}, + 22: {region: 0x161, script: 0x57, flags: 0x0}, + 23: {region: 0x165, script: 0x57, flags: 0x0}, + 24: {region: 0x165, script: 0x57, flags: 0x0}, + 25: {region: 0x165, script: 0x57, flags: 0x0}, + 26: {region: 0x165, script: 0x57, flags: 0x0}, + 27: {region: 0x165, script: 0x57, flags: 0x0}, + 28: {region: 0x52, script: 0x57, flags: 0x0}, + 29: {region: 0x165, script: 0x57, flags: 0x0}, + 30: {region: 0x165, script: 0x57, flags: 0x0}, + 31: {region: 0x99, script: 0x4, flags: 0x0}, + 32: {region: 0x165, script: 0x57, flags: 0x0}, + 33: {region: 0x80, script: 0x57, flags: 0x0}, + 34: {region: 0x9b, script: 0xe9, flags: 0x0}, + 35: {region: 0x165, script: 0x57, flags: 0x0}, + 36: {region: 0x165, script: 0x57, flags: 0x0}, + 37: {region: 0x14d, script: 0x57, flags: 0x0}, + 38: {region: 0x106, script: 0x1f, flags: 0x0}, + 39: {region: 0x6f, script: 0x29, flags: 0x0}, + 40: {region: 0x165, script: 0x57, flags: 0x0}, + 41: {region: 0x165, script: 0x57, flags: 0x0}, + 42: {region: 0xd6, script: 0x57, flags: 0x0}, + 43: {region: 0x165, script: 0x57, flags: 0x0}, + 45: {region: 0x165, script: 0x57, flags: 0x0}, + 46: {region: 0x165, script: 0x57, flags: 0x0}, + 47: {region: 0x165, script: 0x57, flags: 0x0}, + 48: {region: 0x165, script: 0x57, flags: 0x0}, + 49: {region: 0x165, script: 0x57, flags: 0x0}, + 50: {region: 0x165, script: 0x57, flags: 0x0}, + 51: {region: 0x95, script: 0x57, flags: 0x0}, + 52: {region: 0x165, script: 0x5, flags: 0x0}, + 53: {region: 0x122, script: 0x5, flags: 0x0}, + 54: {region: 0x165, script: 0x57, flags: 0x0}, + 55: {region: 0x165, script: 0x57, flags: 0x0}, + 56: {region: 0x165, script: 0x57, flags: 0x0}, + 57: {region: 0x165, script: 0x57, flags: 0x0}, + 58: {region: 0x6b, script: 0x5, flags: 0x0}, + 59: {region: 0x0, script: 0x3, flags: 0x1}, + 60: {region: 0x165, script: 0x57, flags: 0x0}, + 61: {region: 0x51, script: 0x57, flags: 0x0}, + 62: {region: 0x3f, script: 0x57, flags: 0x0}, + 63: {region: 0x67, script: 0x5, flags: 0x0}, + 65: {region: 0xba, script: 0x5, flags: 0x0}, + 66: {region: 0x6b, script: 0x5, flags: 0x0}, + 67: {region: 0x99, script: 0xe, flags: 0x0}, + 68: {region: 0x12f, script: 0x57, flags: 0x0}, + 69: {region: 0x135, script: 0xc4, flags: 0x0}, + 70: {region: 0x165, script: 0x57, flags: 0x0}, + 71: {region: 0x165, script: 0x57, flags: 0x0}, + 72: {region: 0x6e, script: 0x57, flags: 0x0}, + 73: {region: 0x165, script: 0x57, flags: 0x0}, + 74: {region: 0x165, script: 0x57, flags: 0x0}, + 75: {region: 0x49, script: 0x57, flags: 0x0}, + 76: {region: 0x165, script: 0x57, flags: 0x0}, + 77: {region: 0x106, script: 0x1f, flags: 0x0}, + 78: {region: 0x165, script: 0x5, flags: 0x0}, + 79: {region: 0x165, script: 0x57, flags: 0x0}, + 80: {region: 0x165, script: 0x57, flags: 0x0}, + 81: {region: 0x165, script: 0x57, flags: 0x0}, + 82: {region: 0x99, script: 0x21, flags: 0x0}, + 83: {region: 0x165, script: 0x57, flags: 0x0}, + 84: {region: 0x165, script: 0x57, flags: 0x0}, + 85: {region: 0x165, script: 0x57, flags: 0x0}, + 86: {region: 0x3f, script: 0x57, flags: 0x0}, + 87: {region: 0x165, script: 0x57, flags: 0x0}, + 88: {region: 0x3, script: 0x5, flags: 0x1}, + 89: {region: 0x106, script: 0x1f, flags: 0x0}, + 90: {region: 0xe8, script: 0x5, flags: 0x0}, + 91: {region: 0x95, script: 0x57, flags: 0x0}, + 92: {region: 0xdb, script: 0x21, flags: 0x0}, + 93: {region: 0x2e, script: 0x57, flags: 0x0}, + 94: {region: 0x52, script: 0x57, flags: 0x0}, + 95: {region: 0x165, script: 0x57, flags: 0x0}, + 96: {region: 0x52, script: 0xb, flags: 0x0}, + 97: {region: 0x165, script: 0x57, flags: 0x0}, + 98: {region: 0x165, script: 0x57, flags: 0x0}, + 99: {region: 0x95, script: 0x57, flags: 0x0}, + 100: {region: 0x165, script: 0x57, flags: 0x0}, + 101: {region: 0x52, script: 0x57, flags: 0x0}, + 102: {region: 0x165, script: 0x57, flags: 0x0}, + 103: {region: 0x165, script: 0x57, flags: 0x0}, + 104: {region: 0x165, script: 0x57, flags: 0x0}, + 105: {region: 0x165, script: 0x57, flags: 0x0}, + 106: {region: 0x4f, script: 0x57, flags: 0x0}, + 107: {region: 0x165, script: 0x57, flags: 0x0}, + 108: {region: 0x165, script: 0x57, flags: 0x0}, + 109: {region: 0x165, script: 0x57, flags: 0x0}, + 110: {region: 0x165, script: 0x29, flags: 0x0}, + 111: {region: 0x165, script: 0x57, flags: 0x0}, + 112: {region: 0x165, script: 0x57, flags: 0x0}, + 113: {region: 0x47, script: 0x1f, flags: 0x0}, + 114: {region: 0x165, script: 0x57, flags: 0x0}, + 115: {region: 0x165, script: 0x57, flags: 0x0}, + 116: {region: 0x10b, script: 0x5, flags: 0x0}, + 117: {region: 0x162, script: 0x57, flags: 0x0}, + 118: {region: 0x165, script: 0x57, flags: 0x0}, + 119: {region: 0x95, script: 0x57, flags: 0x0}, + 120: {region: 0x165, script: 0x57, flags: 0x0}, + 121: {region: 0x12f, script: 0x57, flags: 0x0}, + 122: {region: 0x52, script: 0x57, flags: 0x0}, + 123: {region: 0x99, script: 0xd7, flags: 0x0}, + 124: {region: 0xe8, script: 0x5, flags: 0x0}, + 125: {region: 0x99, script: 0x21, flags: 0x0}, + 126: {region: 0x38, script: 0x1f, flags: 0x0}, + 127: {region: 0x99, script: 0x21, flags: 0x0}, + 128: {region: 0xe8, script: 0x5, flags: 0x0}, + 129: {region: 0x12b, script: 0x31, flags: 0x0}, + 131: {region: 0x99, script: 0x21, flags: 0x0}, + 132: {region: 0x165, script: 0x57, flags: 0x0}, + 133: {region: 0x99, script: 0x21, flags: 0x0}, + 134: {region: 0xe7, script: 0x57, flags: 0x0}, + 135: {region: 0x165, script: 0x57, flags: 0x0}, + 136: {region: 0x99, script: 0x21, flags: 0x0}, + 137: {region: 0x165, script: 0x57, flags: 0x0}, + 138: {region: 0x13f, script: 0x57, flags: 0x0}, + 139: {region: 0x165, script: 0x57, flags: 0x0}, + 140: {region: 0x165, script: 0x57, flags: 0x0}, + 141: {region: 0xe7, script: 0x57, flags: 0x0}, + 142: {region: 0x165, script: 0x57, flags: 0x0}, + 143: {region: 0xd6, script: 0x57, flags: 0x0}, + 144: {region: 0x165, script: 0x57, flags: 0x0}, + 145: {region: 0x165, script: 0x57, flags: 0x0}, + 146: {region: 0x165, script: 0x57, flags: 0x0}, + 147: {region: 0x165, script: 0x29, flags: 0x0}, + 148: {region: 0x99, script: 0x21, flags: 0x0}, + 149: {region: 0x95, script: 0x57, flags: 0x0}, + 150: {region: 0x165, script: 0x57, flags: 0x0}, + 151: {region: 0x165, script: 0x57, flags: 0x0}, + 152: {region: 0x114, script: 0x57, flags: 0x0}, + 153: {region: 0x165, script: 0x57, flags: 0x0}, + 154: {region: 0x165, script: 0x57, flags: 0x0}, + 155: {region: 0x52, script: 0x57, flags: 0x0}, + 156: {region: 0x165, script: 0x57, flags: 0x0}, + 157: {region: 0xe7, script: 0x57, flags: 0x0}, + 158: {region: 0x165, script: 0x57, flags: 0x0}, + 159: {region: 0x13e, script: 0xd9, flags: 0x0}, + 160: {region: 0xc3, script: 0x57, flags: 0x0}, + 161: {region: 0x165, script: 0x57, flags: 0x0}, + 162: {region: 0x165, script: 0x57, flags: 0x0}, + 163: {region: 0xc3, script: 0x57, flags: 0x0}, + 164: {region: 0x165, script: 0x57, flags: 0x0}, + 165: {region: 0x35, script: 0xe, flags: 0x0}, + 166: {region: 0x165, script: 0x57, flags: 0x0}, + 167: {region: 0x165, script: 0x57, flags: 0x0}, + 168: {region: 0x165, script: 0x57, flags: 0x0}, + 169: {region: 0x53, script: 0xe0, flags: 0x0}, + 170: {region: 0x165, script: 0x57, flags: 0x0}, + 171: {region: 0x165, script: 0x57, flags: 0x0}, + 172: {region: 0x165, script: 0x57, flags: 0x0}, + 173: {region: 0x99, script: 0xe, flags: 0x0}, + 174: {region: 0x165, script: 0x57, flags: 0x0}, + 175: {region: 0x9c, script: 0x5, flags: 0x0}, + 176: {region: 0x165, script: 0x57, flags: 0x0}, + 177: {region: 0x4f, script: 0x57, flags: 0x0}, + 178: {region: 0x78, script: 0x57, flags: 0x0}, + 179: {region: 0x99, script: 0x21, flags: 0x0}, + 180: {region: 0xe8, script: 0x5, flags: 0x0}, + 181: {region: 0x99, script: 0x21, flags: 0x0}, + 182: {region: 0x165, script: 0x57, flags: 0x0}, + 183: {region: 0x33, script: 0x57, flags: 0x0}, + 184: {region: 0x165, script: 0x57, flags: 0x0}, + 185: {region: 0xb4, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x57, flags: 0x0}, + 187: {region: 0x165, script: 0x29, flags: 0x0}, + 188: {region: 0xe7, script: 0x57, flags: 0x0}, + 189: {region: 0x165, script: 0x57, flags: 0x0}, + 190: {region: 0xe8, script: 0x21, flags: 0x0}, + 191: {region: 0x106, script: 0x1f, flags: 0x0}, + 192: {region: 0x15f, script: 0x57, flags: 0x0}, + 193: {region: 0x165, script: 0x57, flags: 0x0}, + 194: {region: 0x95, script: 0x57, flags: 0x0}, + 195: {region: 0x165, script: 0x57, flags: 0x0}, + 196: {region: 0x52, script: 0x57, flags: 0x0}, + 197: {region: 0x165, script: 0x57, flags: 0x0}, + 198: {region: 0x165, script: 0x57, flags: 0x0}, + 199: {region: 0x165, script: 0x57, flags: 0x0}, + 200: {region: 0x86, script: 0x57, flags: 0x0}, + 201: {region: 0x165, script: 0x57, flags: 0x0}, + 202: {region: 0x165, script: 0x57, flags: 0x0}, + 203: {region: 0x165, script: 0x57, flags: 0x0}, + 204: {region: 0x165, script: 0x57, flags: 0x0}, + 205: {region: 0x6d, script: 0x29, flags: 0x0}, + 206: {region: 0x165, script: 0x57, flags: 0x0}, + 207: {region: 0x165, script: 0x57, flags: 0x0}, + 208: {region: 0x52, script: 0x57, flags: 0x0}, + 209: {region: 0x165, script: 0x57, flags: 0x0}, + 210: {region: 0x165, script: 0x57, flags: 0x0}, + 211: {region: 0xc3, script: 0x57, flags: 0x0}, + 212: {region: 0x165, script: 0x57, flags: 0x0}, + 213: {region: 0x165, script: 0x57, flags: 0x0}, + 214: {region: 0x165, script: 0x57, flags: 0x0}, + 215: {region: 0x6e, script: 0x57, flags: 0x0}, + 216: {region: 0x165, script: 0x57, flags: 0x0}, + 217: {region: 0x165, script: 0x57, flags: 0x0}, + 218: {region: 0xd6, script: 0x57, flags: 0x0}, + 219: {region: 0x35, script: 0x16, flags: 0x0}, + 220: {region: 0x106, script: 0x1f, flags: 0x0}, + 221: {region: 0xe7, script: 0x57, flags: 0x0}, + 222: {region: 0x165, script: 0x57, flags: 0x0}, + 223: {region: 0x131, script: 0x57, flags: 0x0}, + 224: {region: 0x8a, script: 0x57, flags: 0x0}, + 225: {region: 0x75, script: 0x57, flags: 0x0}, + 226: {region: 0x106, script: 0x1f, flags: 0x0}, + 227: {region: 0x135, script: 0x57, flags: 0x0}, + 228: {region: 0x49, script: 0x57, flags: 0x0}, + 229: {region: 0x135, script: 0x1a, flags: 0x0}, + 230: {region: 0xa6, script: 0x5, flags: 0x0}, + 231: {region: 0x13e, script: 0x19, flags: 0x0}, + 232: {region: 0x165, script: 0x57, flags: 0x0}, + 233: {region: 0x9b, script: 0x5, flags: 0x0}, + 234: {region: 0x165, script: 0x57, flags: 0x0}, + 235: {region: 0x165, script: 0x57, flags: 0x0}, + 236: {region: 0x165, script: 0x57, flags: 0x0}, + 237: {region: 0x165, script: 0x57, flags: 0x0}, + 238: {region: 0x165, script: 0x57, flags: 0x0}, + 239: {region: 0xc5, script: 0xcc, flags: 0x0}, + 240: {region: 0x78, script: 0x57, flags: 0x0}, + 241: {region: 0x6b, script: 0x1c, flags: 0x0}, + 242: {region: 0xe7, script: 0x57, flags: 0x0}, + 243: {region: 0x49, script: 0x17, flags: 0x0}, + 244: {region: 0x130, script: 0x1f, flags: 0x0}, + 245: {region: 0x49, script: 0x17, flags: 0x0}, + 246: {region: 0x49, script: 0x17, flags: 0x0}, + 247: {region: 0x49, script: 0x17, flags: 0x0}, + 248: {region: 0x49, script: 0x17, flags: 0x0}, + 249: {region: 0x10a, script: 0x57, flags: 0x0}, + 250: {region: 0x5e, script: 0x57, flags: 0x0}, + 251: {region: 0xe9, script: 0x57, flags: 0x0}, + 252: {region: 0x49, script: 0x17, flags: 0x0}, + 253: {region: 0xc4, script: 0x81, flags: 0x0}, + 254: {region: 0x8, script: 0x2, flags: 0x1}, + 255: {region: 0x106, script: 0x1f, flags: 0x0}, + 256: {region: 0x7b, script: 0x57, flags: 0x0}, + 257: {region: 0x63, script: 0x57, flags: 0x0}, + 258: {region: 0x165, script: 0x57, flags: 0x0}, + 259: {region: 0x165, script: 0x57, flags: 0x0}, + 260: {region: 0x165, script: 0x57, flags: 0x0}, + 261: {region: 0x165, script: 0x57, flags: 0x0}, + 262: {region: 0x135, script: 0x57, flags: 0x0}, + 263: {region: 0x106, script: 0x1f, flags: 0x0}, + 264: {region: 0xa4, script: 0x57, flags: 0x0}, + 265: {region: 0x165, script: 0x57, flags: 0x0}, + 266: {region: 0x165, script: 0x57, flags: 0x0}, + 267: {region: 0x99, script: 0x5, flags: 0x0}, + 268: {region: 0x165, script: 0x57, flags: 0x0}, + 269: {region: 0x60, script: 0x57, flags: 0x0}, + 270: {region: 0x165, script: 0x57, flags: 0x0}, + 271: {region: 0x49, script: 0x57, flags: 0x0}, + 272: {region: 0x165, script: 0x57, flags: 0x0}, + 273: {region: 0x165, script: 0x57, flags: 0x0}, + 274: {region: 0x165, script: 0x57, flags: 0x0}, + 275: {region: 0x165, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x57, flags: 0x0}, + 277: {region: 0x165, script: 0x57, flags: 0x0}, + 278: {region: 0x165, script: 0x57, flags: 0x0}, + 279: {region: 0xd4, script: 0x57, flags: 0x0}, + 280: {region: 0x4f, script: 0x57, flags: 0x0}, + 281: {region: 0x165, script: 0x57, flags: 0x0}, + 282: {region: 0x99, script: 0x5, flags: 0x0}, + 283: {region: 0x165, script: 0x57, flags: 0x0}, + 284: {region: 0x165, script: 0x57, flags: 0x0}, + 285: {region: 0x165, script: 0x57, flags: 0x0}, + 286: {region: 0x165, script: 0x29, flags: 0x0}, + 287: {region: 0x60, script: 0x57, flags: 0x0}, + 288: {region: 0xc3, script: 0x57, flags: 0x0}, + 289: {region: 0xd0, script: 0x57, flags: 0x0}, + 290: {region: 0x165, script: 0x57, flags: 0x0}, + 291: {region: 0xdb, script: 0x21, flags: 0x0}, + 292: {region: 0x52, script: 0x57, flags: 0x0}, + 293: {region: 0x165, script: 0x57, flags: 0x0}, + 294: {region: 0x165, script: 0x57, flags: 0x0}, + 295: {region: 0x165, script: 0x57, flags: 0x0}, + 296: {region: 0xcd, script: 0xde, flags: 0x0}, + 297: {region: 0x165, script: 0x57, flags: 0x0}, + 298: {region: 0x165, script: 0x57, flags: 0x0}, + 299: {region: 0x114, script: 0x57, flags: 0x0}, + 300: {region: 0x37, script: 0x57, flags: 0x0}, + 301: {region: 0x43, script: 0xe0, flags: 0x0}, + 302: {region: 0x165, script: 0x57, flags: 0x0}, + 303: {region: 0xa4, script: 0x57, flags: 0x0}, + 304: {region: 0x80, script: 0x57, flags: 0x0}, + 305: {region: 0xd6, script: 0x57, flags: 0x0}, + 306: {region: 0x9e, script: 0x57, flags: 0x0}, + 307: {region: 0x6b, script: 0x27, flags: 0x0}, + 308: {region: 0x165, script: 0x57, flags: 0x0}, + 309: {region: 0xc4, script: 0x48, flags: 0x0}, + 310: {region: 0x87, script: 0x31, flags: 0x0}, + 311: {region: 0x165, script: 0x57, flags: 0x0}, + 312: {region: 0x165, script: 0x57, flags: 0x0}, + 313: {region: 0xa, script: 0x2, flags: 0x1}, + 314: {region: 0x165, script: 0x57, flags: 0x0}, + 315: {region: 0x165, script: 0x57, flags: 0x0}, + 316: {region: 0x1, script: 0x57, flags: 0x0}, + 317: {region: 0x165, script: 0x57, flags: 0x0}, + 318: {region: 0x6e, script: 0x57, flags: 0x0}, + 319: {region: 0x135, script: 0x57, flags: 0x0}, + 320: {region: 0x6a, script: 0x57, flags: 0x0}, + 321: {region: 0x165, script: 0x57, flags: 0x0}, + 322: {region: 0x9e, script: 0x43, flags: 0x0}, + 323: {region: 0x165, script: 0x57, flags: 0x0}, + 324: {region: 0x165, script: 0x57, flags: 0x0}, + 325: {region: 0x6e, script: 0x57, flags: 0x0}, + 326: {region: 0x52, script: 0x57, flags: 0x0}, + 327: {region: 0x6e, script: 0x57, flags: 0x0}, + 328: {region: 0x9c, script: 0x5, flags: 0x0}, + 329: {region: 0x165, script: 0x57, flags: 0x0}, + 330: {region: 0x165, script: 0x57, flags: 0x0}, + 331: {region: 0x165, script: 0x57, flags: 0x0}, + 332: {region: 0x165, script: 0x57, flags: 0x0}, + 333: {region: 0x86, script: 0x57, flags: 0x0}, + 334: {region: 0xc, script: 0x2, flags: 0x1}, + 335: {region: 0x165, script: 0x57, flags: 0x0}, + 336: {region: 0xc3, script: 0x57, flags: 0x0}, + 337: {region: 0x72, script: 0x57, flags: 0x0}, + 338: {region: 0x10b, script: 0x5, flags: 0x0}, + 339: {region: 0xe7, script: 0x57, flags: 0x0}, + 340: {region: 0x10c, script: 0x57, flags: 0x0}, + 341: {region: 0x73, script: 0x57, flags: 0x0}, + 342: {region: 0x165, script: 0x57, flags: 0x0}, + 343: {region: 0x165, script: 0x57, flags: 0x0}, + 344: {region: 0x76, script: 0x57, flags: 0x0}, + 345: {region: 0x165, script: 0x57, flags: 0x0}, + 346: {region: 0x3b, script: 0x57, flags: 0x0}, + 347: {region: 0x165, script: 0x57, flags: 0x0}, + 348: {region: 0x165, script: 0x57, flags: 0x0}, + 349: {region: 0x165, script: 0x57, flags: 0x0}, + 350: {region: 0x78, script: 0x57, flags: 0x0}, + 351: {region: 0x135, script: 0x57, flags: 0x0}, + 352: {region: 0x78, script: 0x57, flags: 0x0}, + 353: {region: 0x60, script: 0x57, flags: 0x0}, + 354: {region: 0x60, script: 0x57, flags: 0x0}, + 355: {region: 0x52, script: 0x5, flags: 0x0}, + 356: {region: 0x140, script: 0x57, flags: 0x0}, + 357: {region: 0x165, script: 0x57, flags: 0x0}, + 358: {region: 0x84, script: 0x57, flags: 0x0}, + 359: {region: 0x165, script: 0x57, flags: 0x0}, + 360: {region: 0xd4, script: 0x57, flags: 0x0}, + 361: {region: 0x9e, script: 0x57, flags: 0x0}, + 362: {region: 0xd6, script: 0x57, flags: 0x0}, + 363: {region: 0x165, script: 0x57, flags: 0x0}, + 364: {region: 0x10b, script: 0x57, flags: 0x0}, + 365: {region: 0xd9, script: 0x57, flags: 0x0}, + 366: {region: 0x96, script: 0x57, flags: 0x0}, + 367: {region: 0x80, script: 0x57, flags: 0x0}, + 368: {region: 0x165, script: 0x57, flags: 0x0}, + 369: {region: 0xbc, script: 0x57, flags: 0x0}, + 370: {region: 0x165, script: 0x57, flags: 0x0}, + 371: {region: 0x165, script: 0x57, flags: 0x0}, + 372: {region: 0x165, script: 0x57, flags: 0x0}, + 373: {region: 0x53, script: 0x38, flags: 0x0}, + 374: {region: 0x165, script: 0x57, flags: 0x0}, + 375: {region: 0x95, script: 0x57, flags: 0x0}, + 376: {region: 0x165, script: 0x57, flags: 0x0}, + 377: {region: 0x165, script: 0x57, flags: 0x0}, + 378: {region: 0x99, script: 0x21, flags: 0x0}, + 379: {region: 0x165, script: 0x57, flags: 0x0}, + 380: {region: 0x9c, script: 0x5, flags: 0x0}, + 381: {region: 0x7e, script: 0x57, flags: 0x0}, + 382: {region: 0x7b, script: 0x57, flags: 0x0}, + 383: {region: 0x165, script: 0x57, flags: 0x0}, + 384: {region: 0x165, script: 0x57, flags: 0x0}, + 385: {region: 0x165, script: 0x57, flags: 0x0}, + 386: {region: 0x165, script: 0x57, flags: 0x0}, + 387: {region: 0x165, script: 0x57, flags: 0x0}, + 388: {region: 0x165, script: 0x57, flags: 0x0}, + 389: {region: 0x6f, script: 0x29, flags: 0x0}, + 390: {region: 0x165, script: 0x57, flags: 0x0}, + 391: {region: 0xdb, script: 0x21, flags: 0x0}, + 392: {region: 0x165, script: 0x57, flags: 0x0}, + 393: {region: 0xa7, script: 0x57, flags: 0x0}, + 394: {region: 0x165, script: 0x57, flags: 0x0}, + 395: {region: 0xe8, script: 0x5, flags: 0x0}, + 396: {region: 0x165, script: 0x57, flags: 0x0}, + 397: {region: 0xe8, script: 0x5, flags: 0x0}, + 398: {region: 0x165, script: 0x57, flags: 0x0}, + 399: {region: 0x165, script: 0x57, flags: 0x0}, + 400: {region: 0x6e, script: 0x57, flags: 0x0}, + 401: {region: 0x9c, script: 0x5, flags: 0x0}, + 402: {region: 0x165, script: 0x57, flags: 0x0}, + 403: {region: 0x165, script: 0x29, flags: 0x0}, + 404: {region: 0xf1, script: 0x57, flags: 0x0}, + 405: {region: 0x165, script: 0x57, flags: 0x0}, + 406: {region: 0x165, script: 0x57, flags: 0x0}, + 407: {region: 0x165, script: 0x57, flags: 0x0}, + 408: {region: 0x165, script: 0x29, flags: 0x0}, + 409: {region: 0x165, script: 0x57, flags: 0x0}, + 410: {region: 0x99, script: 0x21, flags: 0x0}, + 411: {region: 0x99, script: 0xda, flags: 0x0}, + 412: {region: 0x95, script: 0x57, flags: 0x0}, + 413: {region: 0xd9, script: 0x57, flags: 0x0}, + 414: {region: 0x130, script: 0x2f, flags: 0x0}, + 415: {region: 0x165, script: 0x57, flags: 0x0}, + 416: {region: 0xe, script: 0x2, flags: 0x1}, + 417: {region: 0x99, script: 0xe, flags: 0x0}, + 418: {region: 0x165, script: 0x57, flags: 0x0}, + 419: {region: 0x4e, script: 0x57, flags: 0x0}, + 420: {region: 0x99, script: 0x32, flags: 0x0}, + 421: {region: 0x41, script: 0x57, flags: 0x0}, + 422: {region: 0x54, script: 0x57, flags: 0x0}, + 423: {region: 0x165, script: 0x57, flags: 0x0}, + 424: {region: 0x80, script: 0x57, flags: 0x0}, + 425: {region: 0x165, script: 0x57, flags: 0x0}, + 426: {region: 0x165, script: 0x57, flags: 0x0}, + 427: {region: 0xa4, script: 0x57, flags: 0x0}, + 428: {region: 0x98, script: 0x57, flags: 0x0}, + 429: {region: 0x165, script: 0x57, flags: 0x0}, + 430: {region: 0xdb, script: 0x21, flags: 0x0}, + 431: {region: 0x165, script: 0x57, flags: 0x0}, + 432: {region: 0x165, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x57, flags: 0x0}, + 434: {region: 0x165, script: 0x5, flags: 0x0}, + 435: {region: 0x165, script: 0x57, flags: 0x0}, + 436: {region: 0x10, script: 0x3, flags: 0x1}, + 437: {region: 0x165, script: 0x57, flags: 0x0}, + 438: {region: 0x53, script: 0x38, flags: 0x0}, + 439: {region: 0x165, script: 0x57, flags: 0x0}, + 440: {region: 0x135, script: 0x57, flags: 0x0}, + 441: {region: 0x24, script: 0x5, flags: 0x0}, + 442: {region: 0x165, script: 0x57, flags: 0x0}, + 443: {region: 0x165, script: 0x29, flags: 0x0}, + 444: {region: 0x97, script: 0x3b, flags: 0x0}, + 445: {region: 0x165, script: 0x57, flags: 0x0}, + 446: {region: 0x99, script: 0x21, flags: 0x0}, + 447: {region: 0x165, script: 0x57, flags: 0x0}, + 448: {region: 0x73, script: 0x57, flags: 0x0}, + 449: {region: 0x165, script: 0x57, flags: 0x0}, + 450: {region: 0x165, script: 0x57, flags: 0x0}, + 451: {region: 0xe7, script: 0x57, flags: 0x0}, + 452: {region: 0x165, script: 0x57, flags: 0x0}, + 453: {region: 0x12b, script: 0x3d, flags: 0x0}, + 454: {region: 0x53, script: 0x89, flags: 0x0}, + 455: {region: 0x165, script: 0x57, flags: 0x0}, + 456: {region: 0xe8, script: 0x5, flags: 0x0}, + 457: {region: 0x99, script: 0x21, flags: 0x0}, + 458: {region: 0xaf, script: 0x3e, flags: 0x0}, + 459: {region: 0xe7, script: 0x57, flags: 0x0}, + 460: {region: 0xe8, script: 0x5, flags: 0x0}, + 461: {region: 0xe6, script: 0x57, flags: 0x0}, + 462: {region: 0x99, script: 0x21, flags: 0x0}, + 463: {region: 0x99, script: 0x21, flags: 0x0}, + 464: {region: 0x165, script: 0x57, flags: 0x0}, + 465: {region: 0x90, script: 0x57, flags: 0x0}, + 466: {region: 0x60, script: 0x57, flags: 0x0}, + 467: {region: 0x53, script: 0x38, flags: 0x0}, + 468: {region: 0x91, script: 0x57, flags: 0x0}, + 469: {region: 0x92, script: 0x57, flags: 0x0}, + 470: {region: 0x165, script: 0x57, flags: 0x0}, + 471: {region: 0x28, script: 0x8, flags: 0x0}, + 472: {region: 0xd2, script: 0x57, flags: 0x0}, + 473: {region: 0x78, script: 0x57, flags: 0x0}, + 474: {region: 0x165, script: 0x57, flags: 0x0}, + 475: {region: 0x165, script: 0x57, flags: 0x0}, + 476: {region: 0xd0, script: 0x57, flags: 0x0}, + 477: {region: 0xd6, script: 0x57, flags: 0x0}, + 478: {region: 0x165, script: 0x57, flags: 0x0}, + 479: {region: 0x165, script: 0x57, flags: 0x0}, + 480: {region: 0x165, script: 0x57, flags: 0x0}, + 481: {region: 0x95, script: 0x57, flags: 0x0}, + 482: {region: 0x165, script: 0x57, flags: 0x0}, + 483: {region: 0x165, script: 0x57, flags: 0x0}, + 484: {region: 0x165, script: 0x57, flags: 0x0}, + 486: {region: 0x122, script: 0x57, flags: 0x0}, + 487: {region: 0xd6, script: 0x57, flags: 0x0}, + 488: {region: 0x165, script: 0x57, flags: 0x0}, + 489: {region: 0x165, script: 0x57, flags: 0x0}, + 490: {region: 0x53, script: 0xea, flags: 0x0}, + 491: {region: 0x165, script: 0x57, flags: 0x0}, + 492: {region: 0x135, script: 0x57, flags: 0x0}, + 493: {region: 0x165, script: 0x57, flags: 0x0}, + 494: {region: 0x49, script: 0x57, flags: 0x0}, + 495: {region: 0x165, script: 0x57, flags: 0x0}, + 496: {region: 0x165, script: 0x57, flags: 0x0}, + 497: {region: 0xe7, script: 0x57, flags: 0x0}, + 498: {region: 0x165, script: 0x57, flags: 0x0}, + 499: {region: 0x95, script: 0x57, flags: 0x0}, + 500: {region: 0x106, script: 0x1f, flags: 0x0}, + 501: {region: 0x1, script: 0x57, flags: 0x0}, + 502: {region: 0x165, script: 0x57, flags: 0x0}, + 503: {region: 0x165, script: 0x57, flags: 0x0}, + 504: {region: 0x9d, script: 0x57, flags: 0x0}, + 505: {region: 0x9e, script: 0x57, flags: 0x0}, + 506: {region: 0x49, script: 0x17, flags: 0x0}, + 507: {region: 0x97, script: 0x3b, flags: 0x0}, + 508: {region: 0x165, script: 0x57, flags: 0x0}, + 509: {region: 0x165, script: 0x57, flags: 0x0}, + 510: {region: 0x106, script: 0x57, flags: 0x0}, + 511: {region: 0x165, script: 0x57, flags: 0x0}, + 512: {region: 0xa2, script: 0x46, flags: 0x0}, + 513: {region: 0x165, script: 0x57, flags: 0x0}, + 514: {region: 0xa0, script: 0x57, flags: 0x0}, + 515: {region: 0x1, script: 0x57, flags: 0x0}, + 516: {region: 0x165, script: 0x57, flags: 0x0}, + 517: {region: 0x165, script: 0x57, flags: 0x0}, + 518: {region: 0x165, script: 0x57, flags: 0x0}, + 519: {region: 0x52, script: 0x57, flags: 0x0}, + 520: {region: 0x130, script: 0x3b, flags: 0x0}, + 521: {region: 0x165, script: 0x57, flags: 0x0}, + 522: {region: 0x12f, script: 0x57, flags: 0x0}, + 523: {region: 0xdb, script: 0x21, flags: 0x0}, + 524: {region: 0x165, script: 0x57, flags: 0x0}, + 525: {region: 0x63, script: 0x57, flags: 0x0}, + 526: {region: 0x95, script: 0x57, flags: 0x0}, + 527: {region: 0x95, script: 0x57, flags: 0x0}, + 528: {region: 0x7d, script: 0x2b, flags: 0x0}, + 529: {region: 0x137, script: 0x1f, flags: 0x0}, + 530: {region: 0x67, script: 0x57, flags: 0x0}, + 531: {region: 0xc4, script: 0x57, flags: 0x0}, + 532: {region: 0x165, script: 0x57, flags: 0x0}, + 533: {region: 0x165, script: 0x57, flags: 0x0}, + 534: {region: 0xd6, script: 0x57, flags: 0x0}, + 535: {region: 0xa4, script: 0x57, flags: 0x0}, + 536: {region: 0xc3, script: 0x57, flags: 0x0}, + 537: {region: 0x106, script: 0x1f, flags: 0x0}, + 538: {region: 0x165, script: 0x57, flags: 0x0}, + 539: {region: 0x165, script: 0x57, flags: 0x0}, + 540: {region: 0x165, script: 0x57, flags: 0x0}, + 541: {region: 0x165, script: 0x57, flags: 0x0}, + 542: {region: 0xd4, script: 0x5, flags: 0x0}, + 543: {region: 0xd6, script: 0x57, flags: 0x0}, + 544: {region: 0x164, script: 0x57, flags: 0x0}, + 545: {region: 0x165, script: 0x57, flags: 0x0}, + 546: {region: 0x165, script: 0x57, flags: 0x0}, + 547: {region: 0x12f, script: 0x57, flags: 0x0}, + 548: {region: 0x122, script: 0x5, flags: 0x0}, + 549: {region: 0x165, script: 0x57, flags: 0x0}, + 550: {region: 0x123, script: 0xdf, flags: 0x0}, + 551: {region: 0x5a, script: 0x57, flags: 0x0}, + 552: {region: 0x52, script: 0x57, flags: 0x0}, + 553: {region: 0x165, script: 0x57, flags: 0x0}, + 554: {region: 0x4f, script: 0x57, flags: 0x0}, + 555: {region: 0x99, script: 0x21, flags: 0x0}, + 556: {region: 0x99, script: 0x21, flags: 0x0}, + 557: {region: 0x4b, script: 0x57, flags: 0x0}, + 558: {region: 0x95, script: 0x57, flags: 0x0}, + 559: {region: 0x165, script: 0x57, flags: 0x0}, + 560: {region: 0x41, script: 0x57, flags: 0x0}, + 561: {region: 0x99, script: 0x57, flags: 0x0}, + 562: {region: 0x53, script: 0xd6, flags: 0x0}, + 563: {region: 0x99, script: 0x21, flags: 0x0}, + 564: {region: 0xc3, script: 0x57, flags: 0x0}, + 565: {region: 0x165, script: 0x57, flags: 0x0}, + 566: {region: 0x99, script: 0x72, flags: 0x0}, + 567: {region: 0xe8, script: 0x5, flags: 0x0}, + 568: {region: 0x165, script: 0x57, flags: 0x0}, + 569: {region: 0xa4, script: 0x57, flags: 0x0}, + 570: {region: 0x165, script: 0x57, flags: 0x0}, + 571: {region: 0x12b, script: 0x57, flags: 0x0}, + 572: {region: 0x165, script: 0x57, flags: 0x0}, + 573: {region: 0xd2, script: 0x57, flags: 0x0}, + 574: {region: 0x165, script: 0x57, flags: 0x0}, + 575: {region: 0xaf, script: 0x54, flags: 0x0}, + 576: {region: 0x165, script: 0x57, flags: 0x0}, + 577: {region: 0x165, script: 0x57, flags: 0x0}, + 578: {region: 0x13, script: 0x6, flags: 0x1}, + 579: {region: 0x165, script: 0x57, flags: 0x0}, + 580: {region: 0x52, script: 0x57, flags: 0x0}, + 581: {region: 0x82, script: 0x57, flags: 0x0}, + 582: {region: 0xa4, script: 0x57, flags: 0x0}, + 583: {region: 0x165, script: 0x57, flags: 0x0}, + 584: {region: 0x165, script: 0x57, flags: 0x0}, + 585: {region: 0x165, script: 0x57, flags: 0x0}, + 586: {region: 0xa6, script: 0x4b, flags: 0x0}, + 587: {region: 0x2a, script: 0x57, flags: 0x0}, + 588: {region: 0x165, script: 0x57, flags: 0x0}, + 589: {region: 0x165, script: 0x57, flags: 0x0}, + 590: {region: 0x165, script: 0x57, flags: 0x0}, + 591: {region: 0x165, script: 0x57, flags: 0x0}, + 592: {region: 0x165, script: 0x57, flags: 0x0}, + 593: {region: 0x99, script: 0x4f, flags: 0x0}, + 594: {region: 0x8b, script: 0x57, flags: 0x0}, + 595: {region: 0x165, script: 0x57, flags: 0x0}, + 596: {region: 0xab, script: 0x50, flags: 0x0}, + 597: {region: 0x106, script: 0x1f, flags: 0x0}, + 598: {region: 0x99, script: 0x21, flags: 0x0}, + 599: {region: 0x165, script: 0x57, flags: 0x0}, + 600: {region: 0x75, script: 0x57, flags: 0x0}, + 601: {region: 0x165, script: 0x57, flags: 0x0}, + 602: {region: 0xb4, script: 0x57, flags: 0x0}, + 603: {region: 0x165, script: 0x57, flags: 0x0}, + 604: {region: 0x165, script: 0x57, flags: 0x0}, + 605: {region: 0x165, script: 0x57, flags: 0x0}, + 606: {region: 0x165, script: 0x57, flags: 0x0}, + 607: {region: 0x165, script: 0x57, flags: 0x0}, + 608: {region: 0x165, script: 0x57, flags: 0x0}, + 609: {region: 0x165, script: 0x57, flags: 0x0}, + 610: {region: 0x165, script: 0x29, flags: 0x0}, + 611: {region: 0x165, script: 0x57, flags: 0x0}, + 612: {region: 0x106, script: 0x1f, flags: 0x0}, + 613: {region: 0x112, script: 0x57, flags: 0x0}, + 614: {region: 0xe7, script: 0x57, flags: 0x0}, + 615: {region: 0x106, script: 0x57, flags: 0x0}, + 616: {region: 0x165, script: 0x57, flags: 0x0}, + 617: {region: 0x99, script: 0x21, flags: 0x0}, + 618: {region: 0x99, script: 0x5, flags: 0x0}, + 619: {region: 0x12f, script: 0x57, flags: 0x0}, + 620: {region: 0x165, script: 0x57, flags: 0x0}, + 621: {region: 0x52, script: 0x57, flags: 0x0}, + 622: {region: 0x60, script: 0x57, flags: 0x0}, + 623: {region: 0x165, script: 0x57, flags: 0x0}, + 624: {region: 0x165, script: 0x57, flags: 0x0}, + 625: {region: 0x165, script: 0x29, flags: 0x0}, + 626: {region: 0x165, script: 0x57, flags: 0x0}, + 627: {region: 0x165, script: 0x57, flags: 0x0}, + 628: {region: 0x19, script: 0x3, flags: 0x1}, + 629: {region: 0x165, script: 0x57, flags: 0x0}, + 630: {region: 0x165, script: 0x57, flags: 0x0}, + 631: {region: 0x165, script: 0x57, flags: 0x0}, + 632: {region: 0x165, script: 0x57, flags: 0x0}, + 633: {region: 0x106, script: 0x1f, flags: 0x0}, + 634: {region: 0x165, script: 0x57, flags: 0x0}, + 635: {region: 0x165, script: 0x57, flags: 0x0}, + 636: {region: 0x165, script: 0x57, flags: 0x0}, + 637: {region: 0x106, script: 0x1f, flags: 0x0}, + 638: {region: 0x165, script: 0x57, flags: 0x0}, + 639: {region: 0x95, script: 0x57, flags: 0x0}, + 640: {region: 0xe8, script: 0x5, flags: 0x0}, + 641: {region: 0x7b, script: 0x57, flags: 0x0}, + 642: {region: 0x165, script: 0x57, flags: 0x0}, + 643: {region: 0x165, script: 0x57, flags: 0x0}, + 644: {region: 0x165, script: 0x57, flags: 0x0}, + 645: {region: 0x165, script: 0x29, flags: 0x0}, + 646: {region: 0x123, script: 0xdf, flags: 0x0}, + 647: {region: 0xe8, script: 0x5, flags: 0x0}, + 648: {region: 0x165, script: 0x57, flags: 0x0}, + 649: {region: 0x165, script: 0x57, flags: 0x0}, + 650: {region: 0x1c, script: 0x5, flags: 0x1}, + 651: {region: 0x165, script: 0x57, flags: 0x0}, + 652: {region: 0x165, script: 0x57, flags: 0x0}, + 653: {region: 0x165, script: 0x57, flags: 0x0}, + 654: {region: 0x138, script: 0x57, flags: 0x0}, + 655: {region: 0x87, script: 0x5b, flags: 0x0}, + 656: {region: 0x97, script: 0x3b, flags: 0x0}, + 657: {region: 0x12f, script: 0x57, flags: 0x0}, + 658: {region: 0xe8, script: 0x5, flags: 0x0}, + 659: {region: 0x131, script: 0x57, flags: 0x0}, + 660: {region: 0x165, script: 0x57, flags: 0x0}, + 661: {region: 0xb7, script: 0x57, flags: 0x0}, + 662: {region: 0x106, script: 0x1f, flags: 0x0}, + 663: {region: 0x165, script: 0x57, flags: 0x0}, + 664: {region: 0x95, script: 0x57, flags: 0x0}, + 665: {region: 0x165, script: 0x57, flags: 0x0}, + 666: {region: 0x53, script: 0xdf, flags: 0x0}, + 667: {region: 0x165, script: 0x57, flags: 0x0}, + 668: {region: 0x165, script: 0x57, flags: 0x0}, + 669: {region: 0x165, script: 0x57, flags: 0x0}, + 670: {region: 0x165, script: 0x57, flags: 0x0}, + 671: {region: 0x99, script: 0x59, flags: 0x0}, + 672: {region: 0x165, script: 0x57, flags: 0x0}, + 673: {region: 0x165, script: 0x57, flags: 0x0}, + 674: {region: 0x106, script: 0x1f, flags: 0x0}, + 675: {region: 0x131, script: 0x57, flags: 0x0}, + 676: {region: 0x165, script: 0x57, flags: 0x0}, + 677: {region: 0xd9, script: 0x57, flags: 0x0}, + 678: {region: 0x165, script: 0x57, flags: 0x0}, + 679: {region: 0x165, script: 0x57, flags: 0x0}, + 680: {region: 0x21, script: 0x2, flags: 0x1}, + 681: {region: 0x165, script: 0x57, flags: 0x0}, + 682: {region: 0x165, script: 0x57, flags: 0x0}, + 683: {region: 0x9e, script: 0x57, flags: 0x0}, + 684: {region: 0x53, script: 0x5d, flags: 0x0}, + 685: {region: 0x95, script: 0x57, flags: 0x0}, + 686: {region: 0x9c, script: 0x5, flags: 0x0}, + 687: {region: 0x135, script: 0x57, flags: 0x0}, + 688: {region: 0x165, script: 0x57, flags: 0x0}, + 689: {region: 0x165, script: 0x57, flags: 0x0}, + 690: {region: 0x99, script: 0xda, flags: 0x0}, + 691: {region: 0x9e, script: 0x57, flags: 0x0}, + 692: {region: 0x165, script: 0x57, flags: 0x0}, + 693: {region: 0x4b, script: 0x57, flags: 0x0}, + 694: {region: 0x165, script: 0x57, flags: 0x0}, + 695: {region: 0x165, script: 0x57, flags: 0x0}, + 696: {region: 0xaf, script: 0x54, flags: 0x0}, + 697: {region: 0x165, script: 0x57, flags: 0x0}, + 698: {region: 0x165, script: 0x57, flags: 0x0}, + 699: {region: 0x4b, script: 0x57, flags: 0x0}, + 700: {region: 0x165, script: 0x57, flags: 0x0}, + 701: {region: 0x165, script: 0x57, flags: 0x0}, + 702: {region: 0x162, script: 0x57, flags: 0x0}, + 703: {region: 0x9c, script: 0x5, flags: 0x0}, + 704: {region: 0xb6, script: 0x57, flags: 0x0}, + 705: {region: 0xb8, script: 0x57, flags: 0x0}, + 706: {region: 0x4b, script: 0x57, flags: 0x0}, + 707: {region: 0x4b, script: 0x57, flags: 0x0}, + 708: {region: 0xa4, script: 0x57, flags: 0x0}, + 709: {region: 0xa4, script: 0x57, flags: 0x0}, + 710: {region: 0x9c, script: 0x5, flags: 0x0}, + 711: {region: 0xb8, script: 0x57, flags: 0x0}, + 712: {region: 0x123, script: 0xdf, flags: 0x0}, + 713: {region: 0x53, script: 0x38, flags: 0x0}, + 714: {region: 0x12b, script: 0x57, flags: 0x0}, + 715: {region: 0x95, script: 0x57, flags: 0x0}, + 716: {region: 0x52, script: 0x57, flags: 0x0}, + 717: {region: 0x99, script: 0x21, flags: 0x0}, + 718: {region: 0x99, script: 0x21, flags: 0x0}, + 719: {region: 0x95, script: 0x57, flags: 0x0}, + 720: {region: 0x23, script: 0x3, flags: 0x1}, + 721: {region: 0xa4, script: 0x57, flags: 0x0}, + 722: {region: 0x165, script: 0x57, flags: 0x0}, + 723: {region: 0xcf, script: 0x57, flags: 0x0}, + 724: {region: 0x165, script: 0x57, flags: 0x0}, + 725: {region: 0x165, script: 0x57, flags: 0x0}, + 726: {region: 0x165, script: 0x57, flags: 0x0}, + 727: {region: 0x165, script: 0x57, flags: 0x0}, + 728: {region: 0x165, script: 0x57, flags: 0x0}, + 729: {region: 0x165, script: 0x57, flags: 0x0}, + 730: {region: 0x165, script: 0x57, flags: 0x0}, + 731: {region: 0x165, script: 0x57, flags: 0x0}, + 732: {region: 0x165, script: 0x57, flags: 0x0}, + 733: {region: 0x165, script: 0x57, flags: 0x0}, + 734: {region: 0x165, script: 0x57, flags: 0x0}, + 735: {region: 0x165, script: 0x5, flags: 0x0}, + 736: {region: 0x106, script: 0x1f, flags: 0x0}, + 737: {region: 0xe7, script: 0x57, flags: 0x0}, + 738: {region: 0x165, script: 0x57, flags: 0x0}, + 739: {region: 0x95, script: 0x57, flags: 0x0}, + 740: {region: 0x165, script: 0x29, flags: 0x0}, + 741: {region: 0x165, script: 0x57, flags: 0x0}, + 742: {region: 0x165, script: 0x57, flags: 0x0}, + 743: {region: 0x165, script: 0x57, flags: 0x0}, + 744: {region: 0x112, script: 0x57, flags: 0x0}, + 745: {region: 0xa4, script: 0x57, flags: 0x0}, + 746: {region: 0x165, script: 0x57, flags: 0x0}, + 747: {region: 0x165, script: 0x57, flags: 0x0}, + 748: {region: 0x123, script: 0x5, flags: 0x0}, + 749: {region: 0xcc, script: 0x57, flags: 0x0}, + 750: {region: 0x165, script: 0x57, flags: 0x0}, + 751: {region: 0x165, script: 0x57, flags: 0x0}, + 752: {region: 0x165, script: 0x57, flags: 0x0}, + 753: {region: 0xbf, script: 0x57, flags: 0x0}, + 754: {region: 0xd1, script: 0x57, flags: 0x0}, + 755: {region: 0x165, script: 0x57, flags: 0x0}, + 756: {region: 0x52, script: 0x57, flags: 0x0}, + 757: {region: 0xdb, script: 0x21, flags: 0x0}, + 758: {region: 0x12f, script: 0x57, flags: 0x0}, + 759: {region: 0xc0, script: 0x57, flags: 0x0}, + 760: {region: 0x165, script: 0x57, flags: 0x0}, + 761: {region: 0x165, script: 0x57, flags: 0x0}, + 762: {region: 0xe0, script: 0x57, flags: 0x0}, + 763: {region: 0x165, script: 0x57, flags: 0x0}, + 764: {region: 0x95, script: 0x57, flags: 0x0}, + 765: {region: 0x9b, script: 0x3a, flags: 0x0}, + 766: {region: 0x165, script: 0x57, flags: 0x0}, + 767: {region: 0xc2, script: 0x1f, flags: 0x0}, + 768: {region: 0x165, script: 0x5, flags: 0x0}, + 769: {region: 0x165, script: 0x57, flags: 0x0}, + 770: {region: 0x165, script: 0x57, flags: 0x0}, + 771: {region: 0x165, script: 0x57, flags: 0x0}, + 772: {region: 0x99, script: 0x6b, flags: 0x0}, + 773: {region: 0x165, script: 0x57, flags: 0x0}, + 774: {region: 0x165, script: 0x57, flags: 0x0}, + 775: {region: 0x10b, script: 0x57, flags: 0x0}, + 776: {region: 0x165, script: 0x57, flags: 0x0}, + 777: {region: 0x165, script: 0x57, flags: 0x0}, + 778: {region: 0x165, script: 0x57, flags: 0x0}, + 779: {region: 0x26, script: 0x3, flags: 0x1}, + 780: {region: 0x165, script: 0x57, flags: 0x0}, + 781: {region: 0x165, script: 0x57, flags: 0x0}, + 782: {region: 0x99, script: 0xe, flags: 0x0}, + 783: {region: 0xc4, script: 0x72, flags: 0x0}, + 785: {region: 0x165, script: 0x57, flags: 0x0}, + 786: {region: 0x49, script: 0x57, flags: 0x0}, + 787: {region: 0x49, script: 0x57, flags: 0x0}, + 788: {region: 0x37, script: 0x57, flags: 0x0}, + 789: {region: 0x165, script: 0x57, flags: 0x0}, + 790: {region: 0x165, script: 0x57, flags: 0x0}, + 791: {region: 0x165, script: 0x57, flags: 0x0}, + 792: {region: 0x165, script: 0x57, flags: 0x0}, + 793: {region: 0x165, script: 0x57, flags: 0x0}, + 794: {region: 0x165, script: 0x57, flags: 0x0}, + 795: {region: 0x99, script: 0x21, flags: 0x0}, + 796: {region: 0xdb, script: 0x21, flags: 0x0}, + 797: {region: 0x106, script: 0x1f, flags: 0x0}, + 798: {region: 0x35, script: 0x6f, flags: 0x0}, + 799: {region: 0x29, script: 0x3, flags: 0x1}, + 800: {region: 0xcb, script: 0x57, flags: 0x0}, + 801: {region: 0x165, script: 0x57, flags: 0x0}, + 802: {region: 0x165, script: 0x57, flags: 0x0}, + 803: {region: 0x165, script: 0x57, flags: 0x0}, + 804: {region: 0x99, script: 0x21, flags: 0x0}, + 805: {region: 0x52, script: 0x57, flags: 0x0}, + 807: {region: 0x165, script: 0x57, flags: 0x0}, + 808: {region: 0x135, script: 0x57, flags: 0x0}, + 809: {region: 0x165, script: 0x57, flags: 0x0}, + 810: {region: 0x165, script: 0x57, flags: 0x0}, + 811: {region: 0xe8, script: 0x5, flags: 0x0}, + 812: {region: 0xc3, script: 0x57, flags: 0x0}, + 813: {region: 0x99, script: 0x21, flags: 0x0}, + 814: {region: 0x95, script: 0x57, flags: 0x0}, + 815: {region: 0x164, script: 0x57, flags: 0x0}, + 816: {region: 0x165, script: 0x57, flags: 0x0}, + 817: {region: 0xc4, script: 0x72, flags: 0x0}, + 818: {region: 0x165, script: 0x57, flags: 0x0}, + 819: {region: 0x165, script: 0x29, flags: 0x0}, + 820: {region: 0x106, script: 0x1f, flags: 0x0}, + 821: {region: 0x165, script: 0x57, flags: 0x0}, + 822: {region: 0x131, script: 0x57, flags: 0x0}, + 823: {region: 0x9c, script: 0x63, flags: 0x0}, + 824: {region: 0x165, script: 0x57, flags: 0x0}, + 825: {region: 0x165, script: 0x57, flags: 0x0}, + 826: {region: 0x9c, script: 0x5, flags: 0x0}, + 827: {region: 0x165, script: 0x57, flags: 0x0}, + 828: {region: 0x165, script: 0x57, flags: 0x0}, + 829: {region: 0x165, script: 0x57, flags: 0x0}, + 830: {region: 0xdd, script: 0x57, flags: 0x0}, + 831: {region: 0x165, script: 0x57, flags: 0x0}, + 832: {region: 0x165, script: 0x57, flags: 0x0}, + 834: {region: 0x165, script: 0x57, flags: 0x0}, + 835: {region: 0x53, script: 0x38, flags: 0x0}, + 836: {region: 0x9e, script: 0x57, flags: 0x0}, + 837: {region: 0xd2, script: 0x57, flags: 0x0}, + 838: {region: 0x165, script: 0x57, flags: 0x0}, + 839: {region: 0xda, script: 0x57, flags: 0x0}, + 840: {region: 0x165, script: 0x57, flags: 0x0}, + 841: {region: 0x165, script: 0x57, flags: 0x0}, + 842: {region: 0x165, script: 0x57, flags: 0x0}, + 843: {region: 0xcf, script: 0x57, flags: 0x0}, + 844: {region: 0x165, script: 0x57, flags: 0x0}, + 845: {region: 0x165, script: 0x57, flags: 0x0}, + 846: {region: 0x164, script: 0x57, flags: 0x0}, + 847: {region: 0xd1, script: 0x57, flags: 0x0}, + 848: {region: 0x60, script: 0x57, flags: 0x0}, + 849: {region: 0xdb, script: 0x21, flags: 0x0}, + 850: {region: 0x165, script: 0x57, flags: 0x0}, + 851: {region: 0xdb, script: 0x21, flags: 0x0}, + 852: {region: 0x165, script: 0x57, flags: 0x0}, + 853: {region: 0x165, script: 0x57, flags: 0x0}, + 854: {region: 0xd2, script: 0x57, flags: 0x0}, + 855: {region: 0x165, script: 0x57, flags: 0x0}, + 856: {region: 0x165, script: 0x57, flags: 0x0}, + 857: {region: 0xd1, script: 0x57, flags: 0x0}, + 858: {region: 0x165, script: 0x57, flags: 0x0}, + 859: {region: 0xcf, script: 0x57, flags: 0x0}, + 860: {region: 0xcf, script: 0x57, flags: 0x0}, + 861: {region: 0x165, script: 0x57, flags: 0x0}, + 862: {region: 0x165, script: 0x57, flags: 0x0}, + 863: {region: 0x95, script: 0x57, flags: 0x0}, + 864: {region: 0x165, script: 0x57, flags: 0x0}, + 865: {region: 0xdf, script: 0x57, flags: 0x0}, + 866: {region: 0x165, script: 0x57, flags: 0x0}, + 867: {region: 0x165, script: 0x57, flags: 0x0}, + 868: {region: 0x99, script: 0x57, flags: 0x0}, + 869: {region: 0x165, script: 0x57, flags: 0x0}, + 870: {region: 0x165, script: 0x57, flags: 0x0}, + 871: {region: 0xd9, script: 0x57, flags: 0x0}, + 872: {region: 0x52, script: 0x57, flags: 0x0}, + 873: {region: 0x165, script: 0x57, flags: 0x0}, + 874: {region: 0xda, script: 0x57, flags: 0x0}, + 875: {region: 0x165, script: 0x57, flags: 0x0}, + 876: {region: 0x52, script: 0x57, flags: 0x0}, + 877: {region: 0x165, script: 0x57, flags: 0x0}, + 878: {region: 0x165, script: 0x57, flags: 0x0}, + 879: {region: 0xda, script: 0x57, flags: 0x0}, + 880: {region: 0x123, script: 0x53, flags: 0x0}, + 881: {region: 0x99, script: 0x21, flags: 0x0}, + 882: {region: 0x10c, script: 0xbf, flags: 0x0}, + 883: {region: 0x165, script: 0x57, flags: 0x0}, + 884: {region: 0x165, script: 0x57, flags: 0x0}, + 885: {region: 0x84, script: 0x78, flags: 0x0}, + 886: {region: 0x161, script: 0x57, flags: 0x0}, + 887: {region: 0x165, script: 0x57, flags: 0x0}, + 888: {region: 0x49, script: 0x17, flags: 0x0}, + 889: {region: 0x165, script: 0x57, flags: 0x0}, + 890: {region: 0x161, script: 0x57, flags: 0x0}, + 891: {region: 0x165, script: 0x57, flags: 0x0}, + 892: {region: 0x165, script: 0x57, flags: 0x0}, + 893: {region: 0x165, script: 0x57, flags: 0x0}, + 894: {region: 0x165, script: 0x57, flags: 0x0}, + 895: {region: 0x165, script: 0x57, flags: 0x0}, + 896: {region: 0x117, script: 0x57, flags: 0x0}, + 897: {region: 0x165, script: 0x57, flags: 0x0}, + 898: {region: 0x165, script: 0x57, flags: 0x0}, + 899: {region: 0x135, script: 0x57, flags: 0x0}, + 900: {region: 0x165, script: 0x57, flags: 0x0}, + 901: {region: 0x53, script: 0x57, flags: 0x0}, + 902: {region: 0x165, script: 0x57, flags: 0x0}, + 903: {region: 0xce, script: 0x57, flags: 0x0}, + 904: {region: 0x12f, script: 0x57, flags: 0x0}, + 905: {region: 0x131, script: 0x57, flags: 0x0}, + 906: {region: 0x80, script: 0x57, flags: 0x0}, + 907: {region: 0x78, script: 0x57, flags: 0x0}, + 908: {region: 0x165, script: 0x57, flags: 0x0}, + 910: {region: 0x165, script: 0x57, flags: 0x0}, + 911: {region: 0x165, script: 0x57, flags: 0x0}, + 912: {region: 0x6f, script: 0x57, flags: 0x0}, + 913: {region: 0x165, script: 0x57, flags: 0x0}, + 914: {region: 0x165, script: 0x57, flags: 0x0}, + 915: {region: 0x165, script: 0x57, flags: 0x0}, + 916: {region: 0x165, script: 0x57, flags: 0x0}, + 917: {region: 0x99, script: 0x7d, flags: 0x0}, + 918: {region: 0x165, script: 0x57, flags: 0x0}, + 919: {region: 0x165, script: 0x5, flags: 0x0}, + 920: {region: 0x7d, script: 0x1f, flags: 0x0}, + 921: {region: 0x135, script: 0x7e, flags: 0x0}, + 922: {region: 0x165, script: 0x5, flags: 0x0}, + 923: {region: 0xc5, script: 0x7c, flags: 0x0}, + 924: {region: 0x165, script: 0x57, flags: 0x0}, + 925: {region: 0x2c, script: 0x3, flags: 0x1}, + 926: {region: 0xe7, script: 0x57, flags: 0x0}, + 927: {region: 0x2f, script: 0x2, flags: 0x1}, + 928: {region: 0xe7, script: 0x57, flags: 0x0}, + 929: {region: 0x30, script: 0x57, flags: 0x0}, + 930: {region: 0xf0, script: 0x57, flags: 0x0}, + 931: {region: 0x165, script: 0x57, flags: 0x0}, + 932: {region: 0x78, script: 0x57, flags: 0x0}, + 933: {region: 0xd6, script: 0x57, flags: 0x0}, + 934: {region: 0x135, script: 0x57, flags: 0x0}, + 935: {region: 0x49, script: 0x57, flags: 0x0}, + 936: {region: 0x165, script: 0x57, flags: 0x0}, + 937: {region: 0x9c, script: 0xe8, flags: 0x0}, + 938: {region: 0x165, script: 0x57, flags: 0x0}, + 939: {region: 0x60, script: 0x57, flags: 0x0}, + 940: {region: 0x165, script: 0x5, flags: 0x0}, + 941: {region: 0xb0, script: 0x87, flags: 0x0}, + 943: {region: 0x165, script: 0x57, flags: 0x0}, + 944: {region: 0x165, script: 0x57, flags: 0x0}, + 945: {region: 0x99, script: 0x12, flags: 0x0}, + 946: {region: 0xa4, script: 0x57, flags: 0x0}, + 947: {region: 0xe9, script: 0x57, flags: 0x0}, + 948: {region: 0x165, script: 0x57, flags: 0x0}, + 949: {region: 0x9e, script: 0x57, flags: 0x0}, + 950: {region: 0x165, script: 0x57, flags: 0x0}, + 951: {region: 0x165, script: 0x57, flags: 0x0}, + 952: {region: 0x87, script: 0x31, flags: 0x0}, + 953: {region: 0x75, script: 0x57, flags: 0x0}, + 954: {region: 0x165, script: 0x57, flags: 0x0}, + 955: {region: 0xe8, script: 0x4a, flags: 0x0}, + 956: {region: 0x9c, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x57, flags: 0x0}, + 958: {region: 0x24, script: 0x5, flags: 0x0}, + 959: {region: 0x165, script: 0x57, flags: 0x0}, + 960: {region: 0x41, script: 0x57, flags: 0x0}, + 961: {region: 0x165, script: 0x57, flags: 0x0}, + 962: {region: 0x7a, script: 0x57, flags: 0x0}, + 963: {region: 0x165, script: 0x57, flags: 0x0}, + 964: {region: 0xe4, script: 0x57, flags: 0x0}, + 965: {region: 0x89, script: 0x57, flags: 0x0}, + 966: {region: 0x69, script: 0x57, flags: 0x0}, + 967: {region: 0x165, script: 0x57, flags: 0x0}, + 968: {region: 0x99, script: 0x21, flags: 0x0}, + 969: {region: 0x165, script: 0x57, flags: 0x0}, + 970: {region: 0x102, script: 0x57, flags: 0x0}, + 971: {region: 0x95, script: 0x57, flags: 0x0}, + 972: {region: 0x165, script: 0x57, flags: 0x0}, + 973: {region: 0x165, script: 0x57, flags: 0x0}, + 974: {region: 0x9e, script: 0x57, flags: 0x0}, + 975: {region: 0x165, script: 0x5, flags: 0x0}, + 976: {region: 0x99, script: 0x57, flags: 0x0}, + 977: {region: 0x31, script: 0x2, flags: 0x1}, + 978: {region: 0xdb, script: 0x21, flags: 0x0}, + 979: {region: 0x35, script: 0xe, flags: 0x0}, + 980: {region: 0x4e, script: 0x57, flags: 0x0}, + 981: {region: 0x72, script: 0x57, flags: 0x0}, + 982: {region: 0x4e, script: 0x57, flags: 0x0}, + 983: {region: 0x9c, script: 0x5, flags: 0x0}, + 984: {region: 0x10c, script: 0x57, flags: 0x0}, + 985: {region: 0x3a, script: 0x57, flags: 0x0}, + 986: {region: 0x165, script: 0x57, flags: 0x0}, + 987: {region: 0xd1, script: 0x57, flags: 0x0}, + 988: {region: 0x104, script: 0x57, flags: 0x0}, + 989: {region: 0x95, script: 0x57, flags: 0x0}, + 990: {region: 0x12f, script: 0x57, flags: 0x0}, + 991: {region: 0x165, script: 0x57, flags: 0x0}, + 992: {region: 0x165, script: 0x57, flags: 0x0}, + 993: {region: 0x73, script: 0x57, flags: 0x0}, + 994: {region: 0x106, script: 0x1f, flags: 0x0}, + 995: {region: 0x130, script: 0x1f, flags: 0x0}, + 996: {region: 0x109, script: 0x57, flags: 0x0}, + 997: {region: 0x107, script: 0x57, flags: 0x0}, + 998: {region: 0x12f, script: 0x57, flags: 0x0}, + 999: {region: 0x165, script: 0x57, flags: 0x0}, + 1000: {region: 0xa2, script: 0x49, flags: 0x0}, + 1001: {region: 0x99, script: 0x21, flags: 0x0}, + 1002: {region: 0x80, script: 0x57, flags: 0x0}, + 1003: {region: 0x106, script: 0x1f, flags: 0x0}, + 1004: {region: 0xa4, script: 0x57, flags: 0x0}, + 1005: {region: 0x95, script: 0x57, flags: 0x0}, + 1006: {region: 0x99, script: 0x57, flags: 0x0}, + 1007: {region: 0x114, script: 0x57, flags: 0x0}, + 1008: {region: 0x99, script: 0xc3, flags: 0x0}, + 1009: {region: 0x165, script: 0x57, flags: 0x0}, + 1010: {region: 0x165, script: 0x57, flags: 0x0}, + 1011: {region: 0x12f, script: 0x57, flags: 0x0}, + 1012: {region: 0x9e, script: 0x57, flags: 0x0}, + 1013: {region: 0x99, script: 0x21, flags: 0x0}, + 1014: {region: 0x165, script: 0x5, flags: 0x0}, + 1015: {region: 0x9e, script: 0x57, flags: 0x0}, + 1016: {region: 0x7b, script: 0x57, flags: 0x0}, + 1017: {region: 0x49, script: 0x57, flags: 0x0}, + 1018: {region: 0x33, script: 0x4, flags: 0x1}, + 1019: {region: 0x9e, script: 0x57, flags: 0x0}, + 1020: {region: 0x9c, script: 0x5, flags: 0x0}, + 1021: {region: 0xda, script: 0x57, flags: 0x0}, + 1022: {region: 0x4f, script: 0x57, flags: 0x0}, + 1023: {region: 0xd1, script: 0x57, flags: 0x0}, + 1024: {region: 0xcf, script: 0x57, flags: 0x0}, + 1025: {region: 0xc3, script: 0x57, flags: 0x0}, + 1026: {region: 0x4c, script: 0x57, flags: 0x0}, + 1027: {region: 0x96, script: 0x7a, flags: 0x0}, + 1028: {region: 0xb6, script: 0x57, flags: 0x0}, + 1029: {region: 0x165, script: 0x29, flags: 0x0}, + 1030: {region: 0x165, script: 0x57, flags: 0x0}, + 1032: {region: 0xba, script: 0xdc, flags: 0x0}, + 1033: {region: 0x165, script: 0x57, flags: 0x0}, + 1034: {region: 0xc4, script: 0x72, flags: 0x0}, + 1035: {region: 0x165, script: 0x5, flags: 0x0}, + 1036: {region: 0xb3, script: 0xca, flags: 0x0}, + 1037: {region: 0x6f, script: 0x57, flags: 0x0}, + 1038: {region: 0x165, script: 0x57, flags: 0x0}, + 1039: {region: 0x165, script: 0x57, flags: 0x0}, + 1040: {region: 0x165, script: 0x57, flags: 0x0}, + 1041: {region: 0x165, script: 0x57, flags: 0x0}, + 1042: {region: 0x111, script: 0x57, flags: 0x0}, + 1043: {region: 0x165, script: 0x57, flags: 0x0}, + 1044: {region: 0xe8, script: 0x5, flags: 0x0}, + 1045: {region: 0x165, script: 0x57, flags: 0x0}, + 1046: {region: 0x10f, script: 0x57, flags: 0x0}, + 1047: {region: 0x165, script: 0x57, flags: 0x0}, + 1048: {region: 0xe9, script: 0x57, flags: 0x0}, + 1049: {region: 0x165, script: 0x57, flags: 0x0}, + 1050: {region: 0x95, script: 0x57, flags: 0x0}, + 1051: {region: 0x142, script: 0x57, flags: 0x0}, + 1052: {region: 0x10c, script: 0x57, flags: 0x0}, + 1054: {region: 0x10c, script: 0x57, flags: 0x0}, + 1055: {region: 0x72, script: 0x57, flags: 0x0}, + 1056: {region: 0x97, script: 0xc0, flags: 0x0}, + 1057: {region: 0x165, script: 0x57, flags: 0x0}, + 1058: {region: 0x72, script: 0x57, flags: 0x0}, + 1059: {region: 0x164, script: 0x57, flags: 0x0}, + 1060: {region: 0x165, script: 0x57, flags: 0x0}, + 1061: {region: 0xc3, script: 0x57, flags: 0x0}, + 1062: {region: 0x165, script: 0x57, flags: 0x0}, + 1063: {region: 0x165, script: 0x57, flags: 0x0}, + 1064: {region: 0x165, script: 0x57, flags: 0x0}, + 1065: {region: 0x115, script: 0x57, flags: 0x0}, + 1066: {region: 0x165, script: 0x57, flags: 0x0}, + 1067: {region: 0x165, script: 0x57, flags: 0x0}, + 1068: {region: 0x123, script: 0xdf, flags: 0x0}, + 1069: {region: 0x165, script: 0x57, flags: 0x0}, + 1070: {region: 0x165, script: 0x57, flags: 0x0}, + 1071: {region: 0x165, script: 0x57, flags: 0x0}, + 1072: {region: 0x165, script: 0x57, flags: 0x0}, + 1073: {region: 0x27, script: 0x57, flags: 0x0}, + 1074: {region: 0x37, script: 0x5, flags: 0x1}, + 1075: {region: 0x99, script: 0xcb, flags: 0x0}, + 1076: {region: 0x116, script: 0x57, flags: 0x0}, + 1077: {region: 0x114, script: 0x57, flags: 0x0}, + 1078: {region: 0x99, script: 0x21, flags: 0x0}, + 1079: {region: 0x161, script: 0x57, flags: 0x0}, + 1080: {region: 0x165, script: 0x57, flags: 0x0}, + 1081: {region: 0x165, script: 0x57, flags: 0x0}, + 1082: {region: 0x6d, script: 0x57, flags: 0x0}, + 1083: {region: 0x161, script: 0x57, flags: 0x0}, + 1084: {region: 0x165, script: 0x57, flags: 0x0}, + 1085: {region: 0x60, script: 0x57, flags: 0x0}, + 1086: {region: 0x95, script: 0x57, flags: 0x0}, + 1087: {region: 0x165, script: 0x57, flags: 0x0}, + 1088: {region: 0x165, script: 0x57, flags: 0x0}, + 1089: {region: 0x12f, script: 0x57, flags: 0x0}, + 1090: {region: 0x165, script: 0x57, flags: 0x0}, + 1091: {region: 0x84, script: 0x57, flags: 0x0}, + 1092: {region: 0x10c, script: 0x57, flags: 0x0}, + 1093: {region: 0x12f, script: 0x57, flags: 0x0}, + 1094: {region: 0x15f, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x57, flags: 0x0}, + 1096: {region: 0x60, script: 0x57, flags: 0x0}, + 1097: {region: 0x165, script: 0x57, flags: 0x0}, + 1098: {region: 0x99, script: 0x21, flags: 0x0}, + 1099: {region: 0x95, script: 0x57, flags: 0x0}, + 1100: {region: 0x165, script: 0x57, flags: 0x0}, + 1101: {region: 0x35, script: 0xe, flags: 0x0}, + 1102: {region: 0x9b, script: 0xcf, flags: 0x0}, + 1103: {region: 0xe9, script: 0x57, flags: 0x0}, + 1104: {region: 0x99, script: 0xd7, flags: 0x0}, + 1105: {region: 0xdb, script: 0x21, flags: 0x0}, + 1106: {region: 0x165, script: 0x57, flags: 0x0}, + 1107: {region: 0x165, script: 0x57, flags: 0x0}, + 1108: {region: 0x165, script: 0x57, flags: 0x0}, + 1109: {region: 0x165, script: 0x57, flags: 0x0}, + 1110: {region: 0x165, script: 0x57, flags: 0x0}, + 1111: {region: 0x165, script: 0x57, flags: 0x0}, + 1112: {region: 0x165, script: 0x57, flags: 0x0}, + 1113: {region: 0x165, script: 0x57, flags: 0x0}, + 1114: {region: 0xe7, script: 0x57, flags: 0x0}, + 1115: {region: 0x165, script: 0x57, flags: 0x0}, + 1116: {region: 0x165, script: 0x57, flags: 0x0}, + 1117: {region: 0x99, script: 0x4f, flags: 0x0}, + 1118: {region: 0x53, script: 0xd5, flags: 0x0}, + 1119: {region: 0xdb, script: 0x21, flags: 0x0}, + 1120: {region: 0xdb, script: 0x21, flags: 0x0}, + 1121: {region: 0x99, script: 0xda, flags: 0x0}, + 1122: {region: 0x165, script: 0x57, flags: 0x0}, + 1123: {region: 0x112, script: 0x57, flags: 0x0}, + 1124: {region: 0x131, script: 0x57, flags: 0x0}, + 1125: {region: 0x126, script: 0x57, flags: 0x0}, + 1126: {region: 0x165, script: 0x57, flags: 0x0}, + 1127: {region: 0x3c, script: 0x3, flags: 0x1}, + 1128: {region: 0x165, script: 0x57, flags: 0x0}, + 1129: {region: 0x165, script: 0x57, flags: 0x0}, + 1130: {region: 0x165, script: 0x57, flags: 0x0}, + 1131: {region: 0x123, script: 0xdf, flags: 0x0}, + 1132: {region: 0xdb, script: 0x21, flags: 0x0}, + 1133: {region: 0xdb, script: 0x21, flags: 0x0}, + 1134: {region: 0xdb, script: 0x21, flags: 0x0}, + 1135: {region: 0x6f, script: 0x29, flags: 0x0}, + 1136: {region: 0x165, script: 0x57, flags: 0x0}, + 1137: {region: 0x6d, script: 0x29, flags: 0x0}, + 1138: {region: 0x165, script: 0x57, flags: 0x0}, + 1139: {region: 0x165, script: 0x57, flags: 0x0}, + 1140: {region: 0x165, script: 0x57, flags: 0x0}, + 1141: {region: 0xd6, script: 0x57, flags: 0x0}, + 1142: {region: 0x127, script: 0x57, flags: 0x0}, + 1143: {region: 0x125, script: 0x57, flags: 0x0}, + 1144: {region: 0x32, script: 0x57, flags: 0x0}, + 1145: {region: 0xdb, script: 0x21, flags: 0x0}, + 1146: {region: 0xe7, script: 0x57, flags: 0x0}, + 1147: {region: 0x165, script: 0x57, flags: 0x0}, + 1148: {region: 0x165, script: 0x57, flags: 0x0}, + 1149: {region: 0x32, script: 0x57, flags: 0x0}, + 1150: {region: 0xd4, script: 0x57, flags: 0x0}, + 1151: {region: 0x165, script: 0x57, flags: 0x0}, + 1152: {region: 0x161, script: 0x57, flags: 0x0}, + 1153: {region: 0x165, script: 0x57, flags: 0x0}, + 1154: {region: 0x129, script: 0x57, flags: 0x0}, + 1155: {region: 0x165, script: 0x57, flags: 0x0}, + 1156: {region: 0xce, script: 0x57, flags: 0x0}, + 1157: {region: 0x165, script: 0x57, flags: 0x0}, + 1158: {region: 0xe6, script: 0x57, flags: 0x0}, + 1159: {region: 0x165, script: 0x57, flags: 0x0}, + 1160: {region: 0x165, script: 0x57, flags: 0x0}, + 1161: {region: 0x165, script: 0x57, flags: 0x0}, + 1162: {region: 0x12b, script: 0x57, flags: 0x0}, + 1163: {region: 0x12b, script: 0x57, flags: 0x0}, + 1164: {region: 0x12e, script: 0x57, flags: 0x0}, + 1165: {region: 0x165, script: 0x5, flags: 0x0}, + 1166: {region: 0x161, script: 0x57, flags: 0x0}, + 1167: {region: 0x87, script: 0x31, flags: 0x0}, + 1168: {region: 0xdb, script: 0x21, flags: 0x0}, + 1169: {region: 0xe7, script: 0x57, flags: 0x0}, + 1170: {region: 0x43, script: 0xe0, flags: 0x0}, + 1171: {region: 0x165, script: 0x57, flags: 0x0}, + 1172: {region: 0x106, script: 0x1f, flags: 0x0}, + 1173: {region: 0x165, script: 0x57, flags: 0x0}, + 1174: {region: 0x165, script: 0x57, flags: 0x0}, + 1175: {region: 0x131, script: 0x57, flags: 0x0}, + 1176: {region: 0x165, script: 0x57, flags: 0x0}, + 1177: {region: 0x123, script: 0xdf, flags: 0x0}, + 1178: {region: 0x32, script: 0x57, flags: 0x0}, + 1179: {region: 0x165, script: 0x57, flags: 0x0}, + 1180: {region: 0x165, script: 0x57, flags: 0x0}, + 1181: {region: 0xce, script: 0x57, flags: 0x0}, + 1182: {region: 0x165, script: 0x57, flags: 0x0}, + 1183: {region: 0x165, script: 0x57, flags: 0x0}, + 1184: {region: 0x12d, script: 0x57, flags: 0x0}, + 1185: {region: 0x165, script: 0x57, flags: 0x0}, + 1187: {region: 0x165, script: 0x57, flags: 0x0}, + 1188: {region: 0xd4, script: 0x57, flags: 0x0}, + 1189: {region: 0x53, script: 0xd8, flags: 0x0}, + 1190: {region: 0xe5, script: 0x57, flags: 0x0}, + 1191: {region: 0x165, script: 0x57, flags: 0x0}, + 1192: {region: 0x106, script: 0x1f, flags: 0x0}, + 1193: {region: 0xba, script: 0x57, flags: 0x0}, + 1194: {region: 0x165, script: 0x57, flags: 0x0}, + 1195: {region: 0x106, script: 0x1f, flags: 0x0}, + 1196: {region: 0x3f, script: 0x4, flags: 0x1}, + 1197: {region: 0x11c, script: 0xe2, flags: 0x0}, + 1198: {region: 0x130, script: 0x1f, flags: 0x0}, + 1199: {region: 0x75, script: 0x57, flags: 0x0}, + 1200: {region: 0x2a, script: 0x57, flags: 0x0}, + 1202: {region: 0x43, script: 0x3, flags: 0x1}, + 1203: {region: 0x99, script: 0xe, flags: 0x0}, + 1204: {region: 0xe8, script: 0x5, flags: 0x0}, + 1205: {region: 0x165, script: 0x57, flags: 0x0}, + 1206: {region: 0x165, script: 0x57, flags: 0x0}, + 1207: {region: 0x165, script: 0x57, flags: 0x0}, + 1208: {region: 0x165, script: 0x57, flags: 0x0}, + 1209: {region: 0x165, script: 0x57, flags: 0x0}, + 1210: {region: 0x165, script: 0x57, flags: 0x0}, + 1211: {region: 0x165, script: 0x57, flags: 0x0}, + 1212: {region: 0x46, script: 0x4, flags: 0x1}, + 1213: {region: 0x165, script: 0x57, flags: 0x0}, + 1214: {region: 0xb4, script: 0xe3, flags: 0x0}, + 1215: {region: 0x165, script: 0x57, flags: 0x0}, + 1216: {region: 0x161, script: 0x57, flags: 0x0}, + 1217: {region: 0x9e, script: 0x57, flags: 0x0}, + 1218: {region: 0x106, script: 0x57, flags: 0x0}, + 1219: {region: 0x13e, script: 0x57, flags: 0x0}, + 1220: {region: 0x11b, script: 0x57, flags: 0x0}, + 1221: {region: 0x165, script: 0x57, flags: 0x0}, + 1222: {region: 0x36, script: 0x57, flags: 0x0}, + 1223: {region: 0x60, script: 0x57, flags: 0x0}, + 1224: {region: 0xd1, script: 0x57, flags: 0x0}, + 1225: {region: 0x1, script: 0x57, flags: 0x0}, + 1226: {region: 0x106, script: 0x57, flags: 0x0}, + 1227: {region: 0x6a, script: 0x57, flags: 0x0}, + 1228: {region: 0x12f, script: 0x57, flags: 0x0}, + 1229: {region: 0x165, script: 0x57, flags: 0x0}, + 1230: {region: 0x36, script: 0x57, flags: 0x0}, + 1231: {region: 0x4e, script: 0x57, flags: 0x0}, + 1232: {region: 0x165, script: 0x57, flags: 0x0}, + 1233: {region: 0x6f, script: 0x29, flags: 0x0}, + 1234: {region: 0x165, script: 0x57, flags: 0x0}, + 1235: {region: 0xe7, script: 0x57, flags: 0x0}, + 1236: {region: 0x2f, script: 0x57, flags: 0x0}, + 1237: {region: 0x99, script: 0xda, flags: 0x0}, + 1238: {region: 0x99, script: 0x21, flags: 0x0}, + 1239: {region: 0x165, script: 0x57, flags: 0x0}, + 1240: {region: 0x165, script: 0x57, flags: 0x0}, + 1241: {region: 0x165, script: 0x57, flags: 0x0}, + 1242: {region: 0x165, script: 0x57, flags: 0x0}, + 1243: {region: 0x165, script: 0x57, flags: 0x0}, + 1244: {region: 0x165, script: 0x57, flags: 0x0}, + 1245: {region: 0x165, script: 0x57, flags: 0x0}, + 1246: {region: 0x165, script: 0x57, flags: 0x0}, + 1247: {region: 0x165, script: 0x57, flags: 0x0}, + 1248: {region: 0x140, script: 0x57, flags: 0x0}, + 1249: {region: 0x165, script: 0x57, flags: 0x0}, + 1250: {region: 0x165, script: 0x57, flags: 0x0}, + 1251: {region: 0xa8, script: 0x5, flags: 0x0}, + 1252: {region: 0x165, script: 0x57, flags: 0x0}, + 1253: {region: 0x114, script: 0x57, flags: 0x0}, + 1254: {region: 0x165, script: 0x57, flags: 0x0}, + 1255: {region: 0x165, script: 0x57, flags: 0x0}, + 1256: {region: 0x165, script: 0x57, flags: 0x0}, + 1257: {region: 0x165, script: 0x57, flags: 0x0}, + 1258: {region: 0x99, script: 0x21, flags: 0x0}, + 1259: {region: 0x53, script: 0x38, flags: 0x0}, + 1260: {region: 0x165, script: 0x57, flags: 0x0}, + 1261: {region: 0x165, script: 0x57, flags: 0x0}, + 1262: {region: 0x41, script: 0x57, flags: 0x0}, + 1263: {region: 0x165, script: 0x57, flags: 0x0}, + 1264: {region: 0x12b, script: 0x18, flags: 0x0}, + 1265: {region: 0x165, script: 0x57, flags: 0x0}, + 1266: {region: 0x161, script: 0x57, flags: 0x0}, + 1267: {region: 0x165, script: 0x57, flags: 0x0}, + 1268: {region: 0x12b, script: 0x5f, flags: 0x0}, + 1269: {region: 0x12b, script: 0x60, flags: 0x0}, + 1270: {region: 0x7d, script: 0x2b, flags: 0x0}, + 1271: {region: 0x53, script: 0x64, flags: 0x0}, + 1272: {region: 0x10b, script: 0x69, flags: 0x0}, + 1273: {region: 0x108, script: 0x73, flags: 0x0}, + 1274: {region: 0x99, script: 0x21, flags: 0x0}, + 1275: {region: 0x131, script: 0x57, flags: 0x0}, + 1276: {region: 0x165, script: 0x57, flags: 0x0}, + 1277: {region: 0x9c, script: 0x8a, flags: 0x0}, + 1278: {region: 0x165, script: 0x57, flags: 0x0}, + 1279: {region: 0x15e, script: 0xc2, flags: 0x0}, + 1280: {region: 0x165, script: 0x57, flags: 0x0}, + 1281: {region: 0x165, script: 0x57, flags: 0x0}, + 1282: {region: 0xdb, script: 0x21, flags: 0x0}, + 1283: {region: 0x165, script: 0x57, flags: 0x0}, + 1284: {region: 0x165, script: 0x57, flags: 0x0}, + 1285: {region: 0xd1, script: 0x57, flags: 0x0}, + 1286: {region: 0x75, script: 0x57, flags: 0x0}, + 1287: {region: 0x165, script: 0x57, flags: 0x0}, + 1288: {region: 0x165, script: 0x57, flags: 0x0}, + 1289: {region: 0x52, script: 0x57, flags: 0x0}, + 1290: {region: 0x165, script: 0x57, flags: 0x0}, + 1291: {region: 0x165, script: 0x57, flags: 0x0}, + 1292: {region: 0x165, script: 0x57, flags: 0x0}, + 1293: {region: 0x52, script: 0x57, flags: 0x0}, + 1294: {region: 0x165, script: 0x57, flags: 0x0}, + 1295: {region: 0x165, script: 0x57, flags: 0x0}, + 1296: {region: 0x165, script: 0x57, flags: 0x0}, + 1297: {region: 0x165, script: 0x57, flags: 0x0}, + 1298: {region: 0x1, script: 0x3b, flags: 0x0}, + 1299: {region: 0x165, script: 0x57, flags: 0x0}, + 1300: {region: 0x165, script: 0x57, flags: 0x0}, + 1301: {region: 0x165, script: 0x57, flags: 0x0}, + 1302: {region: 0x165, script: 0x57, flags: 0x0}, + 1303: {region: 0x165, script: 0x57, flags: 0x0}, + 1304: {region: 0xd6, script: 0x57, flags: 0x0}, + 1305: {region: 0x165, script: 0x57, flags: 0x0}, + 1306: {region: 0x165, script: 0x57, flags: 0x0}, + 1307: {region: 0x165, script: 0x57, flags: 0x0}, + 1308: {region: 0x41, script: 0x57, flags: 0x0}, + 1309: {region: 0x165, script: 0x57, flags: 0x0}, + 1310: {region: 0xcf, script: 0x57, flags: 0x0}, + 1311: {region: 0x4a, script: 0x3, flags: 0x1}, + 1312: {region: 0x165, script: 0x57, flags: 0x0}, + 1313: {region: 0x165, script: 0x57, flags: 0x0}, + 1314: {region: 0x165, script: 0x57, flags: 0x0}, + 1315: {region: 0x53, script: 0x57, flags: 0x0}, + 1316: {region: 0x10b, script: 0x57, flags: 0x0}, + 1318: {region: 0xa8, script: 0x5, flags: 0x0}, + 1319: {region: 0xd9, script: 0x57, flags: 0x0}, + 1320: {region: 0xba, script: 0xdc, flags: 0x0}, + 1321: {region: 0x4d, script: 0x14, flags: 0x1}, + 1322: {region: 0x53, script: 0x79, flags: 0x0}, + 1323: {region: 0x165, script: 0x57, flags: 0x0}, + 1324: {region: 0x122, script: 0x57, flags: 0x0}, + 1325: {region: 0xd0, script: 0x57, flags: 0x0}, + 1326: {region: 0x165, script: 0x57, flags: 0x0}, + 1327: {region: 0x161, script: 0x57, flags: 0x0}, + 1329: {region: 0x12b, script: 0x57, flags: 0x0}, +} + +// likelyLangList holds lists info associated with likelyLang. +// Size: 388 bytes, 97 elements +var likelyLangList = [97]likelyScriptRegion{ + 0: {region: 0x9c, script: 0x7, flags: 0x0}, + 1: {region: 0xa1, script: 0x74, flags: 0x2}, + 2: {region: 0x11c, script: 0x80, flags: 0x2}, + 3: {region: 0x32, script: 0x57, flags: 0x0}, + 4: {region: 0x9b, script: 0x5, flags: 0x4}, + 5: {region: 0x9c, script: 0x5, flags: 0x4}, + 6: {region: 0x106, script: 0x1f, flags: 0x4}, + 7: {region: 0x9c, script: 0x5, flags: 0x2}, + 8: {region: 0x106, script: 0x1f, flags: 0x0}, + 9: {region: 0x38, script: 0x2c, flags: 0x2}, + 10: {region: 0x135, script: 0x57, flags: 0x0}, + 11: {region: 0x7b, script: 0xc5, flags: 0x2}, + 12: {region: 0x114, script: 0x57, flags: 0x0}, + 13: {region: 0x84, script: 0x1, flags: 0x2}, + 14: {region: 0x5d, script: 0x1e, flags: 0x0}, + 15: {region: 0x87, script: 0x5c, flags: 0x2}, + 16: {region: 0xd6, script: 0x57, flags: 0x0}, + 17: {region: 0x52, script: 0x5, flags: 0x4}, + 18: {region: 0x10b, script: 0x5, flags: 0x4}, + 19: {region: 0xae, script: 0x1f, flags: 0x0}, + 20: {region: 0x24, script: 0x5, flags: 0x4}, + 21: {region: 0x53, script: 0x5, flags: 0x4}, + 22: {region: 0x9c, script: 0x5, flags: 0x4}, + 23: {region: 0xc5, script: 0x5, flags: 0x4}, + 24: {region: 0x53, script: 0x5, flags: 0x2}, + 25: {region: 0x12b, script: 0x57, flags: 0x0}, + 26: {region: 0xb0, script: 0x5, flags: 0x4}, + 27: {region: 0x9b, script: 0x5, flags: 0x2}, + 28: {region: 0xa5, script: 0x1f, flags: 0x0}, + 29: {region: 0x53, script: 0x5, flags: 0x4}, + 30: {region: 0x12b, script: 0x57, flags: 0x4}, + 31: {region: 0x53, script: 0x5, flags: 0x2}, + 32: {region: 0x12b, script: 0x57, flags: 0x2}, + 33: {region: 0xdb, script: 0x21, flags: 0x0}, + 34: {region: 0x99, script: 0x5a, flags: 0x2}, + 35: {region: 0x83, script: 0x57, flags: 0x0}, + 36: {region: 0x84, script: 0x78, flags: 0x4}, + 37: {region: 0x84, script: 0x78, flags: 0x2}, + 38: {region: 0xc5, script: 0x1f, flags: 0x0}, + 39: {region: 0x53, script: 0x6d, flags: 0x4}, + 40: {region: 0x53, script: 0x6d, flags: 0x2}, + 41: {region: 0xd0, script: 0x57, flags: 0x0}, + 42: {region: 0x4a, script: 0x5, flags: 0x4}, + 43: {region: 0x95, script: 0x5, flags: 0x4}, + 44: {region: 0x99, script: 0x33, flags: 0x0}, + 45: {region: 0xe8, script: 0x5, flags: 0x4}, + 46: {region: 0xe8, script: 0x5, flags: 0x2}, + 47: {region: 0x9c, script: 0x84, flags: 0x0}, + 48: {region: 0x53, script: 0x85, flags: 0x2}, + 49: {region: 0xba, script: 0xdc, flags: 0x0}, + 50: {region: 0xd9, script: 0x57, flags: 0x4}, + 51: {region: 0xe8, script: 0x5, flags: 0x0}, + 52: {region: 0x99, script: 0x21, flags: 0x2}, + 53: {region: 0x99, script: 0x4c, flags: 0x2}, + 54: {region: 0x99, script: 0xc9, flags: 0x2}, + 55: {region: 0x105, script: 0x1f, flags: 0x0}, + 56: {region: 0xbd, script: 0x57, flags: 0x4}, + 57: {region: 0x104, script: 0x57, flags: 0x4}, + 58: {region: 0x106, script: 0x57, flags: 0x4}, + 59: {region: 0x12b, script: 0x57, flags: 0x4}, + 60: {region: 0x124, script: 0x1f, flags: 0x0}, + 61: {region: 0xe8, script: 0x5, flags: 0x4}, + 62: {region: 0xe8, script: 0x5, flags: 0x2}, + 63: {region: 0x53, script: 0x5, flags: 0x0}, + 64: {region: 0xae, script: 0x1f, flags: 0x4}, + 65: {region: 0xc5, script: 0x1f, flags: 0x4}, + 66: {region: 0xae, script: 0x1f, flags: 0x2}, + 67: {region: 0x99, script: 0xe, flags: 0x0}, + 68: {region: 0xdb, script: 0x21, flags: 0x4}, + 69: {region: 0xdb, script: 0x21, flags: 0x2}, + 70: {region: 0x137, script: 0x57, flags: 0x0}, + 71: {region: 0x24, script: 0x5, flags: 0x4}, + 72: {region: 0x53, script: 0x1f, flags: 0x4}, + 73: {region: 0x24, script: 0x5, flags: 0x2}, + 74: {region: 0x8d, script: 0x39, flags: 0x0}, + 75: {region: 0x53, script: 0x38, flags: 0x4}, + 76: {region: 0x53, script: 0x38, flags: 0x2}, + 77: {region: 0x53, script: 0x38, flags: 0x0}, + 78: {region: 0x2f, script: 0x39, flags: 0x4}, + 79: {region: 0x3e, script: 0x39, flags: 0x4}, + 80: {region: 0x7b, script: 0x39, flags: 0x4}, + 81: {region: 0x7e, script: 0x39, flags: 0x4}, + 82: {region: 0x8d, script: 0x39, flags: 0x4}, + 83: {region: 0x95, script: 0x39, flags: 0x4}, + 84: {region: 0xc6, script: 0x39, flags: 0x4}, + 85: {region: 0xd0, script: 0x39, flags: 0x4}, + 86: {region: 0xe2, script: 0x39, flags: 0x4}, + 87: {region: 0xe5, script: 0x39, flags: 0x4}, + 88: {region: 0xe7, script: 0x39, flags: 0x4}, + 89: {region: 0x116, script: 0x39, flags: 0x4}, + 90: {region: 0x123, script: 0x39, flags: 0x4}, + 91: {region: 0x12e, script: 0x39, flags: 0x4}, + 92: {region: 0x135, script: 0x39, flags: 0x4}, + 93: {region: 0x13e, script: 0x39, flags: 0x4}, + 94: {region: 0x12e, script: 0x11, flags: 0x2}, + 95: {region: 0x12e, script: 0x34, flags: 0x2}, + 96: {region: 0x12e, script: 0x39, flags: 0x2}, +} + +type likelyLangScript struct { + lang uint16 + script uint8 + flags uint8 +} + +// likelyRegion is a lookup table, indexed by regionID, for the most likely +// languages and scripts given incomplete information. If more entries exist +// for a given regionID, lang and script are the index and size respectively +// of the list in likelyRegionList. +// TODO: exclude containers and user-definable regions from the list. +// Size: 1432 bytes, 358 elements +var likelyRegion = [358]likelyLangScript{ + 34: {lang: 0xd7, script: 0x57, flags: 0x0}, + 35: {lang: 0x3a, script: 0x5, flags: 0x0}, + 36: {lang: 0x0, script: 0x2, flags: 0x1}, + 39: {lang: 0x2, script: 0x2, flags: 0x1}, + 40: {lang: 0x4, script: 0x2, flags: 0x1}, + 42: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 43: {lang: 0x0, script: 0x57, flags: 0x0}, + 44: {lang: 0x13e, script: 0x57, flags: 0x0}, + 45: {lang: 0x41b, script: 0x57, flags: 0x0}, + 46: {lang: 0x10d, script: 0x57, flags: 0x0}, + 48: {lang: 0x367, script: 0x57, flags: 0x0}, + 49: {lang: 0x444, script: 0x57, flags: 0x0}, + 50: {lang: 0x58, script: 0x57, flags: 0x0}, + 51: {lang: 0x6, script: 0x2, flags: 0x1}, + 53: {lang: 0xa5, script: 0xe, flags: 0x0}, + 54: {lang: 0x367, script: 0x57, flags: 0x0}, + 55: {lang: 0x15e, script: 0x57, flags: 0x0}, + 56: {lang: 0x7e, script: 0x1f, flags: 0x0}, + 57: {lang: 0x3a, script: 0x5, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x57, flags: 0x0}, + 59: {lang: 0x15e, script: 0x57, flags: 0x0}, + 60: {lang: 0x15e, script: 0x57, flags: 0x0}, + 62: {lang: 0x31f, script: 0x57, flags: 0x0}, + 63: {lang: 0x13e, script: 0x57, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x57, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 67: {lang: 0x8, script: 0x2, flags: 0x1}, + 69: {lang: 0x0, script: 0x57, flags: 0x0}, + 71: {lang: 0x71, script: 0x1f, flags: 0x0}, + 73: {lang: 0x512, script: 0x3b, flags: 0x2}, + 74: {lang: 0x31f, script: 0x5, flags: 0x2}, + 75: {lang: 0x445, script: 0x57, flags: 0x0}, + 76: {lang: 0x15e, script: 0x57, flags: 0x0}, + 77: {lang: 0x15e, script: 0x57, flags: 0x0}, + 78: {lang: 0x10d, script: 0x57, flags: 0x0}, + 79: {lang: 0x15e, script: 0x57, flags: 0x0}, + 81: {lang: 0x13e, script: 0x57, flags: 0x0}, + 82: {lang: 0x15e, script: 0x57, flags: 0x0}, + 83: {lang: 0xa, script: 0x4, flags: 0x1}, + 84: {lang: 0x13e, script: 0x57, flags: 0x0}, + 85: {lang: 0x0, script: 0x57, flags: 0x0}, + 86: {lang: 0x13e, script: 0x57, flags: 0x0}, + 89: {lang: 0x13e, script: 0x57, flags: 0x0}, + 90: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 91: {lang: 0x3a1, script: 0x57, flags: 0x0}, + 93: {lang: 0xe, script: 0x2, flags: 0x1}, + 94: {lang: 0xfa, script: 0x57, flags: 0x0}, + 96: {lang: 0x10d, script: 0x57, flags: 0x0}, + 98: {lang: 0x1, script: 0x57, flags: 0x0}, + 99: {lang: 0x101, script: 0x57, flags: 0x0}, + 101: {lang: 0x13e, script: 0x57, flags: 0x0}, + 103: {lang: 0x10, script: 0x2, flags: 0x1}, + 104: {lang: 0x13e, script: 0x57, flags: 0x0}, + 105: {lang: 0x13e, script: 0x57, flags: 0x0}, + 106: {lang: 0x140, script: 0x57, flags: 0x0}, + 107: {lang: 0x3a, script: 0x5, flags: 0x0}, + 108: {lang: 0x3a, script: 0x5, flags: 0x0}, + 109: {lang: 0x46f, script: 0x29, flags: 0x0}, + 110: {lang: 0x13e, script: 0x57, flags: 0x0}, + 111: {lang: 0x12, script: 0x2, flags: 0x1}, + 113: {lang: 0x10d, script: 0x57, flags: 0x0}, + 114: {lang: 0x151, script: 0x57, flags: 0x0}, + 115: {lang: 0x1c0, script: 0x21, flags: 0x2}, + 118: {lang: 0x158, script: 0x57, flags: 0x0}, + 120: {lang: 0x15e, script: 0x57, flags: 0x0}, + 122: {lang: 0x15e, script: 0x57, flags: 0x0}, + 123: {lang: 0x14, script: 0x2, flags: 0x1}, + 125: {lang: 0x16, script: 0x3, flags: 0x1}, + 126: {lang: 0x15e, script: 0x57, flags: 0x0}, + 128: {lang: 0x21, script: 0x57, flags: 0x0}, + 130: {lang: 0x245, script: 0x57, flags: 0x0}, + 132: {lang: 0x15e, script: 0x57, flags: 0x0}, + 133: {lang: 0x15e, script: 0x57, flags: 0x0}, + 134: {lang: 0x13e, script: 0x57, flags: 0x0}, + 135: {lang: 0x19, script: 0x2, flags: 0x1}, + 136: {lang: 0x0, script: 0x57, flags: 0x0}, + 137: {lang: 0x13e, script: 0x57, flags: 0x0}, + 139: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 141: {lang: 0x529, script: 0x39, flags: 0x0}, + 142: {lang: 0x0, script: 0x57, flags: 0x0}, + 143: {lang: 0x13e, script: 0x57, flags: 0x0}, + 144: {lang: 0x1d1, script: 0x57, flags: 0x0}, + 145: {lang: 0x1d4, script: 0x57, flags: 0x0}, + 146: {lang: 0x1d5, script: 0x57, flags: 0x0}, + 148: {lang: 0x13e, script: 0x57, flags: 0x0}, + 149: {lang: 0x1b, script: 0x2, flags: 0x1}, + 151: {lang: 0x1bc, script: 0x3b, flags: 0x0}, + 153: {lang: 0x1d, script: 0x3, flags: 0x1}, + 155: {lang: 0x3a, script: 0x5, flags: 0x0}, + 156: {lang: 0x20, script: 0x2, flags: 0x1}, + 157: {lang: 0x1f8, script: 0x57, flags: 0x0}, + 158: {lang: 0x1f9, script: 0x57, flags: 0x0}, + 161: {lang: 0x3a, script: 0x5, flags: 0x0}, + 162: {lang: 0x200, script: 0x46, flags: 0x0}, + 164: {lang: 0x445, script: 0x57, flags: 0x0}, + 165: {lang: 0x28a, script: 0x1f, flags: 0x0}, + 166: {lang: 0x22, script: 0x3, flags: 0x1}, + 168: {lang: 0x25, script: 0x2, flags: 0x1}, + 170: {lang: 0x254, script: 0x50, flags: 0x0}, + 171: {lang: 0x254, script: 0x50, flags: 0x0}, + 172: {lang: 0x3a, script: 0x5, flags: 0x0}, + 174: {lang: 0x3e2, script: 0x1f, flags: 0x0}, + 175: {lang: 0x27, script: 0x2, flags: 0x1}, + 176: {lang: 0x3a, script: 0x5, flags: 0x0}, + 178: {lang: 0x10d, script: 0x57, flags: 0x0}, + 179: {lang: 0x40c, script: 0xca, flags: 0x0}, + 181: {lang: 0x43b, script: 0x57, flags: 0x0}, + 182: {lang: 0x2c0, script: 0x57, flags: 0x0}, + 183: {lang: 0x15e, script: 0x57, flags: 0x0}, + 184: {lang: 0x2c7, script: 0x57, flags: 0x0}, + 185: {lang: 0x3a, script: 0x5, flags: 0x0}, + 186: {lang: 0x29, script: 0x2, flags: 0x1}, + 187: {lang: 0x15e, script: 0x57, flags: 0x0}, + 188: {lang: 0x2b, script: 0x2, flags: 0x1}, + 189: {lang: 0x432, script: 0x57, flags: 0x0}, + 190: {lang: 0x15e, script: 0x57, flags: 0x0}, + 191: {lang: 0x2f1, script: 0x57, flags: 0x0}, + 194: {lang: 0x2d, script: 0x2, flags: 0x1}, + 195: {lang: 0xa0, script: 0x57, flags: 0x0}, + 196: {lang: 0x2f, script: 0x2, flags: 0x1}, + 197: {lang: 0x31, script: 0x2, flags: 0x1}, + 198: {lang: 0x33, script: 0x2, flags: 0x1}, + 200: {lang: 0x15e, script: 0x57, flags: 0x0}, + 201: {lang: 0x35, script: 0x2, flags: 0x1}, + 203: {lang: 0x320, script: 0x57, flags: 0x0}, + 204: {lang: 0x37, script: 0x3, flags: 0x1}, + 205: {lang: 0x128, script: 0xde, flags: 0x0}, + 207: {lang: 0x13e, script: 0x57, flags: 0x0}, + 208: {lang: 0x31f, script: 0x57, flags: 0x0}, + 209: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 210: {lang: 0x16, script: 0x57, flags: 0x0}, + 211: {lang: 0x15e, script: 0x57, flags: 0x0}, + 212: {lang: 0x1b4, script: 0x57, flags: 0x0}, + 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 216: {lang: 0x13e, script: 0x57, flags: 0x0}, + 217: {lang: 0x367, script: 0x57, flags: 0x0}, + 218: {lang: 0x347, script: 0x57, flags: 0x0}, + 219: {lang: 0x351, script: 0x21, flags: 0x0}, + 225: {lang: 0x3a, script: 0x5, flags: 0x0}, + 226: {lang: 0x13e, script: 0x57, flags: 0x0}, + 228: {lang: 0x13e, script: 0x57, flags: 0x0}, + 229: {lang: 0x15e, script: 0x57, flags: 0x0}, + 230: {lang: 0x486, script: 0x57, flags: 0x0}, + 231: {lang: 0x153, script: 0x57, flags: 0x0}, + 232: {lang: 0x3a, script: 0x3, flags: 0x1}, + 233: {lang: 0x3b3, script: 0x57, flags: 0x0}, + 234: {lang: 0x15e, script: 0x57, flags: 0x0}, + 236: {lang: 0x13e, script: 0x57, flags: 0x0}, + 237: {lang: 0x3a, script: 0x5, flags: 0x0}, + 238: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 240: {lang: 0x3a2, script: 0x57, flags: 0x0}, + 241: {lang: 0x194, script: 0x57, flags: 0x0}, + 243: {lang: 0x3a, script: 0x5, flags: 0x0}, + 258: {lang: 0x15e, script: 0x57, flags: 0x0}, + 260: {lang: 0x3d, script: 0x2, flags: 0x1}, + 261: {lang: 0x432, script: 0x1f, flags: 0x0}, + 262: {lang: 0x3f, script: 0x2, flags: 0x1}, + 263: {lang: 0x3e5, script: 0x57, flags: 0x0}, + 264: {lang: 0x3a, script: 0x5, flags: 0x0}, + 266: {lang: 0x15e, script: 0x57, flags: 0x0}, + 267: {lang: 0x3a, script: 0x5, flags: 0x0}, + 268: {lang: 0x41, script: 0x2, flags: 0x1}, + 271: {lang: 0x416, script: 0x57, flags: 0x0}, + 272: {lang: 0x347, script: 0x57, flags: 0x0}, + 273: {lang: 0x43, script: 0x2, flags: 0x1}, + 275: {lang: 0x1f9, script: 0x57, flags: 0x0}, + 276: {lang: 0x15e, script: 0x57, flags: 0x0}, + 277: {lang: 0x429, script: 0x57, flags: 0x0}, + 278: {lang: 0x367, script: 0x57, flags: 0x0}, + 280: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 282: {lang: 0x13e, script: 0x57, flags: 0x0}, + 284: {lang: 0x45, script: 0x2, flags: 0x1}, + 288: {lang: 0x15e, script: 0x57, flags: 0x0}, + 289: {lang: 0x15e, script: 0x57, flags: 0x0}, + 290: {lang: 0x47, script: 0x2, flags: 0x1}, + 291: {lang: 0x49, script: 0x3, flags: 0x1}, + 292: {lang: 0x4c, script: 0x2, flags: 0x1}, + 293: {lang: 0x477, script: 0x57, flags: 0x0}, + 294: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 295: {lang: 0x476, script: 0x57, flags: 0x0}, + 296: {lang: 0x4e, script: 0x2, flags: 0x1}, + 297: {lang: 0x482, script: 0x57, flags: 0x0}, + 299: {lang: 0x50, script: 0x4, flags: 0x1}, + 301: {lang: 0x4a0, script: 0x57, flags: 0x0}, + 302: {lang: 0x54, script: 0x2, flags: 0x1}, + 303: {lang: 0x445, script: 0x57, flags: 0x0}, + 304: {lang: 0x56, script: 0x3, flags: 0x1}, + 305: {lang: 0x445, script: 0x57, flags: 0x0}, + 309: {lang: 0x512, script: 0x3b, flags: 0x2}, + 310: {lang: 0x13e, script: 0x57, flags: 0x0}, + 311: {lang: 0x4bc, script: 0x57, flags: 0x0}, + 312: {lang: 0x1f9, script: 0x57, flags: 0x0}, + 315: {lang: 0x13e, script: 0x57, flags: 0x0}, + 318: {lang: 0x4c3, script: 0x57, flags: 0x0}, + 319: {lang: 0x8a, script: 0x57, flags: 0x0}, + 320: {lang: 0x15e, script: 0x57, flags: 0x0}, + 322: {lang: 0x41b, script: 0x57, flags: 0x0}, + 333: {lang: 0x59, script: 0x2, flags: 0x1}, + 350: {lang: 0x3a, script: 0x5, flags: 0x0}, + 351: {lang: 0x5b, script: 0x2, flags: 0x1}, + 356: {lang: 0x423, script: 0x57, flags: 0x0}, +} + +// likelyRegionList holds lists info associated with likelyRegion. +// Size: 372 bytes, 93 elements +var likelyRegionList = [93]likelyLangScript{ + 0: {lang: 0x148, script: 0x5, flags: 0x0}, + 1: {lang: 0x476, script: 0x57, flags: 0x0}, + 2: {lang: 0x431, script: 0x57, flags: 0x0}, + 3: {lang: 0x2ff, script: 0x1f, flags: 0x0}, + 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, + 5: {lang: 0x274, script: 0x57, flags: 0x0}, + 6: {lang: 0xb7, script: 0x57, flags: 0x0}, + 7: {lang: 0x432, script: 0x1f, flags: 0x0}, + 8: {lang: 0x12d, script: 0xe0, flags: 0x0}, + 9: {lang: 0x351, script: 0x21, flags: 0x0}, + 10: {lang: 0x529, script: 0x38, flags: 0x0}, + 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, + 12: {lang: 0x523, script: 0x57, flags: 0x0}, + 13: {lang: 0x29a, script: 0xdf, flags: 0x0}, + 14: {lang: 0x136, script: 0x31, flags: 0x0}, + 15: {lang: 0x48a, script: 0x57, flags: 0x0}, + 16: {lang: 0x3a, script: 0x5, flags: 0x0}, + 17: {lang: 0x15e, script: 0x57, flags: 0x0}, + 18: {lang: 0x27, script: 0x29, flags: 0x0}, + 19: {lang: 0x139, script: 0x57, flags: 0x0}, + 20: {lang: 0x26a, script: 0x5, flags: 0x2}, + 21: {lang: 0x512, script: 0x3b, flags: 0x2}, + 22: {lang: 0x210, script: 0x2b, flags: 0x0}, + 23: {lang: 0x5, script: 0x1f, flags: 0x0}, + 24: {lang: 0x274, script: 0x57, flags: 0x0}, + 25: {lang: 0x136, script: 0x31, flags: 0x0}, + 26: {lang: 0x2ff, script: 0x1f, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x57, flags: 0x0}, + 28: {lang: 0x31f, script: 0x5, flags: 0x0}, + 29: {lang: 0x1be, script: 0x21, flags: 0x0}, + 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 31: {lang: 0x236, script: 0x72, flags: 0x0}, + 32: {lang: 0x148, script: 0x5, flags: 0x0}, + 33: {lang: 0x476, script: 0x57, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4b, flags: 0x0}, + 35: {lang: 0xe6, script: 0x5, flags: 0x0}, + 36: {lang: 0x226, script: 0xdf, flags: 0x0}, + 37: {lang: 0x3a, script: 0x5, flags: 0x0}, + 38: {lang: 0x15e, script: 0x57, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x54, flags: 0x0}, + 40: {lang: 0x226, script: 0xdf, flags: 0x0}, + 41: {lang: 0x3a, script: 0x5, flags: 0x0}, + 42: {lang: 0x15e, script: 0x57, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x57, flags: 0x0}, + 44: {lang: 0x4ae, script: 0x1f, flags: 0x0}, + 45: {lang: 0x2ff, script: 0x1f, flags: 0x0}, + 46: {lang: 0x431, script: 0x57, flags: 0x0}, + 47: {lang: 0x331, script: 0x72, flags: 0x0}, + 48: {lang: 0x213, script: 0x57, flags: 0x0}, + 49: {lang: 0x30b, script: 0x1f, flags: 0x0}, + 50: {lang: 0x242, script: 0x5, flags: 0x0}, + 51: {lang: 0x529, script: 0x39, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 53: {lang: 0x3a, script: 0x5, flags: 0x0}, + 54: {lang: 0x15e, script: 0x57, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x57, flags: 0x0}, + 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 57: {lang: 0x88, script: 0x21, flags: 0x0}, + 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 60: {lang: 0xbe, script: 0x21, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x57, flags: 0x0}, + 62: {lang: 0x7e, script: 0x1f, flags: 0x0}, + 63: {lang: 0x3e2, script: 0x1f, flags: 0x0}, + 64: {lang: 0x267, script: 0x57, flags: 0x0}, + 65: {lang: 0x444, script: 0x57, flags: 0x0}, + 66: {lang: 0x512, script: 0x3b, flags: 0x0}, + 67: {lang: 0x412, script: 0x57, flags: 0x0}, + 68: {lang: 0x4ae, script: 0x1f, flags: 0x0}, + 69: {lang: 0x3a, script: 0x5, flags: 0x0}, + 70: {lang: 0x15e, script: 0x57, flags: 0x0}, + 71: {lang: 0x15e, script: 0x57, flags: 0x0}, + 72: {lang: 0x35, script: 0x5, flags: 0x0}, + 73: {lang: 0x46b, script: 0xdf, flags: 0x0}, + 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, + 75: {lang: 0x30f, script: 0x72, flags: 0x0}, + 76: {lang: 0x467, script: 0x1f, flags: 0x0}, + 77: {lang: 0x148, script: 0x5, flags: 0x0}, + 78: {lang: 0x3a, script: 0x5, flags: 0x0}, + 79: {lang: 0x15e, script: 0x57, flags: 0x0}, + 80: {lang: 0x48a, script: 0x57, flags: 0x0}, + 81: {lang: 0x58, script: 0x5, flags: 0x0}, + 82: {lang: 0x219, script: 0x1f, flags: 0x0}, + 83: {lang: 0x81, script: 0x31, flags: 0x0}, + 84: {lang: 0x529, script: 0x39, flags: 0x0}, + 85: {lang: 0x48c, script: 0x57, flags: 0x0}, + 86: {lang: 0x4ae, script: 0x1f, flags: 0x0}, + 87: {lang: 0x512, script: 0x3b, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x57, flags: 0x0}, + 89: {lang: 0x431, script: 0x57, flags: 0x0}, + 90: {lang: 0x432, script: 0x1f, flags: 0x0}, + 91: {lang: 0x15e, script: 0x57, flags: 0x0}, + 92: {lang: 0x446, script: 0x5, flags: 0x0}, +} + +type likelyTag struct { + lang uint16 + region uint16 + script uint8 +} + +// Size: 198 bytes, 33 elements +var likelyRegionGroup = [33]likelyTag{ + 1: {lang: 0x139, region: 0xd6, script: 0x57}, + 2: {lang: 0x139, region: 0x135, script: 0x57}, + 3: {lang: 0x3c0, region: 0x41, script: 0x57}, + 4: {lang: 0x139, region: 0x2f, script: 0x57}, + 5: {lang: 0x139, region: 0xd6, script: 0x57}, + 6: {lang: 0x13e, region: 0xcf, script: 0x57}, + 7: {lang: 0x445, region: 0x12f, script: 0x57}, + 8: {lang: 0x3a, region: 0x6b, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x57}, + 10: {lang: 0x139, region: 0x161, script: 0x57}, + 11: {lang: 0x139, region: 0x135, script: 0x57}, + 12: {lang: 0x139, region: 0x135, script: 0x57}, + 13: {lang: 0x13e, region: 0x59, script: 0x57}, + 14: {lang: 0x529, region: 0x53, script: 0x38}, + 15: {lang: 0x1be, region: 0x99, script: 0x21}, + 16: {lang: 0x1e1, region: 0x95, script: 0x57}, + 17: {lang: 0x1f9, region: 0x9e, script: 0x57}, + 18: {lang: 0x139, region: 0x2f, script: 0x57}, + 19: {lang: 0x139, region: 0xe6, script: 0x57}, + 20: {lang: 0x139, region: 0x8a, script: 0x57}, + 21: {lang: 0x41b, region: 0x142, script: 0x57}, + 22: {lang: 0x529, region: 0x53, script: 0x38}, + 23: {lang: 0x4bc, region: 0x137, script: 0x57}, + 24: {lang: 0x3a, region: 0x108, script: 0x5}, + 25: {lang: 0x3e2, region: 0x106, script: 0x1f}, + 26: {lang: 0x3e2, region: 0x106, script: 0x1f}, + 27: {lang: 0x139, region: 0x7b, script: 0x57}, + 28: {lang: 0x10d, region: 0x60, script: 0x57}, + 29: {lang: 0x139, region: 0xd6, script: 0x57}, + 30: {lang: 0x13e, region: 0x1f, script: 0x57}, + 31: {lang: 0x139, region: 0x9a, script: 0x57}, + 32: {lang: 0x139, region: 0x7b, script: 0x57}, +} + +// Size: 264 bytes, 33 elements +var regionContainment = [33]uint64{ + // Entry 0 - 1F + 0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008, + 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080, + 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c, + 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000, + 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000, + 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000, + 0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000, + // Entry 20 - 3F + 0x0000000100000000, +} + +// regionInclusion maps region identifiers to sets of regions in regionInclusionBits, +// where each set holds all groupings that are directly connected in a region +// containment graph. +// Size: 358 bytes, 358 elements +var regionInclusion = [358]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, + 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, + 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, + 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e, + 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23, + 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b, + 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d, + 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28, + // Entry 40 - 7F + 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, + 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, + 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, + 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, + 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, + 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, + 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, + // Entry 80 - BF + 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, + 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, + 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, + 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, + 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, + 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, + 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, + 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, + // Entry C0 - FF + 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, + 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, + 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, + 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, + 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, + 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, + 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + // Entry 100 - 13F + 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, + 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, + 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, + 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, + 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, + 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, + 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, + 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, + // Entry 140 - 17F + 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, + 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, +} + +// regionInclusionBits is an array of bit vectors where every vector represents +// a set of region groupings. These sets are used to compute the distance +// between two regions for the purpose of language matching. +// Size: 584 bytes, 73 elements +var regionInclusionBits = [73]uint64{ + // Entry 0 - 1F + 0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808, + 0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082, + 0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d, + 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000, + 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010, + 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000, + 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000, + 0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010, + // Entry 20 - 3F + 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000, + 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200, + 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000, + 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080, + 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000, + 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000, + 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3, + // Entry 40 - 5F + 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813, + 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001, + 0x0000000102020001, +} + +// regionInclusionNext marks, for each entry in regionInclusionBits, the set of +// all groups that are reachable from the groups set in the respective entry. +// Size: 73 bytes, 73 elements +var regionInclusionNext = [73]uint8{ + // Entry 0 - 3F + 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01, + 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16, + 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16, + 0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04, + 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09, + 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07, + 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46, + 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e, + // Entry 40 - 7F + 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43, + 0x43, +} + +type parentRel struct { + lang uint16 + script uint8 + maxScript uint8 + toRegion uint16 + fromRegion []uint16 +} + +// Size: 414 bytes, 5 elements +var parents = [5]parentRel{ + 0: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x57, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x57, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, + 4: {lang: 0x529, script: 0x39, maxScript: 0x39, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, +} + +// Total table size 25886 bytes (25KiB); checksum: 50D3D57D diff --git a/vendor/golang.org/x/text/internal/language/tags.go b/vendor/golang.org/x/text/internal/language/tags.go new file mode 100644 index 0000000..e7afd31 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/tags.go @@ -0,0 +1,48 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func MustParse(s string) Tag { + t, err := Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. +// It simplifies safe initialization of Base values. +func MustParseBase(s string) Language { + b, err := ParseBase(s) + if err != nil { + panic(err) + } + return b +} + +// MustParseScript is like ParseScript, but panics if the given script cannot be +// parsed. It simplifies safe initialization of Script values. +func MustParseScript(s string) Script { + scr, err := ParseScript(s) + if err != nil { + panic(err) + } + return scr +} + +// MustParseRegion is like ParseRegion, but panics if the given region cannot be +// parsed. It simplifies safe initialization of Region values. +func MustParseRegion(s string) Region { + r, err := ParseRegion(s) + if err != nil { + panic(err) + } + return r +} + +// Und is the root language. +var Und Tag diff --git a/vendor/golang.org/x/text/internal/tag/tag.go b/vendor/golang.org/x/text/internal/tag/tag.go new file mode 100644 index 0000000..b5d3488 --- /dev/null +++ b/vendor/golang.org/x/text/internal/tag/tag.go @@ -0,0 +1,100 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package tag contains functionality handling tags and related data. +package tag // import "golang.org/x/text/internal/tag" + +import "sort" + +// An Index converts tags to a compact numeric value. +// +// All elements are of size 4. Tags may be up to 4 bytes long. Excess bytes can +// be used to store additional information about the tag. +type Index string + +// Elem returns the element data at the given index. +func (s Index) Elem(x int) string { + return string(s[x*4 : x*4+4]) +} + +// Index reports the index of the given key or -1 if it could not be found. +// Only the first len(key) bytes from the start of the 4-byte entries will be +// considered for the search and the first match in Index will be returned. +func (s Index) Index(key []byte) int { + n := len(key) + // search the index of the first entry with an equal or higher value than + // key in s. + index := sort.Search(len(s)/4, func(i int) bool { + return cmp(s[i*4:i*4+n], key) != -1 + }) + i := index * 4 + if cmp(s[i:i+len(key)], key) != 0 { + return -1 + } + return index +} + +// Next finds the next occurrence of key after index x, which must have been +// obtained from a call to Index using the same key. It returns x+1 or -1. +func (s Index) Next(key []byte, x int) int { + if x++; x*4 < len(s) && cmp(s[x*4:x*4+len(key)], key) == 0 { + return x + } + return -1 +} + +// cmp returns an integer comparing a and b lexicographically. +func cmp(a Index, b []byte) int { + n := len(a) + if len(b) < n { + n = len(b) + } + for i, c := range b[:n] { + switch { + case a[i] > c: + return 1 + case a[i] < c: + return -1 + } + } + switch { + case len(a) < len(b): + return -1 + case len(a) > len(b): + return 1 + } + return 0 +} + +// Compare returns an integer comparing a and b lexicographically. +func Compare(a string, b []byte) int { + return cmp(Index(a), b) +} + +// FixCase reformats b to the same pattern of cases as form. +// If returns false if string b is malformed. +func FixCase(form string, b []byte) bool { + if len(form) != len(b) { + return false + } + for i, c := range b { + if form[i] <= 'Z' { + if c >= 'a' { + c -= 'z' - 'Z' + } + if c < 'A' || 'Z' < c { + return false + } + } else { + if c <= 'Z' { + c += 'z' - 'Z' + } + if c < 'a' || 'z' < c { + return false + } + } + b[i] = c + } + return true +} diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go new file mode 100644 index 0000000..a24fd1a --- /dev/null +++ b/vendor/golang.org/x/text/language/coverage.go @@ -0,0 +1,187 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "fmt" + "sort" + + "golang.org/x/text/internal/language" +) + +// The Coverage interface is used to define the level of coverage of an +// internationalization service. Note that not all types are supported by all +// services. As lists may be generated on the fly, it is recommended that users +// of a Coverage cache the results. +type Coverage interface { + // Tags returns the list of supported tags. + Tags() []Tag + + // BaseLanguages returns the list of supported base languages. + BaseLanguages() []Base + + // Scripts returns the list of supported scripts. + Scripts() []Script + + // Regions returns the list of supported regions. + Regions() []Region +} + +var ( + // Supported defines a Coverage that lists all supported subtags. Tags + // always returns nil. + Supported Coverage = allSubtags{} +) + +// TODO: +// - Support Variants, numbering systems. +// - CLDR coverage levels. +// - Set of common tags defined in this package. + +type allSubtags struct{} + +// Regions returns the list of supported regions. As all regions are in a +// consecutive range, it simply returns a slice of numbers in increasing order. +// The "undefined" region is not returned. +func (s allSubtags) Regions() []Region { + reg := make([]Region, language.NumRegions) + for i := range reg { + reg[i] = Region{language.Region(i + 1)} + } + return reg +} + +// Scripts returns the list of supported scripts. As all scripts are in a +// consecutive range, it simply returns a slice of numbers in increasing order. +// The "undefined" script is not returned. +func (s allSubtags) Scripts() []Script { + scr := make([]Script, language.NumScripts) + for i := range scr { + scr[i] = Script{language.Script(i + 1)} + } + return scr +} + +// BaseLanguages returns the list of all supported base languages. It generates +// the list by traversing the internal structures. +func (s allSubtags) BaseLanguages() []Base { + bs := language.BaseLanguages() + base := make([]Base, len(bs)) + for i, b := range bs { + base[i] = Base{b} + } + return base +} + +// Tags always returns nil. +func (s allSubtags) Tags() []Tag { + return nil +} + +// coverage is used by NewCoverage which is used as a convenient way for +// creating Coverage implementations for partially defined data. Very often a +// package will only need to define a subset of slices. coverage provides a +// convenient way to do this. Moreover, packages using NewCoverage, instead of +// their own implementation, will not break if later new slice types are added. +type coverage struct { + tags func() []Tag + bases func() []Base + scripts func() []Script + regions func() []Region +} + +func (s *coverage) Tags() []Tag { + if s.tags == nil { + return nil + } + return s.tags() +} + +// bases implements sort.Interface and is used to sort base languages. +type bases []Base + +func (b bases) Len() int { + return len(b) +} + +func (b bases) Swap(i, j int) { + b[i], b[j] = b[j], b[i] +} + +func (b bases) Less(i, j int) bool { + return b[i].langID < b[j].langID +} + +// BaseLanguages returns the result from calling s.bases if it is specified or +// otherwise derives the set of supported base languages from tags. +func (s *coverage) BaseLanguages() []Base { + if s.bases == nil { + tags := s.Tags() + if len(tags) == 0 { + return nil + } + a := make([]Base, len(tags)) + for i, t := range tags { + a[i] = Base{language.Language(t.lang())} + } + sort.Sort(bases(a)) + k := 0 + for i := 1; i < len(a); i++ { + if a[k] != a[i] { + k++ + a[k] = a[i] + } + } + return a[:k+1] + } + return s.bases() +} + +func (s *coverage) Scripts() []Script { + if s.scripts == nil { + return nil + } + return s.scripts() +} + +func (s *coverage) Regions() []Region { + if s.regions == nil { + return nil + } + return s.regions() +} + +// NewCoverage returns a Coverage for the given lists. It is typically used by +// packages providing internationalization services to define their level of +// coverage. A list may be of type []T or func() []T, where T is either Tag, +// Base, Script or Region. The returned Coverage derives the value for Bases +// from Tags if no func or slice for []Base is specified. For other unspecified +// types the returned Coverage will return nil for the respective methods. +func NewCoverage(list ...interface{}) Coverage { + s := &coverage{} + for _, x := range list { + switch v := x.(type) { + case func() []Base: + s.bases = v + case func() []Script: + s.scripts = v + case func() []Region: + s.regions = v + case func() []Tag: + s.tags = v + case []Base: + s.bases = func() []Base { return v } + case []Script: + s.scripts = func() []Script { return v } + case []Region: + s.regions = func() []Region { return v } + case []Tag: + s.tags = func() []Tag { return v } + default: + panic(fmt.Sprintf("language: unsupported set type %T", v)) + } + } + return s +} diff --git a/vendor/golang.org/x/text/language/doc.go b/vendor/golang.org/x/text/language/doc.go new file mode 100644 index 0000000..8afecd5 --- /dev/null +++ b/vendor/golang.org/x/text/language/doc.go @@ -0,0 +1,102 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package language implements BCP 47 language tags and related functionality. +// +// The most important function of package language is to match a list of +// user-preferred languages to a list of supported languages. +// It alleviates the developer of dealing with the complexity of this process +// and provides the user with the best experience +// (see https://blog.golang.org/matchlang). +// +// +// Matching preferred against supported languages +// +// A Matcher for an application that supports English, Australian English, +// Danish, and standard Mandarin can be created as follows: +// +// var matcher = language.NewMatcher([]language.Tag{ +// language.English, // The first language is used as fallback. +// language.MustParse("en-AU"), +// language.Danish, +// language.Chinese, +// }) +// +// This list of supported languages is typically implied by the languages for +// which there exists translations of the user interface. +// +// User-preferred languages usually come as a comma-separated list of BCP 47 +// language tags. +// The MatchString finds best matches for such strings: +// +// handler(w http.ResponseWriter, r *http.Request) { +// lang, _ := r.Cookie("lang") +// accept := r.Header.Get("Accept-Language") +// tag, _ := language.MatchStrings(matcher, lang.String(), accept) +// +// // tag should now be used for the initialization of any +// // locale-specific service. +// } +// +// The Matcher's Match method can be used to match Tags directly. +// +// Matchers are aware of the intricacies of equivalence between languages, such +// as deprecated subtags, legacy tags, macro languages, mutual +// intelligibility between scripts and languages, and transparently passing +// BCP 47 user configuration. +// For instance, it will know that a reader of BokmÃ¥l Danish can read Norwegian +// and will know that Cantonese ("yue") is a good match for "zh-HK". +// +// +// Using match results +// +// To guarantee a consistent user experience to the user it is important to +// use the same language tag for the selection of any locale-specific services. +// For example, it is utterly confusing to substitute spelled-out numbers +// or dates in one language in text of another language. +// More subtly confusing is using the wrong sorting order or casing +// algorithm for a certain language. +// +// All the packages in x/text that provide locale-specific services +// (e.g. collate, cases) should be initialized with the tag that was +// obtained at the start of an interaction with the user. +// +// Note that Tag that is returned by Match and MatchString may differ from any +// of the supported languages, as it may contain carried over settings from +// the user tags. +// This may be inconvenient when your application has some additional +// locale-specific data for your supported languages. +// Match and MatchString both return the index of the matched supported tag +// to simplify associating such data with the matched tag. +// +// +// Canonicalization +// +// If one uses the Matcher to compare languages one does not need to +// worry about canonicalization. +// +// The meaning of a Tag varies per application. The language package +// therefore delays canonicalization and preserves information as much +// as possible. The Matcher, however, will always take into account that +// two different tags may represent the same language. +// +// By default, only legacy and deprecated tags are converted into their +// canonical equivalent. All other information is preserved. This approach makes +// the confidence scores more accurate and allows matchers to distinguish +// between variants that are otherwise lost. +// +// As a consequence, two tags that should be treated as identical according to +// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The +// Matcher handles such distinctions, though, and is aware of the +// equivalence relations. The CanonType type can be used to alter the +// canonicalization form. +// +// References +// +// BCP 47 - Tags for Identifying Languages http://tools.ietf.org/html/bcp47 +// +package language // import "golang.org/x/text/language" + +// TODO: explanation on how to match languages for your own locale-specific +// service. diff --git a/vendor/golang.org/x/text/language/go1_1.go b/vendor/golang.org/x/text/language/go1_1.go new file mode 100644 index 0000000..380f4c0 --- /dev/null +++ b/vendor/golang.org/x/text/language/go1_1.go @@ -0,0 +1,38 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build !go1.2 + +package language + +import "sort" + +func sortStable(s sort.Interface) { + ss := stableSort{ + s: s, + pos: make([]int, s.Len()), + } + for i := range ss.pos { + ss.pos[i] = i + } + sort.Sort(&ss) +} + +type stableSort struct { + s sort.Interface + pos []int +} + +func (s *stableSort) Len() int { + return len(s.pos) +} + +func (s *stableSort) Less(i, j int) bool { + return s.s.Less(i, j) || !s.s.Less(j, i) && s.pos[i] < s.pos[j] +} + +func (s *stableSort) Swap(i, j int) { + s.s.Swap(i, j) + s.pos[i], s.pos[j] = s.pos[j], s.pos[i] +} diff --git a/vendor/golang.org/x/text/language/go1_2.go b/vendor/golang.org/x/text/language/go1_2.go new file mode 100644 index 0000000..38268c5 --- /dev/null +++ b/vendor/golang.org/x/text/language/go1_2.go @@ -0,0 +1,11 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build go1.2 + +package language + +import "sort" + +var sortStable = sort.Stable diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go new file mode 100644 index 0000000..abfa17f --- /dev/null +++ b/vendor/golang.org/x/text/language/language.go @@ -0,0 +1,601 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go -output tables.go + +package language + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "strings" + + "golang.org/x/text/internal/language" + "golang.org/x/text/internal/language/compact" +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. +type Tag compact.Tag + +func makeTag(t language.Tag) (tag Tag) { + return Tag(compact.Make(t)) +} + +func (t *Tag) tag() language.Tag { + return (*compact.Tag)(t).Tag() +} + +func (t *Tag) isCompact() bool { + return (*compact.Tag)(t).IsCompact() +} + +// TODO: improve performance. +func (t *Tag) lang() language.Language { return t.tag().LangID } +func (t *Tag) region() language.Region { return t.tag().RegionID } +func (t *Tag) script() language.Script { return t.tag().ScriptID } + +// Make is a convenience wrapper for Parse that omits the error. +// In case of an error, a sensible default is returned. +func Make(s string) Tag { + return Default.Make(s) +} + +// Make is a convenience wrapper for c.Parse that omits the error. +// In case of an error, a sensible default is returned. +func (c CanonType) Make(s string) Tag { + t, _ := c.Parse(s) + return t +} + +// Raw returns the raw base language, script and region, without making an +// attempt to infer their values. +func (t Tag) Raw() (b Base, s Script, r Region) { + tt := t.tag() + return Base{tt.LangID}, Script{tt.ScriptID}, Region{tt.RegionID} +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + return compact.Tag(t).IsRoot() +} + +// CanonType can be used to enable or disable various types of canonicalization. +type CanonType int + +const ( + // Replace deprecated base languages with their preferred replacements. + DeprecatedBase CanonType = 1 << iota + // Replace deprecated scripts with their preferred replacements. + DeprecatedScript + // Replace deprecated regions with their preferred replacements. + DeprecatedRegion + // Remove redundant scripts. + SuppressScript + // Normalize legacy encodings. This includes legacy languages defined in + // CLDR as well as bibliographic codes defined in ISO-639. + Legacy + // Map the dominant language of a macro language group to the macro language + // subtag. For example cmn -> zh. + Macro + // The CLDR flag should be used if full compatibility with CLDR is required. + // There are a few cases where language.Tag may differ from CLDR. To follow all + // of CLDR's suggestions, use All|CLDR. + CLDR + + // Raw can be used to Compose or Parse without Canonicalization. + Raw CanonType = 0 + + // Replace all deprecated tags with their preferred replacements. + Deprecated = DeprecatedBase | DeprecatedScript | DeprecatedRegion + + // All canonicalizations recommended by BCP 47. + BCP47 = Deprecated | SuppressScript + + // All canonicalizations. + All = BCP47 | Legacy | Macro + + // Default is the canonicalization used by Parse, Make and Compose. To + // preserve as much information as possible, canonicalizations that remove + // potentially valuable information are not included. The Matcher is + // designed to recognize similar tags that would be the same if + // they were canonicalized using All. + Default = Deprecated | Legacy + + canonLang = DeprecatedBase | Legacy | Macro + + // TODO: LikelyScript, LikelyRegion: suppress similar to ICU. +) + +// canonicalize returns the canonicalized equivalent of the tag and +// whether there was any change. +func canonicalize(c CanonType, t language.Tag) (language.Tag, bool) { + if c == Raw { + return t, false + } + changed := false + if c&SuppressScript != 0 { + if t.LangID.SuppressScript() == t.ScriptID { + t.ScriptID = 0 + changed = true + } + } + if c&canonLang != 0 { + for { + if l, aliasType := t.LangID.Canonicalize(); l != t.LangID { + switch aliasType { + case language.Legacy: + if c&Legacy != 0 { + if t.LangID == _sh && t.ScriptID == 0 { + t.ScriptID = _Latn + } + t.LangID = l + changed = true + } + case language.Macro: + if c&Macro != 0 { + // We deviate here from CLDR. The mapping "nb" -> "no" + // qualifies as a typical Macro language mapping. However, + // for legacy reasons, CLDR maps "no", the macro language + // code for Norwegian, to the dominant variant "nb". This + // change is currently under consideration for CLDR as well. + // See https://unicode.org/cldr/trac/ticket/2698 and also + // https://unicode.org/cldr/trac/ticket/1790 for some of the + // practical implications. TODO: this check could be removed + // if CLDR adopts this change. + if c&CLDR == 0 || t.LangID != _nb { + changed = true + t.LangID = l + } + } + case language.Deprecated: + if c&DeprecatedBase != 0 { + if t.LangID == _mo && t.RegionID == 0 { + t.RegionID = _MD + } + t.LangID = l + changed = true + // Other canonicalization types may still apply. + continue + } + } + } else if c&Legacy != 0 && t.LangID == _no && c&CLDR != 0 { + t.LangID = _nb + changed = true + } + break + } + } + if c&DeprecatedScript != 0 { + if t.ScriptID == _Qaai { + changed = true + t.ScriptID = _Zinh + } + } + if c&DeprecatedRegion != 0 { + if r := t.RegionID.Canonicalize(); r != t.RegionID { + changed = true + t.RegionID = r + } + } + return t, changed +} + +// Canonicalize returns the canonicalized equivalent of the tag. +func (c CanonType) Canonicalize(t Tag) (Tag, error) { + // First try fast path. + if t.isCompact() { + if _, changed := canonicalize(c, compact.Tag(t).Tag()); !changed { + return t, nil + } + } + // It is unlikely that one will canonicalize a tag after matching. So do + // a slow but simple approach here. + if tag, changed := canonicalize(c, t.tag()); changed { + tag.RemakeString() + return makeTag(tag), nil + } + return t, nil + +} + +// Confidence indicates the level of certainty for a given return value. +// For example, Serbian may be written in Cyrillic or Latin script. +// The confidence level indicates whether a value was explicitly specified, +// whether it is typically the only possible value, or whether there is +// an ambiguity. +type Confidence int + +const ( + No Confidence = iota // full confidence that there was no match + Low // most likely value picked out of a set of alternatives + High // value is generally assumed to be the correct match + Exact // exact match or explicitly specified value +) + +var confName = []string{"No", "Low", "High", "Exact"} + +func (c Confidence) String() string { + return confName[c] +} + +// String returns the canonical string representation of the language tag. +func (t Tag) String() string { + return t.tag().String() +} + +// MarshalText implements encoding.TextMarshaler. +func (t Tag) MarshalText() (text []byte, err error) { + return t.tag().MarshalText() +} + +// UnmarshalText implements encoding.TextUnmarshaler. +func (t *Tag) UnmarshalText(text []byte) error { + var tag language.Tag + err := tag.UnmarshalText(text) + *t = makeTag(tag) + return err +} + +// Base returns the base language of the language tag. If the base language is +// unspecified, an attempt will be made to infer it from the context. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Base() (Base, Confidence) { + if b := t.lang(); b != 0 { + return Base{b}, Exact + } + tt := t.tag() + c := High + if tt.ScriptID == 0 && !tt.RegionID.IsCountry() { + c = Low + } + if tag, err := tt.Maximize(); err == nil && tag.LangID != 0 { + return Base{tag.LangID}, c + } + return Base{0}, No +} + +// Script infers the script for the language tag. If it was not explicitly given, it will infer +// a most likely candidate. +// If more than one script is commonly used for a language, the most likely one +// is returned with a low confidence indication. For example, it returns (Cyrl, Low) +// for Serbian. +// If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined) +// as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks +// common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts. +// See https://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for +// unknown value in CLDR. (Zzzz, Exact) is returned if Zzzz was explicitly specified. +// Note that an inferred script is never guaranteed to be the correct one. Latin is +// almost exclusively used for Afrikaans, but Arabic has been used for some texts +// in the past. Also, the script that is commonly used may change over time. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Script() (Script, Confidence) { + if scr := t.script(); scr != 0 { + return Script{scr}, Exact + } + tt := t.tag() + sc, c := language.Script(_Zzzz), No + if scr := tt.LangID.SuppressScript(); scr != 0 { + // Note: it is not always the case that a language with a suppress + // script value is only written in one script (e.g. kk, ms, pa). + if tt.RegionID == 0 { + return Script{scr}, High + } + sc, c = scr, High + } + if tag, err := tt.Maximize(); err == nil { + if tag.ScriptID != sc { + sc, c = tag.ScriptID, Low + } + } else { + tt, _ = canonicalize(Deprecated|Macro, tt) + if tag, err := tt.Maximize(); err == nil && tag.ScriptID != sc { + sc, c = tag.ScriptID, Low + } + } + return Script{sc}, c +} + +// Region returns the region for the language tag. If it was not explicitly given, it will +// infer a most likely candidate from the context. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Region() (Region, Confidence) { + if r := t.region(); r != 0 { + return Region{r}, Exact + } + tt := t.tag() + if tt, err := tt.Maximize(); err == nil { + return Region{tt.RegionID}, Low // TODO: differentiate between high and low. + } + tt, _ = canonicalize(Deprecated|Macro, tt) + if tag, err := tt.Maximize(); err == nil { + return Region{tag.RegionID}, Low + } + return Region{_ZZ}, No // TODO: return world instead of undetermined? +} + +// Variants returns the variants specified explicitly for this language tag. +// or nil if no variant was specified. +func (t Tag) Variants() []Variant { + if !compact.Tag(t).MayHaveVariants() { + return nil + } + v := []Variant{} + x, str := "", t.tag().Variants() + for str != "" { + x, str = nextToken(str) + v = append(v, Variant{x}) + } + return v +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +// +// Parent returns a tag for a less specific language that is mutually +// intelligible or Und if there is no such language. This may not be the same as +// simply stripping the last BCP 47 subtag. For instance, the parent of "zh-TW" +// is "zh-Hant", and the parent of "zh-Hant" is "und". +func (t Tag) Parent() Tag { + return Tag(compact.Tag(t).Parent()) +} + +// returns token t and the rest of the string. +func nextToken(s string) (t, tail string) { + p := strings.Index(s[1:], "-") + if p == -1 { + return s[1:], "" + } + p++ + return s[1:p], s[p:] +} + +// Extension is a single BCP 47 extension. +type Extension struct { + s string +} + +// String returns the string representation of the extension, including the +// type tag. +func (e Extension) String() string { + return e.s +} + +// ParseExtension parses s as an extension and returns it on success. +func ParseExtension(s string) (e Extension, err error) { + ext, err := language.ParseExtension(s) + return Extension{ext}, err +} + +// Type returns the one-byte extension type of e. It returns 0 for the zero +// exception. +func (e Extension) Type() byte { + if e.s == "" { + return 0 + } + return e.s[0] +} + +// Tokens returns the list of tokens of e. +func (e Extension) Tokens() []string { + return strings.Split(e.s, "-") +} + +// Extension returns the extension of type x for tag t. It will return +// false for ok if t does not have the requested extension. The returned +// extension will be invalid in this case. +func (t Tag) Extension(x byte) (ext Extension, ok bool) { + if !compact.Tag(t).MayHaveExtensions() { + return Extension{}, false + } + e, ok := t.tag().Extension(x) + return Extension{e}, ok +} + +// Extensions returns all extensions of t. +func (t Tag) Extensions() []Extension { + if !compact.Tag(t).MayHaveExtensions() { + return nil + } + e := []Extension{} + for _, ext := range t.tag().Extensions() { + e = append(e, Extension{ext}) + } + return e +} + +// TypeForKey returns the type associated with the given key, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// TypeForKey will traverse the inheritance chain to get the correct value. +func (t Tag) TypeForKey(key string) string { + if !compact.Tag(t).MayHaveExtensions() { + if key != "rg" && key != "va" { + return "" + } + } + return t.tag().TypeForKey(key) +} + +// SetTypeForKey returns a new Tag with the key set to type, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// An empty value removes an existing pair with the same key. +func (t Tag) SetTypeForKey(key, value string) (Tag, error) { + tt, err := t.tag().SetTypeForKey(key, value) + return makeTag(tt), err +} + +// NumCompactTags is the number of compact tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = compact.NumCompactTags + +// CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags +// for which data exists in the text repository.The index will change over time +// and should not be stored in persistent storage. If t does not match a compact +// index, exact will be false and the compact index will be returned for the +// first match after repeatedly taking the Parent of t. +func CompactIndex(t Tag) (index int, exact bool) { + id, exact := compact.LanguageID(compact.Tag(t)) + return int(id), exact +} + +var root = language.Tag{} + +// Base is an ISO 639 language code, used for encoding the base language +// of a language tag. +type Base struct { + langID language.Language +} + +// ParseBase parses a 2- or 3-letter ISO 639 code. +// It returns a ValueError if s is a well-formed but unknown language identifier +// or another error if another error occurred. +func ParseBase(s string) (Base, error) { + l, err := language.ParseBase(s) + return Base{l}, err +} + +// String returns the BCP 47 representation of the base language. +func (b Base) String() string { + return b.langID.String() +} + +// ISO3 returns the ISO 639-3 language code. +func (b Base) ISO3() string { + return b.langID.ISO3() +} + +// IsPrivateUse reports whether this language code is reserved for private use. +func (b Base) IsPrivateUse() bool { + return b.langID.IsPrivateUse() +} + +// Script is a 4-letter ISO 15924 code for representing scripts. +// It is idiomatically represented in title case. +type Script struct { + scriptID language.Script +} + +// ParseScript parses a 4-letter ISO 15924 code. +// It returns a ValueError if s is a well-formed but unknown script identifier +// or another error if another error occurred. +func ParseScript(s string) (Script, error) { + sc, err := language.ParseScript(s) + return Script{sc}, err +} + +// String returns the script code in title case. +// It returns "Zzzz" for an unspecified script. +func (s Script) String() string { + return s.scriptID.String() +} + +// IsPrivateUse reports whether this script code is reserved for private use. +func (s Script) IsPrivateUse() bool { + return s.scriptID.IsPrivateUse() +} + +// Region is an ISO 3166-1 or UN M.49 code for representing countries and regions. +type Region struct { + regionID language.Region +} + +// EncodeM49 returns the Region for the given UN M.49 code. +// It returns an error if r is not a valid code. +func EncodeM49(r int) (Region, error) { + rid, err := language.EncodeM49(r) + return Region{rid}, err +} + +// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. +// It returns a ValueError if s is a well-formed but unknown region identifier +// or another error if another error occurred. +func ParseRegion(s string) (Region, error) { + r, err := language.ParseRegion(s) + return Region{r}, err +} + +// String returns the BCP 47 representation for the region. +// It returns "ZZ" for an unspecified region. +func (r Region) String() string { + return r.regionID.String() +} + +// ISO3 returns the 3-letter ISO code of r. +// Note that not all regions have a 3-letter ISO code. +// In such cases this method returns "ZZZ". +func (r Region) ISO3() string { + return r.regionID.ISO3() +} + +// M49 returns the UN M.49 encoding of r, or 0 if this encoding +// is not defined for r. +func (r Region) M49() int { + return r.regionID.M49() +} + +// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This +// may include private-use tags that are assigned by CLDR and used in this +// implementation. So IsPrivateUse and IsCountry can be simultaneously true. +func (r Region) IsPrivateUse() bool { + return r.regionID.IsPrivateUse() +} + +// IsCountry returns whether this region is a country or autonomous area. This +// includes non-standard definitions from CLDR. +func (r Region) IsCountry() bool { + return r.regionID.IsCountry() +} + +// IsGroup returns whether this region defines a collection of regions. This +// includes non-standard definitions from CLDR. +func (r Region) IsGroup() bool { + return r.regionID.IsGroup() +} + +// Contains returns whether Region c is contained by Region r. It returns true +// if c == r. +func (r Region) Contains(c Region) bool { + return r.regionID.Contains(c.regionID) +} + +// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. +// In all other cases it returns either the region itself or an error. +// +// This method may return an error for a region for which there exists a +// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The +// region will already be canonicalized it was obtained from a Tag that was +// obtained using any of the default methods. +func (r Region) TLD() (Region, error) { + tld, err := r.regionID.TLD() + return Region{tld}, err +} + +// Canonicalize returns the region or a possible replacement if the region is +// deprecated. It will not return a replacement for deprecated regions that +// are split into multiple regions. +func (r Region) Canonicalize() Region { + return Region{r.regionID.Canonicalize()} +} + +// Variant represents a registered variant of a language as defined by BCP 47. +type Variant struct { + variant string +} + +// ParseVariant parses and returns a Variant. An error is returned if s is not +// a valid variant. +func ParseVariant(s string) (Variant, error) { + v, err := language.ParseVariant(s) + return Variant{v.String()}, err +} + +// String returns the string representation of the variant. +func (v Variant) String() string { + return v.variant +} diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go new file mode 100644 index 0000000..f734921 --- /dev/null +++ b/vendor/golang.org/x/text/language/match.go @@ -0,0 +1,735 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "errors" + "strings" + + "golang.org/x/text/internal/language" +) + +// A MatchOption configures a Matcher. +type MatchOption func(*matcher) + +// PreferSameScript will, in the absence of a match, result in the first +// preferred tag with the same script as a supported tag to match this supported +// tag. The default is currently true, but this may change in the future. +func PreferSameScript(preferSame bool) MatchOption { + return func(m *matcher) { m.preferSameScript = preferSame } +} + +// TODO(v1.0.0): consider making Matcher a concrete type, instead of interface. +// There doesn't seem to be too much need for multiple types. +// Making it a concrete type allows MatchStrings to be a method, which will +// improve its discoverability. + +// MatchStrings parses and matches the given strings until one of them matches +// the language in the Matcher. A string may be an Accept-Language header as +// handled by ParseAcceptLanguage. The default language is returned if no +// other language matched. +func MatchStrings(m Matcher, lang ...string) (tag Tag, index int) { + for _, accept := range lang { + desired, _, err := ParseAcceptLanguage(accept) + if err != nil { + continue + } + if tag, index, conf := m.Match(desired...); conf != No { + return tag, index + } + } + tag, index, _ = m.Match() + return +} + +// Matcher is the interface that wraps the Match method. +// +// Match returns the best match for any of the given tags, along with +// a unique index associated with the returned tag and a confidence +// score. +type Matcher interface { + Match(t ...Tag) (tag Tag, index int, c Confidence) +} + +// Comprehends reports the confidence score for a speaker of a given language +// to being able to comprehend the written form of an alternative language. +func Comprehends(speaker, alternative Tag) Confidence { + _, _, c := NewMatcher([]Tag{alternative}).Match(speaker) + return c +} + +// NewMatcher returns a Matcher that matches an ordered list of preferred tags +// against a list of supported tags based on written intelligibility, closeness +// of dialect, equivalence of subtags and various other rules. It is initialized +// with the list of supported tags. The first element is used as the default +// value in case no match is found. +// +// Its Match method matches the first of the given Tags to reach a certain +// confidence threshold. The tags passed to Match should therefore be specified +// in order of preference. Extensions are ignored for matching. +// +// The index returned by the Match method corresponds to the index of the +// matched tag in t, but is augmented with the Unicode extension ('u')of the +// corresponding preferred tag. This allows user locale options to be passed +// transparently. +func NewMatcher(t []Tag, options ...MatchOption) Matcher { + return newMatcher(t, options) +} + +func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) { + var tt language.Tag + match, w, c := m.getBest(want...) + if match != nil { + tt, index = match.tag, match.index + } else { + // TODO: this should be an option + tt = m.default_.tag + if m.preferSameScript { + outer: + for _, w := range want { + script, _ := w.Script() + if script.scriptID == 0 { + // Don't do anything if there is no script, such as with + // private subtags. + continue + } + for i, h := range m.supported { + if script.scriptID == h.maxScript { + tt, index = h.tag, i + break outer + } + } + } + } + // TODO: select first language tag based on script. + } + if w.RegionID != tt.RegionID && w.RegionID != 0 { + if w.RegionID != 0 && tt.RegionID != 0 && tt.RegionID.Contains(w.RegionID) { + tt.RegionID = w.RegionID + tt.RemakeString() + } else if r := w.RegionID.String(); len(r) == 2 { + // TODO: also filter macro and deprecated. + tt, _ = tt.SetTypeForKey("rg", strings.ToLower(r)+"zzzz") + } + } + // Copy options from the user-provided tag into the result tag. This is hard + // to do after the fact, so we do it here. + // TODO: add in alternative variants to -u-va-. + // TODO: add preferred region to -u-rg-. + if e := w.Extensions(); len(e) > 0 { + b := language.Builder{} + b.SetTag(tt) + for _, e := range e { + b.AddExt(e) + } + tt = b.Make() + } + return makeTag(tt), index, c +} + +// ErrMissingLikelyTagsData indicates no information was available +// to compute likely values of missing tags. +var ErrMissingLikelyTagsData = errors.New("missing likely tags data") + +// func (t *Tag) setTagsFrom(id Tag) { +// t.LangID = id.LangID +// t.ScriptID = id.ScriptID +// t.RegionID = id.RegionID +// } + +// Tag Matching +// CLDR defines an algorithm for finding the best match between two sets of language +// tags. The basic algorithm defines how to score a possible match and then find +// the match with the best score +// (see https://www.unicode.org/reports/tr35/#LanguageMatching). +// Using scoring has several disadvantages. The scoring obfuscates the importance of +// the various factors considered, making the algorithm harder to understand. Using +// scoring also requires the full score to be computed for each pair of tags. +// +// We will use a different algorithm which aims to have the following properties: +// - clarity on the precedence of the various selection factors, and +// - improved performance by allowing early termination of a comparison. +// +// Matching algorithm (overview) +// Input: +// - supported: a set of supported tags +// - default: the default tag to return in case there is no match +// - desired: list of desired tags, ordered by preference, starting with +// the most-preferred. +// +// Algorithm: +// 1) Set the best match to the lowest confidence level +// 2) For each tag in "desired": +// a) For each tag in "supported": +// 1) compute the match between the two tags. +// 2) if the match is better than the previous best match, replace it +// with the new match. (see next section) +// b) if the current best match is Exact and pin is true the result will be +// frozen to the language found thusfar, although better matches may +// still be found for the same language. +// 3) If the best match so far is below a certain threshold, return "default". +// +// Ranking: +// We use two phases to determine whether one pair of tags are a better match +// than another pair of tags. First, we determine a rough confidence level. If the +// levels are different, the one with the highest confidence wins. +// Second, if the rough confidence levels are identical, we use a set of tie-breaker +// rules. +// +// The confidence level of matching a pair of tags is determined by finding the +// lowest confidence level of any matches of the corresponding subtags (the +// result is deemed as good as its weakest link). +// We define the following levels: +// Exact - An exact match of a subtag, before adding likely subtags. +// MaxExact - An exact match of a subtag, after adding likely subtags. +// [See Note 2]. +// High - High level of mutual intelligibility between different subtag +// variants. +// Low - Low level of mutual intelligibility between different subtag +// variants. +// No - No mutual intelligibility. +// +// The following levels can occur for each type of subtag: +// Base: Exact, MaxExact, High, Low, No +// Script: Exact, MaxExact [see Note 3], Low, No +// Region: Exact, MaxExact, High +// Variant: Exact, High +// Private: Exact, No +// +// Any result with a confidence level of Low or higher is deemed a possible match. +// Once a desired tag matches any of the supported tags with a level of MaxExact +// or higher, the next desired tag is not considered (see Step 2.b). +// Note that CLDR provides languageMatching data that defines close equivalence +// classes for base languages, scripts and regions. +// +// Tie-breaking +// If we get the same confidence level for two matches, we apply a sequence of +// tie-breaking rules. The first that succeeds defines the result. The rules are +// applied in the following order. +// 1) Original language was defined and was identical. +// 2) Original region was defined and was identical. +// 3) Distance between two maximized regions was the smallest. +// 4) Original script was defined and was identical. +// 5) Distance from want tag to have tag using the parent relation [see Note 5.] +// If there is still no winner after these rules are applied, the first match +// found wins. +// +// Notes: +// [2] In practice, as matching of Exact is done in a separate phase from +// matching the other levels, we reuse the Exact level to mean MaxExact in +// the second phase. As a consequence, we only need the levels defined by +// the Confidence type. The MaxExact confidence level is mapped to High in +// the public API. +// [3] We do not differentiate between maximized script values that were derived +// from suppressScript versus most likely tag data. We determined that in +// ranking the two, one ranks just after the other. Moreover, the two cannot +// occur concurrently. As a consequence, they are identical for practical +// purposes. +// [4] In case of deprecated, macro-equivalents and legacy mappings, we assign +// the MaxExact level to allow iw vs he to still be a closer match than +// en-AU vs en-US, for example. +// [5] In CLDR a locale inherits fields that are unspecified for this locale +// from its parent. Therefore, if a locale is a parent of another locale, +// it is a strong measure for closeness, especially when no other tie +// breaker rule applies. One could also argue it is inconsistent, for +// example, when pt-AO matches pt (which CLDR equates with pt-BR), even +// though its parent is pt-PT according to the inheritance rules. +// +// Implementation Details: +// There are several performance considerations worth pointing out. Most notably, +// we preprocess as much as possible (within reason) at the time of creation of a +// matcher. This includes: +// - creating a per-language map, which includes data for the raw base language +// and its canonicalized variant (if applicable), +// - expanding entries for the equivalence classes defined in CLDR's +// languageMatch data. +// The per-language map ensures that typically only a very small number of tags +// need to be considered. The pre-expansion of canonicalized subtags and +// equivalence classes reduces the amount of map lookups that need to be done at +// runtime. + +// matcher keeps a set of supported language tags, indexed by language. +type matcher struct { + default_ *haveTag + supported []*haveTag + index map[language.Language]*matchHeader + passSettings bool + preferSameScript bool +} + +// matchHeader has the lists of tags for exact matches and matches based on +// maximized and canonicalized tags for a given language. +type matchHeader struct { + haveTags []*haveTag + original bool +} + +// haveTag holds a supported Tag and its maximized script and region. The maximized +// or canonicalized language is not stored as it is not needed during matching. +type haveTag struct { + tag language.Tag + + // index of this tag in the original list of supported tags. + index int + + // conf is the maximum confidence that can result from matching this haveTag. + // When conf < Exact this means it was inserted after applying a CLDR equivalence rule. + conf Confidence + + // Maximized region and script. + maxRegion language.Region + maxScript language.Script + + // altScript may be checked as an alternative match to maxScript. If altScript + // matches, the confidence level for this match is Low. Theoretically there + // could be multiple alternative scripts. This does not occur in practice. + altScript language.Script + + // nextMax is the index of the next haveTag with the same maximized tags. + nextMax uint16 +} + +func makeHaveTag(tag language.Tag, index int) (haveTag, language.Language) { + max := tag + if tag.LangID != 0 || tag.RegionID != 0 || tag.ScriptID != 0 { + max, _ = canonicalize(All, max) + max, _ = max.Maximize() + max.RemakeString() + } + return haveTag{tag, index, Exact, max.RegionID, max.ScriptID, altScript(max.LangID, max.ScriptID), 0}, max.LangID +} + +// altScript returns an alternative script that may match the given script with +// a low confidence. At the moment, the langMatch data allows for at most one +// script to map to another and we rely on this to keep the code simple. +func altScript(l language.Language, s language.Script) language.Script { + for _, alt := range matchScript { + // TODO: also match cases where language is not the same. + if (language.Language(alt.wantLang) == l || language.Language(alt.haveLang) == l) && + language.Script(alt.haveScript) == s { + return language.Script(alt.wantScript) + } + } + return 0 +} + +// addIfNew adds a haveTag to the list of tags only if it is a unique tag. +// Tags that have the same maximized values are linked by index. +func (h *matchHeader) addIfNew(n haveTag, exact bool) { + h.original = h.original || exact + // Don't add new exact matches. + for _, v := range h.haveTags { + if equalsRest(v.tag, n.tag) { + return + } + } + // Allow duplicate maximized tags, but create a linked list to allow quickly + // comparing the equivalents and bail out. + for i, v := range h.haveTags { + if v.maxScript == n.maxScript && + v.maxRegion == n.maxRegion && + v.tag.VariantOrPrivateUseTags() == n.tag.VariantOrPrivateUseTags() { + for h.haveTags[i].nextMax != 0 { + i = int(h.haveTags[i].nextMax) + } + h.haveTags[i].nextMax = uint16(len(h.haveTags)) + break + } + } + h.haveTags = append(h.haveTags, &n) +} + +// header returns the matchHeader for the given language. It creates one if +// it doesn't already exist. +func (m *matcher) header(l language.Language) *matchHeader { + if h := m.index[l]; h != nil { + return h + } + h := &matchHeader{} + m.index[l] = h + return h +} + +func toConf(d uint8) Confidence { + if d <= 10 { + return High + } + if d < 30 { + return Low + } + return No +} + +// newMatcher builds an index for the given supported tags and returns it as +// a matcher. It also expands the index by considering various equivalence classes +// for a given tag. +func newMatcher(supported []Tag, options []MatchOption) *matcher { + m := &matcher{ + index: make(map[language.Language]*matchHeader), + preferSameScript: true, + } + for _, o := range options { + o(m) + } + if len(supported) == 0 { + m.default_ = &haveTag{} + return m + } + // Add supported languages to the index. Add exact matches first to give + // them precedence. + for i, tag := range supported { + tt := tag.tag() + pair, _ := makeHaveTag(tt, i) + m.header(tt.LangID).addIfNew(pair, true) + m.supported = append(m.supported, &pair) + } + m.default_ = m.header(supported[0].lang()).haveTags[0] + // Keep these in two different loops to support the case that two equivalent + // languages are distinguished, such as iw and he. + for i, tag := range supported { + tt := tag.tag() + pair, max := makeHaveTag(tt, i) + if max != tt.LangID { + m.header(max).addIfNew(pair, true) + } + } + + // update is used to add indexes in the map for equivalent languages. + // update will only add entries to original indexes, thus not computing any + // transitive relations. + update := func(want, have uint16, conf Confidence) { + if hh := m.index[language.Language(have)]; hh != nil { + if !hh.original { + return + } + hw := m.header(language.Language(want)) + for _, ht := range hh.haveTags { + v := *ht + if conf < v.conf { + v.conf = conf + } + v.nextMax = 0 // this value needs to be recomputed + if v.altScript != 0 { + v.altScript = altScript(language.Language(want), v.maxScript) + } + hw.addIfNew(v, conf == Exact && hh.original) + } + } + } + + // Add entries for languages with mutual intelligibility as defined by CLDR's + // languageMatch data. + for _, ml := range matchLang { + update(ml.want, ml.have, toConf(ml.distance)) + if !ml.oneway { + update(ml.have, ml.want, toConf(ml.distance)) + } + } + + // Add entries for possible canonicalizations. This is an optimization to + // ensure that only one map lookup needs to be done at runtime per desired tag. + // First we match deprecated equivalents. If they are perfect equivalents + // (their canonicalization simply substitutes a different language code, but + // nothing else), the match confidence is Exact, otherwise it is High. + for i, lm := range language.AliasMap { + // If deprecated codes match and there is no fiddling with the script or + // or region, we consider it an exact match. + conf := Exact + if language.AliasTypes[i] != language.Macro { + if !isExactEquivalent(language.Language(lm.From)) { + conf = High + } + update(lm.To, lm.From, conf) + } + update(lm.From, lm.To, conf) + } + return m +} + +// getBest gets the best matching tag in m for any of the given tags, taking into +// account the order of preference of the given tags. +func (m *matcher) getBest(want ...Tag) (got *haveTag, orig language.Tag, c Confidence) { + best := bestMatch{} + for i, ww := range want { + w := ww.tag() + var max language.Tag + // Check for exact match first. + h := m.index[w.LangID] + if w.LangID != 0 { + if h == nil { + continue + } + // Base language is defined. + max, _ = canonicalize(Legacy|Deprecated|Macro, w) + // A region that is added through canonicalization is stronger than + // a maximized region: set it in the original (e.g. mo -> ro-MD). + if w.RegionID != max.RegionID { + w.RegionID = max.RegionID + } + // TODO: should we do the same for scripts? + // See test case: en, sr, nl ; sh ; sr + max, _ = max.Maximize() + } else { + // Base language is not defined. + if h != nil { + for i := range h.haveTags { + have := h.haveTags[i] + if equalsRest(have.tag, w) { + return have, w, Exact + } + } + } + if w.ScriptID == 0 && w.RegionID == 0 { + // We skip all tags matching und for approximate matching, including + // private tags. + continue + } + max, _ = w.Maximize() + if h = m.index[max.LangID]; h == nil { + continue + } + } + pin := true + for _, t := range want[i+1:] { + if w.LangID == t.lang() { + pin = false + break + } + } + // Check for match based on maximized tag. + for i := range h.haveTags { + have := h.haveTags[i] + best.update(have, w, max.ScriptID, max.RegionID, pin) + if best.conf == Exact { + for have.nextMax != 0 { + have = h.haveTags[have.nextMax] + best.update(have, w, max.ScriptID, max.RegionID, pin) + } + return best.have, best.want, best.conf + } + } + } + if best.conf <= No { + if len(want) != 0 { + return nil, want[0].tag(), No + } + return nil, language.Tag{}, No + } + return best.have, best.want, best.conf +} + +// bestMatch accumulates the best match so far. +type bestMatch struct { + have *haveTag + want language.Tag + conf Confidence + pinnedRegion language.Region + pinLanguage bool + sameRegionGroup bool + // Cached results from applying tie-breaking rules. + origLang bool + origReg bool + paradigmReg bool + regGroupDist uint8 + origScript bool +} + +// update updates the existing best match if the new pair is considered to be a +// better match. To determine if the given pair is a better match, it first +// computes the rough confidence level. If this surpasses the current match, it +// will replace it and update the tie-breaker rule cache. If there is a tie, it +// proceeds with applying a series of tie-breaker rules. If there is no +// conclusive winner after applying the tie-breaker rules, it leaves the current +// match as the preferred match. +// +// If pin is true and have and tag are a strong match, it will henceforth only +// consider matches for this language. This corresponds to the nothing that most +// users have a strong preference for the first defined language. A user can +// still prefer a second language over a dialect of the preferred language by +// explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should +// be false. +func (m *bestMatch) update(have *haveTag, tag language.Tag, maxScript language.Script, maxRegion language.Region, pin bool) { + // Bail if the maximum attainable confidence is below that of the current best match. + c := have.conf + if c < m.conf { + return + } + // Don't change the language once we already have found an exact match. + if m.pinLanguage && tag.LangID != m.want.LangID { + return + } + // Pin the region group if we are comparing tags for the same language. + if tag.LangID == m.want.LangID && m.sameRegionGroup { + _, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.LangID) + if !sameGroup { + return + } + } + if c == Exact && have.maxScript == maxScript { + // If there is another language and then another entry of this language, + // don't pin anything, otherwise pin the language. + m.pinLanguage = pin + } + if equalsRest(have.tag, tag) { + } else if have.maxScript != maxScript { + // There is usually very little comprehension between different scripts. + // In a few cases there may still be Low comprehension. This possibility + // is pre-computed and stored in have.altScript. + if Low < m.conf || have.altScript != maxScript { + return + } + c = Low + } else if have.maxRegion != maxRegion { + if High < c { + // There is usually a small difference between languages across regions. + c = High + } + } + + // We store the results of the computations of the tie-breaker rules along + // with the best match. There is no need to do the checks once we determine + // we have a winner, but we do still need to do the tie-breaker computations. + // We use "beaten" to keep track if we still need to do the checks. + beaten := false // true if the new pair defeats the current one. + if c != m.conf { + if c < m.conf { + return + } + beaten = true + } + + // Tie-breaker rules: + // We prefer if the pre-maximized language was specified and identical. + origLang := have.tag.LangID == tag.LangID && tag.LangID != 0 + if !beaten && m.origLang != origLang { + if m.origLang { + return + } + beaten = true + } + + // We prefer if the pre-maximized region was specified and identical. + origReg := have.tag.RegionID == tag.RegionID && tag.RegionID != 0 + if !beaten && m.origReg != origReg { + if m.origReg { + return + } + beaten = true + } + + regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.LangID) + if !beaten && m.regGroupDist != regGroupDist { + if regGroupDist > m.regGroupDist { + return + } + beaten = true + } + + paradigmReg := isParadigmLocale(tag.LangID, have.maxRegion) + if !beaten && m.paradigmReg != paradigmReg { + if !paradigmReg { + return + } + beaten = true + } + + // Next we prefer if the pre-maximized script was specified and identical. + origScript := have.tag.ScriptID == tag.ScriptID && tag.ScriptID != 0 + if !beaten && m.origScript != origScript { + if m.origScript { + return + } + beaten = true + } + + // Update m to the newly found best match. + if beaten { + m.have = have + m.want = tag + m.conf = c + m.pinnedRegion = maxRegion + m.sameRegionGroup = sameGroup + m.origLang = origLang + m.origReg = origReg + m.paradigmReg = paradigmReg + m.origScript = origScript + m.regGroupDist = regGroupDist + } +} + +func isParadigmLocale(lang language.Language, r language.Region) bool { + for _, e := range paradigmLocales { + if language.Language(e[0]) == lang && (r == language.Region(e[1]) || r == language.Region(e[2])) { + return true + } + } + return false +} + +// regionGroupDist computes the distance between two regions based on their +// CLDR grouping. +func regionGroupDist(a, b language.Region, script language.Script, lang language.Language) (dist uint8, same bool) { + const defaultDistance = 4 + + aGroup := uint(regionToGroups[a]) << 1 + bGroup := uint(regionToGroups[b]) << 1 + for _, ri := range matchRegion { + if language.Language(ri.lang) == lang && (ri.script == 0 || language.Script(ri.script) == script) { + group := uint(1 << (ri.group &^ 0x80)) + if 0x80&ri.group == 0 { + if aGroup&bGroup&group != 0 { // Both regions are in the group. + return ri.distance, ri.distance == defaultDistance + } + } else { + if (aGroup|bGroup)&group == 0 { // Both regions are not in the group. + return ri.distance, ri.distance == defaultDistance + } + } + } + } + return defaultDistance, true +} + +// equalsRest compares everything except the language. +func equalsRest(a, b language.Tag) bool { + // TODO: don't include extensions in this comparison. To do this efficiently, + // though, we should handle private tags separately. + return a.ScriptID == b.ScriptID && a.RegionID == b.RegionID && a.VariantOrPrivateUseTags() == b.VariantOrPrivateUseTags() +} + +// isExactEquivalent returns true if canonicalizing the language will not alter +// the script or region of a tag. +func isExactEquivalent(l language.Language) bool { + for _, o := range notEquivalent { + if o == l { + return false + } + } + return true +} + +var notEquivalent []language.Language + +func init() { + // Create a list of all languages for which canonicalization may alter the + // script or region. + for _, lm := range language.AliasMap { + tag := language.Tag{LangID: language.Language(lm.From)} + if tag, _ = canonicalize(All, tag); tag.ScriptID != 0 || tag.RegionID != 0 { + notEquivalent = append(notEquivalent, language.Language(lm.From)) + } + } + // Maximize undefined regions of paradigm locales. + for i, v := range paradigmLocales { + t := language.Tag{LangID: language.Language(v[0])} + max, _ := t.Maximize() + if v[1] == 0 { + paradigmLocales[i][1] = uint16(max.RegionID) + } + if v[2] == 0 { + paradigmLocales[i][2] = uint16(max.RegionID) + } + } +} diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go new file mode 100644 index 0000000..11acfd8 --- /dev/null +++ b/vendor/golang.org/x/text/language/parse.go @@ -0,0 +1,228 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "errors" + "strconv" + "strings" + + "golang.org/x/text/internal/language" +) + +// ValueError is returned by any of the parsing functions when the +// input is well-formed but the respective subtag is not recognized +// as a valid value. +type ValueError interface { + error + + // Subtag returns the subtag for which the error occurred. + Subtag() string +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// The resulting tag is canonicalized using the default canonicalization type. +func Parse(s string) (t Tag, err error) { + return Default.Parse(s) +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// The resulting tag is canonicalized using the canonicalization type c. +func (c CanonType) Parse(s string) (t Tag, err error) { + tt, err := language.Parse(s) + if err != nil { + return makeTag(tt), err + } + tt, changed := canonicalize(c, tt) + if changed { + tt.RemakeString() + } + return makeTag(tt), err +} + +// Compose creates a Tag from individual parts, which may be of type Tag, Base, +// Script, Region, Variant, []Variant, Extension, []Extension or error. If a +// Base, Script or Region or slice of type Variant or Extension is passed more +// than once, the latter will overwrite the former. Variants and Extensions are +// accumulated, but if two extensions of the same type are passed, the latter +// will replace the former. For -u extensions, though, the key-type pairs are +// added, where later values overwrite older ones. A Tag overwrites all former +// values and typically only makes sense as the first argument. The resulting +// tag is returned after canonicalizing using the Default CanonType. If one or +// more errors are encountered, one of the errors is returned. +func Compose(part ...interface{}) (t Tag, err error) { + return Default.Compose(part...) +} + +// Compose creates a Tag from individual parts, which may be of type Tag, Base, +// Script, Region, Variant, []Variant, Extension, []Extension or error. If a +// Base, Script or Region or slice of type Variant or Extension is passed more +// than once, the latter will overwrite the former. Variants and Extensions are +// accumulated, but if two extensions of the same type are passed, the latter +// will replace the former. For -u extensions, though, the key-type pairs are +// added, where later values overwrite older ones. A Tag overwrites all former +// values and typically only makes sense as the first argument. The resulting +// tag is returned after canonicalizing using CanonType c. If one or more errors +// are encountered, one of the errors is returned. +func (c CanonType) Compose(part ...interface{}) (t Tag, err error) { + var b language.Builder + if err = update(&b, part...); err != nil { + return und, err + } + b.Tag, _ = canonicalize(c, b.Tag) + return makeTag(b.Make()), err +} + +var errInvalidArgument = errors.New("invalid Extension or Variant") + +func update(b *language.Builder, part ...interface{}) (err error) { + for _, x := range part { + switch v := x.(type) { + case Tag: + b.SetTag(v.tag()) + case Base: + b.Tag.LangID = v.langID + case Script: + b.Tag.ScriptID = v.scriptID + case Region: + b.Tag.RegionID = v.regionID + case Variant: + if v.variant == "" { + err = errInvalidArgument + break + } + b.AddVariant(v.variant) + case Extension: + if v.s == "" { + err = errInvalidArgument + break + } + b.SetExt(v.s) + case []Variant: + b.ClearVariants() + for _, v := range v { + b.AddVariant(v.variant) + } + case []Extension: + b.ClearExtensions() + for _, e := range v { + b.SetExt(e.s) + } + // TODO: support parsing of raw strings based on morphology or just extensions? + case error: + if v != nil { + err = v + } + } + } + return +} + +var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight") + +// ParseAcceptLanguage parses the contents of an Accept-Language header as +// defined in http://www.ietf.org/rfc/rfc2616.txt and returns a list of Tags and +// a list of corresponding quality weights. It is more permissive than RFC 2616 +// and may return non-nil slices even if the input is not valid. +// The Tags will be sorted by highest weight first and then by first occurrence. +// Tags with a weight of zero will be dropped. An error will be returned if the +// input could not be parsed. +func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) { + var entry string + for s != "" { + if entry, s = split(s, ','); entry == "" { + continue + } + + entry, weight := split(entry, ';') + + // Scan the language. + t, err := Parse(entry) + if err != nil { + id, ok := acceptFallback[entry] + if !ok { + return nil, nil, err + } + t = makeTag(language.Tag{LangID: id}) + } + + // Scan the optional weight. + w := 1.0 + if weight != "" { + weight = consume(weight, 'q') + weight = consume(weight, '=') + // consume returns the empty string when a token could not be + // consumed, resulting in an error for ParseFloat. + if w, err = strconv.ParseFloat(weight, 32); err != nil { + return nil, nil, errInvalidWeight + } + // Drop tags with a quality weight of 0. + if w <= 0 { + continue + } + } + + tag = append(tag, t) + q = append(q, float32(w)) + } + sortStable(&tagSort{tag, q}) + return tag, q, nil +} + +// consume removes a leading token c from s and returns the result or the empty +// string if there is no such token. +func consume(s string, c byte) string { + if s == "" || s[0] != c { + return "" + } + return strings.TrimSpace(s[1:]) +} + +func split(s string, c byte) (head, tail string) { + if i := strings.IndexByte(s, c); i >= 0 { + return strings.TrimSpace(s[:i]), strings.TrimSpace(s[i+1:]) + } + return strings.TrimSpace(s), "" +} + +// Add hack mapping to deal with a small number of cases that occur +// in Accept-Language (with reasonable frequency). +var acceptFallback = map[string]language.Language{ + "english": _en, + "deutsch": _de, + "italian": _it, + "french": _fr, + "*": _mul, // defined in the spec to match all languages. +} + +type tagSort struct { + tag []Tag + q []float32 +} + +func (s *tagSort) Len() int { + return len(s.q) +} + +func (s *tagSort) Less(i, j int) bool { + return s.q[i] > s.q[j] +} + +func (s *tagSort) Swap(i, j int) { + s.tag[i], s.tag[j] = s.tag[j], s.tag[i] + s.q[i], s.q[j] = s.q[j], s.q[i] +} diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go new file mode 100644 index 0000000..e228077 --- /dev/null +++ b/vendor/golang.org/x/text/language/tables.go @@ -0,0 +1,298 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +const ( + _de = 269 + _en = 313 + _fr = 350 + _it = 505 + _mo = 784 + _no = 879 + _nb = 839 + _pt = 960 + _sh = 1031 + _mul = 806 + _und = 0 +) +const ( + _001 = 1 + _419 = 31 + _BR = 65 + _CA = 73 + _ES = 110 + _GB = 123 + _MD = 188 + _PT = 238 + _UK = 306 + _US = 309 + _ZZ = 357 + _XA = 323 + _XC = 325 + _XK = 333 +) +const ( + _Latn = 87 + _Hani = 54 + _Hans = 56 + _Hant = 57 + _Qaaa = 139 + _Qaai = 147 + _Qabx = 188 + _Zinh = 236 + _Zyyy = 241 + _Zzzz = 242 +) + +var regionToGroups = []uint8{ // 357 elements + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x01, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x04, + // Entry 40 - 7F + 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, + 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, + // Entry 80 - BF + 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, + // Entry C0 - FF + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, + 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, + // Entry 140 - 17F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, +} // Size: 381 bytes + +var paradigmLocales = [][3]uint16{ // 3 elements + 0: [3]uint16{0x139, 0x0, 0x7b}, + 1: [3]uint16{0x13e, 0x0, 0x1f}, + 2: [3]uint16{0x3c0, 0x41, 0xee}, +} // Size: 42 bytes + +type mutualIntelligibility struct { + want uint16 + have uint16 + distance uint8 + oneway bool +} +type scriptIntelligibility struct { + wantLang uint16 + haveLang uint16 + wantScript uint8 + haveScript uint8 + distance uint8 +} +type regionIntelligibility struct { + lang uint16 + script uint8 + group uint8 + distance uint8 +} + +// matchLang holds pairs of langIDs of base languages that are typically +// mutually intelligible. Each pair is associated with a confidence and +// whether the intelligibility goes one or both ways. +var matchLang = []mutualIntelligibility{ // 113 elements + 0: {want: 0x1d1, have: 0xb7, distance: 0x4, oneway: false}, + 1: {want: 0x407, have: 0xb7, distance: 0x4, oneway: false}, + 2: {want: 0x407, have: 0x1d1, distance: 0x4, oneway: false}, + 3: {want: 0x407, have: 0x432, distance: 0x4, oneway: false}, + 4: {want: 0x43a, have: 0x1, distance: 0x4, oneway: false}, + 5: {want: 0x1a3, have: 0x10d, distance: 0x4, oneway: true}, + 6: {want: 0x295, have: 0x10d, distance: 0x4, oneway: true}, + 7: {want: 0x101, have: 0x36f, distance: 0x8, oneway: false}, + 8: {want: 0x101, have: 0x347, distance: 0x8, oneway: false}, + 9: {want: 0x5, have: 0x3e2, distance: 0xa, oneway: true}, + 10: {want: 0xd, have: 0x139, distance: 0xa, oneway: true}, + 11: {want: 0x16, have: 0x367, distance: 0xa, oneway: true}, + 12: {want: 0x21, have: 0x139, distance: 0xa, oneway: true}, + 13: {want: 0x56, have: 0x13e, distance: 0xa, oneway: true}, + 14: {want: 0x58, have: 0x3e2, distance: 0xa, oneway: true}, + 15: {want: 0x71, have: 0x3e2, distance: 0xa, oneway: true}, + 16: {want: 0x75, have: 0x139, distance: 0xa, oneway: true}, + 17: {want: 0x82, have: 0x1be, distance: 0xa, oneway: true}, + 18: {want: 0xa5, have: 0x139, distance: 0xa, oneway: true}, + 19: {want: 0xb2, have: 0x15e, distance: 0xa, oneway: true}, + 20: {want: 0xdd, have: 0x153, distance: 0xa, oneway: true}, + 21: {want: 0xe5, have: 0x139, distance: 0xa, oneway: true}, + 22: {want: 0xe9, have: 0x3a, distance: 0xa, oneway: true}, + 23: {want: 0xf0, have: 0x15e, distance: 0xa, oneway: true}, + 24: {want: 0xf9, have: 0x15e, distance: 0xa, oneway: true}, + 25: {want: 0x100, have: 0x139, distance: 0xa, oneway: true}, + 26: {want: 0x130, have: 0x139, distance: 0xa, oneway: true}, + 27: {want: 0x13c, have: 0x139, distance: 0xa, oneway: true}, + 28: {want: 0x140, have: 0x151, distance: 0xa, oneway: true}, + 29: {want: 0x145, have: 0x13e, distance: 0xa, oneway: true}, + 30: {want: 0x158, have: 0x101, distance: 0xa, oneway: true}, + 31: {want: 0x16d, have: 0x367, distance: 0xa, oneway: true}, + 32: {want: 0x16e, have: 0x139, distance: 0xa, oneway: true}, + 33: {want: 0x16f, have: 0x139, distance: 0xa, oneway: true}, + 34: {want: 0x17e, have: 0x139, distance: 0xa, oneway: true}, + 35: {want: 0x190, have: 0x13e, distance: 0xa, oneway: true}, + 36: {want: 0x194, have: 0x13e, distance: 0xa, oneway: true}, + 37: {want: 0x1a4, have: 0x1be, distance: 0xa, oneway: true}, + 38: {want: 0x1b4, have: 0x139, distance: 0xa, oneway: true}, + 39: {want: 0x1b8, have: 0x139, distance: 0xa, oneway: true}, + 40: {want: 0x1d4, have: 0x15e, distance: 0xa, oneway: true}, + 41: {want: 0x1d7, have: 0x3e2, distance: 0xa, oneway: true}, + 42: {want: 0x1d9, have: 0x139, distance: 0xa, oneway: true}, + 43: {want: 0x1e7, have: 0x139, distance: 0xa, oneway: true}, + 44: {want: 0x1f8, have: 0x139, distance: 0xa, oneway: true}, + 45: {want: 0x20e, have: 0x1e1, distance: 0xa, oneway: true}, + 46: {want: 0x210, have: 0x139, distance: 0xa, oneway: true}, + 47: {want: 0x22d, have: 0x15e, distance: 0xa, oneway: true}, + 48: {want: 0x242, have: 0x3e2, distance: 0xa, oneway: true}, + 49: {want: 0x24a, have: 0x139, distance: 0xa, oneway: true}, + 50: {want: 0x251, have: 0x139, distance: 0xa, oneway: true}, + 51: {want: 0x265, have: 0x139, distance: 0xa, oneway: true}, + 52: {want: 0x274, have: 0x48a, distance: 0xa, oneway: true}, + 53: {want: 0x28a, have: 0x3e2, distance: 0xa, oneway: true}, + 54: {want: 0x28e, have: 0x1f9, distance: 0xa, oneway: true}, + 55: {want: 0x2a3, have: 0x139, distance: 0xa, oneway: true}, + 56: {want: 0x2b5, have: 0x15e, distance: 0xa, oneway: true}, + 57: {want: 0x2b8, have: 0x139, distance: 0xa, oneway: true}, + 58: {want: 0x2be, have: 0x139, distance: 0xa, oneway: true}, + 59: {want: 0x2c3, have: 0x15e, distance: 0xa, oneway: true}, + 60: {want: 0x2ed, have: 0x139, distance: 0xa, oneway: true}, + 61: {want: 0x2f1, have: 0x15e, distance: 0xa, oneway: true}, + 62: {want: 0x2fa, have: 0x139, distance: 0xa, oneway: true}, + 63: {want: 0x2ff, have: 0x7e, distance: 0xa, oneway: true}, + 64: {want: 0x304, have: 0x139, distance: 0xa, oneway: true}, + 65: {want: 0x30b, have: 0x3e2, distance: 0xa, oneway: true}, + 66: {want: 0x31b, have: 0x1be, distance: 0xa, oneway: true}, + 67: {want: 0x31f, have: 0x1e1, distance: 0xa, oneway: true}, + 68: {want: 0x320, have: 0x139, distance: 0xa, oneway: true}, + 69: {want: 0x331, have: 0x139, distance: 0xa, oneway: true}, + 70: {want: 0x351, have: 0x139, distance: 0xa, oneway: true}, + 71: {want: 0x36a, have: 0x347, distance: 0xa, oneway: false}, + 72: {want: 0x36a, have: 0x36f, distance: 0xa, oneway: true}, + 73: {want: 0x37a, have: 0x139, distance: 0xa, oneway: true}, + 74: {want: 0x387, have: 0x139, distance: 0xa, oneway: true}, + 75: {want: 0x389, have: 0x139, distance: 0xa, oneway: true}, + 76: {want: 0x38b, have: 0x15e, distance: 0xa, oneway: true}, + 77: {want: 0x390, have: 0x139, distance: 0xa, oneway: true}, + 78: {want: 0x395, have: 0x139, distance: 0xa, oneway: true}, + 79: {want: 0x39d, have: 0x139, distance: 0xa, oneway: true}, + 80: {want: 0x3a5, have: 0x139, distance: 0xa, oneway: true}, + 81: {want: 0x3be, have: 0x139, distance: 0xa, oneway: true}, + 82: {want: 0x3c4, have: 0x13e, distance: 0xa, oneway: true}, + 83: {want: 0x3d4, have: 0x10d, distance: 0xa, oneway: true}, + 84: {want: 0x3d9, have: 0x139, distance: 0xa, oneway: true}, + 85: {want: 0x3e5, have: 0x15e, distance: 0xa, oneway: true}, + 86: {want: 0x3e9, have: 0x1be, distance: 0xa, oneway: true}, + 87: {want: 0x3fa, have: 0x139, distance: 0xa, oneway: true}, + 88: {want: 0x40c, have: 0x139, distance: 0xa, oneway: true}, + 89: {want: 0x423, have: 0x139, distance: 0xa, oneway: true}, + 90: {want: 0x429, have: 0x139, distance: 0xa, oneway: true}, + 91: {want: 0x431, have: 0x139, distance: 0xa, oneway: true}, + 92: {want: 0x43b, have: 0x139, distance: 0xa, oneway: true}, + 93: {want: 0x43e, have: 0x1e1, distance: 0xa, oneway: true}, + 94: {want: 0x445, have: 0x139, distance: 0xa, oneway: true}, + 95: {want: 0x450, have: 0x139, distance: 0xa, oneway: true}, + 96: {want: 0x461, have: 0x139, distance: 0xa, oneway: true}, + 97: {want: 0x467, have: 0x3e2, distance: 0xa, oneway: true}, + 98: {want: 0x46f, have: 0x139, distance: 0xa, oneway: true}, + 99: {want: 0x476, have: 0x3e2, distance: 0xa, oneway: true}, + 100: {want: 0x3883, have: 0x139, distance: 0xa, oneway: true}, + 101: {want: 0x480, have: 0x139, distance: 0xa, oneway: true}, + 102: {want: 0x482, have: 0x139, distance: 0xa, oneway: true}, + 103: {want: 0x494, have: 0x3e2, distance: 0xa, oneway: true}, + 104: {want: 0x49d, have: 0x139, distance: 0xa, oneway: true}, + 105: {want: 0x4ac, have: 0x529, distance: 0xa, oneway: true}, + 106: {want: 0x4b4, have: 0x139, distance: 0xa, oneway: true}, + 107: {want: 0x4bc, have: 0x3e2, distance: 0xa, oneway: true}, + 108: {want: 0x4e5, have: 0x15e, distance: 0xa, oneway: true}, + 109: {want: 0x4f2, have: 0x139, distance: 0xa, oneway: true}, + 110: {want: 0x512, have: 0x139, distance: 0xa, oneway: true}, + 111: {want: 0x518, have: 0x139, distance: 0xa, oneway: true}, + 112: {want: 0x52f, have: 0x139, distance: 0xa, oneway: true}, +} // Size: 702 bytes + +// matchScript holds pairs of scriptIDs where readers of one script +// can typically also read the other. Each is associated with a confidence. +var matchScript = []scriptIntelligibility{ // 26 elements + 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x57, haveScript: 0x1f, distance: 0x5}, + 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x1f, haveScript: 0x57, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x57, distance: 0xa}, + 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x1f, distance: 0xa}, + 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2b, haveScript: 0x57, distance: 0xa}, + 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4b, haveScript: 0x57, distance: 0xa}, + 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x57, distance: 0xa}, + 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x54, haveScript: 0x57, distance: 0xa}, + 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6b, haveScript: 0x57, distance: 0xa}, + 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x72, haveScript: 0x57, distance: 0xa}, + 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x21, haveScript: 0x57, distance: 0xa}, + 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x7d, haveScript: 0x57, distance: 0xa}, + 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x33, haveScript: 0x57, distance: 0xa}, + 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x57, distance: 0xa}, + 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x57, distance: 0xa}, + 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xca, haveScript: 0x57, distance: 0xa}, + 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xd7, haveScript: 0x57, distance: 0xa}, + 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xda, haveScript: 0x57, distance: 0xa}, + 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x29, haveScript: 0x57, distance: 0xa}, + 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa}, + 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x57, distance: 0xa}, + 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa}, + 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3b, haveScript: 0x57, distance: 0xa}, + 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x38, haveScript: 0x39, distance: 0xf}, + 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x39, haveScript: 0x38, distance: 0x13}, +} // Size: 232 bytes + +var matchRegion = []regionIntelligibility{ // 15 elements + 0: {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4}, + 1: {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4}, + 2: {lang: 0x139, script: 0x0, group: 0x1, distance: 0x4}, + 3: {lang: 0x139, script: 0x0, group: 0x81, distance: 0x4}, + 4: {lang: 0x13e, script: 0x0, group: 0x3, distance: 0x4}, + 5: {lang: 0x13e, script: 0x0, group: 0x83, distance: 0x4}, + 6: {lang: 0x3c0, script: 0x0, group: 0x3, distance: 0x4}, + 7: {lang: 0x3c0, script: 0x0, group: 0x83, distance: 0x4}, + 8: {lang: 0x529, script: 0x39, group: 0x2, distance: 0x4}, + 9: {lang: 0x529, script: 0x39, group: 0x82, distance: 0x4}, + 10: {lang: 0x3a, script: 0x0, group: 0x80, distance: 0x5}, + 11: {lang: 0x139, script: 0x0, group: 0x80, distance: 0x5}, + 12: {lang: 0x13e, script: 0x0, group: 0x80, distance: 0x5}, + 13: {lang: 0x3c0, script: 0x0, group: 0x80, distance: 0x5}, + 14: {lang: 0x529, script: 0x39, group: 0x80, distance: 0x5}, +} // Size: 114 bytes + +// Total table size 1471 bytes (1KiB); checksum: 4CB1CD46 diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go new file mode 100644 index 0000000..42ea792 --- /dev/null +++ b/vendor/golang.org/x/text/language/tags.go @@ -0,0 +1,145 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import "golang.org/x/text/internal/language/compact" + +// TODO: Various sets of commonly use tags and regions. + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func MustParse(s string) Tag { + t, err := Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func (c CanonType) MustParse(s string) Tag { + t, err := c.Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. +// It simplifies safe initialization of Base values. +func MustParseBase(s string) Base { + b, err := ParseBase(s) + if err != nil { + panic(err) + } + return b +} + +// MustParseScript is like ParseScript, but panics if the given script cannot be +// parsed. It simplifies safe initialization of Script values. +func MustParseScript(s string) Script { + scr, err := ParseScript(s) + if err != nil { + panic(err) + } + return scr +} + +// MustParseRegion is like ParseRegion, but panics if the given region cannot be +// parsed. It simplifies safe initialization of Region values. +func MustParseRegion(s string) Region { + r, err := ParseRegion(s) + if err != nil { + panic(err) + } + return r +} + +var ( + und = Tag{} + + Und Tag = Tag{} + + Afrikaans Tag = Tag(compact.Afrikaans) + Amharic Tag = Tag(compact.Amharic) + Arabic Tag = Tag(compact.Arabic) + ModernStandardArabic Tag = Tag(compact.ModernStandardArabic) + Azerbaijani Tag = Tag(compact.Azerbaijani) + Bulgarian Tag = Tag(compact.Bulgarian) + Bengali Tag = Tag(compact.Bengali) + Catalan Tag = Tag(compact.Catalan) + Czech Tag = Tag(compact.Czech) + Danish Tag = Tag(compact.Danish) + German Tag = Tag(compact.German) + Greek Tag = Tag(compact.Greek) + English Tag = Tag(compact.English) + AmericanEnglish Tag = Tag(compact.AmericanEnglish) + BritishEnglish Tag = Tag(compact.BritishEnglish) + Spanish Tag = Tag(compact.Spanish) + EuropeanSpanish Tag = Tag(compact.EuropeanSpanish) + LatinAmericanSpanish Tag = Tag(compact.LatinAmericanSpanish) + Estonian Tag = Tag(compact.Estonian) + Persian Tag = Tag(compact.Persian) + Finnish Tag = Tag(compact.Finnish) + Filipino Tag = Tag(compact.Filipino) + French Tag = Tag(compact.French) + CanadianFrench Tag = Tag(compact.CanadianFrench) + Gujarati Tag = Tag(compact.Gujarati) + Hebrew Tag = Tag(compact.Hebrew) + Hindi Tag = Tag(compact.Hindi) + Croatian Tag = Tag(compact.Croatian) + Hungarian Tag = Tag(compact.Hungarian) + Armenian Tag = Tag(compact.Armenian) + Indonesian Tag = Tag(compact.Indonesian) + Icelandic Tag = Tag(compact.Icelandic) + Italian Tag = Tag(compact.Italian) + Japanese Tag = Tag(compact.Japanese) + Georgian Tag = Tag(compact.Georgian) + Kazakh Tag = Tag(compact.Kazakh) + Khmer Tag = Tag(compact.Khmer) + Kannada Tag = Tag(compact.Kannada) + Korean Tag = Tag(compact.Korean) + Kirghiz Tag = Tag(compact.Kirghiz) + Lao Tag = Tag(compact.Lao) + Lithuanian Tag = Tag(compact.Lithuanian) + Latvian Tag = Tag(compact.Latvian) + Macedonian Tag = Tag(compact.Macedonian) + Malayalam Tag = Tag(compact.Malayalam) + Mongolian Tag = Tag(compact.Mongolian) + Marathi Tag = Tag(compact.Marathi) + Malay Tag = Tag(compact.Malay) + Burmese Tag = Tag(compact.Burmese) + Nepali Tag = Tag(compact.Nepali) + Dutch Tag = Tag(compact.Dutch) + Norwegian Tag = Tag(compact.Norwegian) + Punjabi Tag = Tag(compact.Punjabi) + Polish Tag = Tag(compact.Polish) + Portuguese Tag = Tag(compact.Portuguese) + BrazilianPortuguese Tag = Tag(compact.BrazilianPortuguese) + EuropeanPortuguese Tag = Tag(compact.EuropeanPortuguese) + Romanian Tag = Tag(compact.Romanian) + Russian Tag = Tag(compact.Russian) + Sinhala Tag = Tag(compact.Sinhala) + Slovak Tag = Tag(compact.Slovak) + Slovenian Tag = Tag(compact.Slovenian) + Albanian Tag = Tag(compact.Albanian) + Serbian Tag = Tag(compact.Serbian) + SerbianLatin Tag = Tag(compact.SerbianLatin) + Swedish Tag = Tag(compact.Swedish) + Swahili Tag = Tag(compact.Swahili) + Tamil Tag = Tag(compact.Tamil) + Telugu Tag = Tag(compact.Telugu) + Thai Tag = Tag(compact.Thai) + Turkish Tag = Tag(compact.Turkish) + Ukrainian Tag = Tag(compact.Ukrainian) + Urdu Tag = Tag(compact.Urdu) + Uzbek Tag = Tag(compact.Uzbek) + Vietnamese Tag = Tag(compact.Vietnamese) + Chinese Tag = Tag(compact.Chinese) + SimplifiedChinese Tag = Tag(compact.SimplifiedChinese) + TraditionalChinese Tag = Tag(compact.TraditionalChinese) + Zulu Tag = Tag(compact.Zulu) +) diff --git a/vendor/gopkg.in/yaml.v3/.travis.yml b/vendor/gopkg.in/yaml.v3/.travis.yml deleted file mode 100644 index 04d4dae..0000000 --- a/vendor/gopkg.in/yaml.v3/.travis.yml +++ /dev/null @@ -1,16 +0,0 @@ -language: go - -go: - - "1.4.x" - - "1.5.x" - - "1.6.x" - - "1.7.x" - - "1.8.x" - - "1.9.x" - - "1.10.x" - - "1.11.x" - - "1.12.x" - - "1.13.x" - - "tip" - -go_import_path: gopkg.in/yaml.v3 diff --git a/vendor/gopkg.in/yaml.v3/apic.go b/vendor/gopkg.in/yaml.v3/apic.go index 65846e6..ae7d049 100644 --- a/vendor/gopkg.in/yaml.v3/apic.go +++ b/vendor/gopkg.in/yaml.v3/apic.go @@ -108,6 +108,7 @@ func yaml_emitter_initialize(emitter *yaml_emitter_t) { raw_buffer: make([]byte, 0, output_raw_buffer_size), states: make([]yaml_emitter_state_t, 0, initial_stack_size), events: make([]yaml_event_t, 0, initial_queue_size), + best_width: -1, } } diff --git a/vendor/gopkg.in/yaml.v3/decode.go b/vendor/gopkg.in/yaml.v3/decode.go index be63169..df36e3a 100644 --- a/vendor/gopkg.in/yaml.v3/decode.go +++ b/vendor/gopkg.in/yaml.v3/decode.go @@ -35,6 +35,7 @@ type parser struct { doc *Node anchors map[string]*Node doneInit bool + textless bool } func newParser(b []byte) *parser { @@ -108,14 +109,18 @@ func (p *parser) peek() yaml_event_type_t { func (p *parser) fail() { var where string var line int - if p.parser.problem_mark.line != 0 { + if p.parser.context_mark.line != 0 { + line = p.parser.context_mark.line + // Scanner errors don't iterate line before returning error + if p.parser.error == yaml_SCANNER_ERROR { + line++ + } + } else if p.parser.problem_mark.line != 0 { line = p.parser.problem_mark.line // Scanner errors don't iterate line before returning error if p.parser.error == yaml_SCANNER_ERROR { line++ } - } else if p.parser.context_mark.line != 0 { - line = p.parser.context_mark.line } if line != 0 { where = "line " + strconv.Itoa(line) + ": " @@ -169,17 +174,20 @@ func (p *parser) node(kind Kind, defaultTag, tag, value string) *Node { } else if kind == ScalarNode { tag, _ = resolve("", value) } - return &Node{ - Kind: kind, - Tag: tag, - Value: value, - Style: style, - Line: p.event.start_mark.line + 1, - Column: p.event.start_mark.column + 1, - HeadComment: string(p.event.head_comment), - LineComment: string(p.event.line_comment), - FootComment: string(p.event.foot_comment), + n := &Node{ + Kind: kind, + Tag: tag, + Value: value, + Style: style, + } + if !p.textless { + n.Line = p.event.start_mark.line + 1 + n.Column = p.event.start_mark.column + 1 + n.HeadComment = string(p.event.head_comment) + n.LineComment = string(p.event.line_comment) + n.FootComment = string(p.event.foot_comment) } + return n } func (p *parser) parseChild(parent *Node) *Node { @@ -497,8 +505,13 @@ func (d *decoder) unmarshal(n *Node, out reflect.Value) (good bool) { good = d.mapping(n, out) case SequenceNode: good = d.sequence(n, out) + case 0: + if n.IsZero() { + return d.null(out) + } + fallthrough default: - panic("internal error: unknown node kind: " + strconv.Itoa(int(n.Kind))) + failf("cannot decode node with unknown kind %d", n.Kind) } return good } @@ -533,6 +546,17 @@ func resetMap(out reflect.Value) { } } +func (d *decoder) null(out reflect.Value) bool { + if out.CanAddr() { + switch out.Kind() { + case reflect.Interface, reflect.Ptr, reflect.Map, reflect.Slice: + out.Set(reflect.Zero(out.Type())) + return true + } + } + return false +} + func (d *decoder) scalar(n *Node, out reflect.Value) bool { var tag string var resolved interface{} @@ -550,14 +574,7 @@ func (d *decoder) scalar(n *Node, out reflect.Value) bool { } } if resolved == nil { - if out.CanAddr() { - switch out.Kind() { - case reflect.Interface, reflect.Ptr, reflect.Map, reflect.Slice: - out.Set(reflect.Zero(out.Type())) - return true - } - } - return false + return d.null(out) } if resolvedv := reflect.ValueOf(resolved); out.Type() == resolvedv.Type() { // We've resolved to exactly the type we want, so use that. @@ -791,8 +808,10 @@ func (d *decoder) mapping(n *Node, out reflect.Value) (good bool) { } } + mapIsNew := false if out.IsNil() { out.Set(reflect.MakeMap(outt)) + mapIsNew = true } for i := 0; i < l; i += 2 { if isMerge(n.Content[i]) { @@ -809,7 +828,7 @@ func (d *decoder) mapping(n *Node, out reflect.Value) (good bool) { failf("invalid map key: %#v", k.Interface()) } e := reflect.New(et).Elem() - if d.unmarshal(n.Content[i+1], e) { + if d.unmarshal(n.Content[i+1], e) || n.Content[i+1].ShortTag() == nullTag && (mapIsNew || !out.MapIndex(k).IsValid()) { out.SetMapIndex(k, e) } } diff --git a/vendor/gopkg.in/yaml.v3/emitterc.go b/vendor/gopkg.in/yaml.v3/emitterc.go index ab2a066..0f47c9c 100644 --- a/vendor/gopkg.in/yaml.v3/emitterc.go +++ b/vendor/gopkg.in/yaml.v3/emitterc.go @@ -235,10 +235,13 @@ func yaml_emitter_increase_indent(emitter *yaml_emitter_t, flow, indentless bool emitter.indent = 0 } } else if !indentless { - emitter.indent += emitter.best_indent - // [Go] If inside a block sequence item, discount the space taken by the indicator. - if emitter.best_indent > 2 && emitter.states[len(emitter.states)-1] == yaml_EMIT_BLOCK_SEQUENCE_ITEM_STATE { - emitter.indent -= 2 + // [Go] This was changed so that indentations are more regular. + if emitter.states[len(emitter.states)-1] == yaml_EMIT_BLOCK_SEQUENCE_ITEM_STATE { + // The first indent inside a sequence will just skip the "- " indicator. + emitter.indent += 2 + } else { + // Everything else aligns to the chosen indentation. + emitter.indent = emitter.best_indent*((emitter.indent+emitter.best_indent)/emitter.best_indent) } } return true @@ -725,16 +728,9 @@ func yaml_emitter_emit_flow_mapping_value(emitter *yaml_emitter_t, event *yaml_e // Expect a block item node. func yaml_emitter_emit_block_sequence_item(emitter *yaml_emitter_t, event *yaml_event_t, first bool) bool { if first { - // [Go] The original logic here would not indent the sequence when inside a mapping. - // In Go we always indent it, but take the sequence indicator out of the indentation. - indentless := emitter.best_indent == 2 && emitter.mapping_context && (emitter.column == 0 || !emitter.indention) - original := emitter.indent - if !yaml_emitter_increase_indent(emitter, false, indentless) { + if !yaml_emitter_increase_indent(emitter, false, false) { return false } - if emitter.indent > original+2 { - emitter.indent -= 2 - } } if event.typ == yaml_SEQUENCE_END_EVENT { emitter.indent = emitter.indents[len(emitter.indents)-1] @@ -785,6 +781,13 @@ func yaml_emitter_emit_block_mapping_key(emitter *yaml_emitter_t, event *yaml_ev if !yaml_emitter_write_indent(emitter) { return false } + if len(emitter.line_comment) > 0 { + // [Go] A line comment was provided for the key. That's unusual as the + // scanner associates line comments with the value. Either way, + // save the line comment and render it appropriately later. + emitter.key_line_comment = emitter.line_comment + emitter.line_comment = nil + } if yaml_emitter_check_simple_key(emitter) { emitter.states = append(emitter.states, yaml_EMIT_BLOCK_MAPPING_SIMPLE_VALUE_STATE) return yaml_emitter_emit_node(emitter, event, false, false, true, true) @@ -810,6 +813,27 @@ func yaml_emitter_emit_block_mapping_value(emitter *yaml_emitter_t, event *yaml_ return false } } + if len(emitter.key_line_comment) > 0 { + // [Go] Line comments are generally associated with the value, but when there's + // no value on the same line as a mapping key they end up attached to the + // key itself. + if event.typ == yaml_SCALAR_EVENT { + if len(emitter.line_comment) == 0 { + // A scalar is coming and it has no line comments by itself yet, + // so just let it handle the line comment as usual. If it has a + // line comment, we can't have both so the one from the key is lost. + emitter.line_comment = emitter.key_line_comment + emitter.key_line_comment = nil + } + } else if event.sequence_style() != yaml_FLOW_SEQUENCE_STYLE && (event.typ == yaml_MAPPING_START_EVENT || event.typ == yaml_SEQUENCE_START_EVENT) { + // An indented block follows, so write the comment right now. + emitter.line_comment, emitter.key_line_comment = emitter.key_line_comment, emitter.line_comment + if !yaml_emitter_process_line_comment(emitter) { + return false + } + emitter.line_comment, emitter.key_line_comment = emitter.key_line_comment, emitter.line_comment + } + } emitter.states = append(emitter.states, yaml_EMIT_BLOCK_MAPPING_KEY_STATE) if !yaml_emitter_emit_node(emitter, event, false, false, true, false) { return false @@ -823,6 +847,10 @@ func yaml_emitter_emit_block_mapping_value(emitter *yaml_emitter_t, event *yaml_ return true } +func yaml_emitter_silent_nil_event(emitter *yaml_emitter_t, event *yaml_event_t) bool { + return event.typ == yaml_SCALAR_EVENT && event.implicit && !emitter.canonical && len(emitter.scalar_data.value) == 0 +} + // Expect a node. func yaml_emitter_emit_node(emitter *yaml_emitter_t, event *yaml_event_t, root bool, sequence bool, mapping bool, simple_key bool) bool { @@ -1866,7 +1894,7 @@ func yaml_emitter_write_literal_scalar(emitter *yaml_emitter_t, value []byte) bo if !yaml_emitter_write_block_scalar_hints(emitter, value) { return false } - if !put_break(emitter) { + if !yaml_emitter_process_line_comment(emitter) { return false } //emitter.indention = true @@ -1903,10 +1931,10 @@ func yaml_emitter_write_folded_scalar(emitter *yaml_emitter_t, value []byte) boo if !yaml_emitter_write_block_scalar_hints(emitter, value) { return false } - - if !put_break(emitter) { + if !yaml_emitter_process_line_comment(emitter) { return false } + //emitter.indention = true emitter.whitespace = true diff --git a/vendor/gopkg.in/yaml.v3/encode.go b/vendor/gopkg.in/yaml.v3/encode.go index 1f37271..de9e72a 100644 --- a/vendor/gopkg.in/yaml.v3/encode.go +++ b/vendor/gopkg.in/yaml.v3/encode.go @@ -119,6 +119,14 @@ func (e *encoder) marshal(tag string, in reflect.Value) { case *Node: e.nodev(in) return + case Node: + if !in.CanAddr() { + var n = reflect.New(in.Type()).Elem() + n.Set(in) + in = n + } + e.nodev(in.Addr()) + return case time.Time: e.timev(tag, in) return @@ -422,18 +430,23 @@ func (e *encoder) nodev(in reflect.Value) { } func (e *encoder) node(node *Node, tail string) { + // Zero nodes behave as nil. + if node.Kind == 0 && node.IsZero() { + e.nilv() + return + } + // If the tag was not explicitly requested, and dropping it won't change the // implicit tag of the value, don't include it in the presentation. var tag = node.Tag var stag = shortTag(tag) - var rtag string var forceQuoting bool if tag != "" && node.Style&TaggedStyle == 0 { if node.Kind == ScalarNode { if stag == strTag && node.Style&(SingleQuotedStyle|DoubleQuotedStyle|LiteralStyle|FoldedStyle) != 0 { tag = "" } else { - rtag, _ = resolve("", node.Value) + rtag, _ := resolve("", node.Value) if rtag == stag { tag = "" } else if stag == strTag { @@ -442,6 +455,7 @@ func (e *encoder) node(node *Node, tail string) { } } } else { + var rtag string switch node.Kind { case MappingNode: rtag = mapTag @@ -471,7 +485,7 @@ func (e *encoder) node(node *Node, tail string) { if node.Style&FlowStyle != 0 { style = yaml_FLOW_SEQUENCE_STYLE } - e.must(yaml_sequence_start_event_initialize(&e.event, []byte(node.Anchor), []byte(tag), tag == "", style)) + e.must(yaml_sequence_start_event_initialize(&e.event, []byte(node.Anchor), []byte(longTag(tag)), tag == "", style)) e.event.head_comment = []byte(node.HeadComment) e.emit() for _, node := range node.Content { @@ -487,7 +501,7 @@ func (e *encoder) node(node *Node, tail string) { if node.Style&FlowStyle != 0 { style = yaml_FLOW_MAPPING_STYLE } - yaml_mapping_start_event_initialize(&e.event, []byte(node.Anchor), []byte(tag), tag == "", style) + yaml_mapping_start_event_initialize(&e.event, []byte(node.Anchor), []byte(longTag(tag)), tag == "", style) e.event.tail_comment = []byte(tail) e.event.head_comment = []byte(node.HeadComment) e.emit() @@ -528,11 +542,11 @@ func (e *encoder) node(node *Node, tail string) { case ScalarNode: value := node.Value if !utf8.ValidString(value) { - if tag == binaryTag { + if stag == binaryTag { failf("explicitly tagged !!binary data must be base64-encoded") } - if tag != "" { - failf("cannot marshal invalid UTF-8 data as %s", shortTag(tag)) + if stag != "" { + failf("cannot marshal invalid UTF-8 data as %s", stag) } // It can't be encoded directly as YAML so use a binary tag // and encode it as base64. @@ -557,5 +571,7 @@ func (e *encoder) node(node *Node, tail string) { } e.emitScalar(value, node.Anchor, tag, style, []byte(node.HeadComment), []byte(node.LineComment), []byte(node.FootComment), []byte(tail)) + default: + failf("cannot encode node with unknown kind %d", node.Kind) } } diff --git a/vendor/gopkg.in/yaml.v3/parserc.go b/vendor/gopkg.in/yaml.v3/parserc.go index aea9050..ac66fcc 100644 --- a/vendor/gopkg.in/yaml.v3/parserc.go +++ b/vendor/gopkg.in/yaml.v3/parserc.go @@ -648,6 +648,10 @@ func yaml_parser_parse_node(parser *yaml_parser_t, event *yaml_event_t, block, i implicit: implicit, style: yaml_style_t(yaml_BLOCK_MAPPING_STYLE), } + if parser.stem_comment != nil { + event.head_comment = parser.stem_comment + parser.stem_comment = nil + } return true } if len(anchor) > 0 || len(tag) > 0 { @@ -694,25 +698,13 @@ func yaml_parser_parse_block_sequence_entry(parser *yaml_parser_t, event *yaml_e if token.typ == yaml_BLOCK_ENTRY_TOKEN { mark := token.end_mark - prior_head := len(parser.head_comment) + prior_head_len := len(parser.head_comment) skip_token(parser) + yaml_parser_split_stem_comment(parser, prior_head_len) token = peek_token(parser) if token == nil { return false } - if prior_head > 0 && token.typ == yaml_BLOCK_SEQUENCE_START_TOKEN { - // [Go] It's a sequence under a sequence entry, so the former head comment - // is for the list itself, not the first list item under it. - parser.stem_comment = parser.head_comment[:prior_head] - if len(parser.head_comment) == prior_head { - parser.head_comment = nil - } else { - // Copy suffix to prevent very strange bugs if someone ever appends - // further bytes to the prefix in the stem_comment slice above. - parser.head_comment = append([]byte(nil), parser.head_comment[prior_head+1:]...) - } - - } if token.typ != yaml_BLOCK_ENTRY_TOKEN && token.typ != yaml_BLOCK_END_TOKEN { parser.states = append(parser.states, yaml_PARSE_BLOCK_SEQUENCE_ENTRY_STATE) return yaml_parser_parse_node(parser, event, true, false) @@ -754,7 +746,9 @@ func yaml_parser_parse_indentless_sequence_entry(parser *yaml_parser_t, event *y if token.typ == yaml_BLOCK_ENTRY_TOKEN { mark := token.end_mark + prior_head_len := len(parser.head_comment) skip_token(parser) + yaml_parser_split_stem_comment(parser, prior_head_len) token = peek_token(parser) if token == nil { return false @@ -780,6 +774,32 @@ func yaml_parser_parse_indentless_sequence_entry(parser *yaml_parser_t, event *y return true } +// Split stem comment from head comment. +// +// When a sequence or map is found under a sequence entry, the former head comment +// is assigned to the underlying sequence or map as a whole, not the individual +// sequence or map entry as would be expected otherwise. To handle this case the +// previous head comment is moved aside as the stem comment. +func yaml_parser_split_stem_comment(parser *yaml_parser_t, stem_len int) { + if stem_len == 0 { + return + } + + token := peek_token(parser) + if token.typ != yaml_BLOCK_SEQUENCE_START_TOKEN && token.typ != yaml_BLOCK_MAPPING_START_TOKEN { + return + } + + parser.stem_comment = parser.head_comment[:stem_len] + if len(parser.head_comment) == stem_len { + parser.head_comment = nil + } else { + // Copy suffix to prevent very strange bugs if someone ever appends + // further bytes to the prefix in the stem_comment slice above. + parser.head_comment = append([]byte(nil), parser.head_comment[stem_len+1:]...) + } +} + // Parse the productions: // block_mapping ::= BLOCK-MAPPING_START // ******************* diff --git a/vendor/gopkg.in/yaml.v3/scannerc.go b/vendor/gopkg.in/yaml.v3/scannerc.go index 57e954c..ca00701 100644 --- a/vendor/gopkg.in/yaml.v3/scannerc.go +++ b/vendor/gopkg.in/yaml.v3/scannerc.go @@ -749,6 +749,11 @@ func yaml_parser_fetch_next_token(parser *yaml_parser_t) (ok bool) { if !ok { return } + if len(parser.tokens) > 0 && parser.tokens[len(parser.tokens)-1].typ == yaml_BLOCK_ENTRY_TOKEN { + // Sequence indicators alone have no line comments. It becomes + // a head comment for whatever follows. + return + } if !yaml_parser_scan_line_comment(parser, comment_mark) { ok = false return @@ -2255,10 +2260,9 @@ func yaml_parser_scan_block_scalar(parser *yaml_parser_t, token *yaml_token_t, l } } if parser.buffer[parser.buffer_pos] == '#' { - // TODO Test this and then re-enable it. - //if !yaml_parser_scan_line_comment(parser, start_mark) { - // return false - //} + if !yaml_parser_scan_line_comment(parser, start_mark) { + return false + } for !is_breakz(parser.buffer, parser.buffer_pos) { skip(parser) if parser.unread < 1 && !yaml_parser_update_buffer(parser, 1) { @@ -2856,13 +2860,12 @@ func yaml_parser_scan_line_comment(parser *yaml_parser_t, token_mark yaml_mark_t return false } skip_line(parser) - } else { - if parser.mark.index >= seen { - if len(text) == 0 { - start_mark = parser.mark - } - text = append(text, parser.buffer[parser.buffer_pos]) + } else if parser.mark.index >= seen { + if len(text) == 0 { + start_mark = parser.mark } + text = read(parser, text) + } else { skip(parser) } } @@ -2888,6 +2891,10 @@ func yaml_parser_scan_comments(parser *yaml_parser_t, scan_mark yaml_mark_t) boo var token_mark = token.start_mark var start_mark yaml_mark_t + var next_indent = parser.indent + if next_indent < 0 { + next_indent = 0 + } var recent_empty = false var first_empty = parser.newlines <= 1 @@ -2919,15 +2926,18 @@ func yaml_parser_scan_comments(parser *yaml_parser_t, scan_mark yaml_mark_t) boo continue } c := parser.buffer[parser.buffer_pos+peek] - if is_breakz(parser.buffer, parser.buffer_pos+peek) || parser.flow_level > 0 && (c == ']' || c == '}') { + var close_flow = parser.flow_level > 0 && (c == ']' || c == '}') + if close_flow || is_breakz(parser.buffer, parser.buffer_pos+peek) { // Got line break or terminator. - if !recent_empty { - if first_empty && (start_mark.line == foot_line || start_mark.column-1 < parser.indent) { + if close_flow || !recent_empty { + if close_flow || first_empty && (start_mark.line == foot_line && token.typ != yaml_VALUE_TOKEN || start_mark.column-1 < next_indent) { // This is the first empty line and there were no empty lines before, // so this initial part of the comment is a foot of the prior token // instead of being a head for the following one. Split it up. + // Alternatively, this might also be the last comment inside a flow + // scope, so it must be a footer. if len(text) > 0 { - if start_mark.column-1 < parser.indent { + if start_mark.column-1 < next_indent { // If dedented it's unrelated to the prior token. token_mark = start_mark } @@ -2958,7 +2968,7 @@ func yaml_parser_scan_comments(parser *yaml_parser_t, scan_mark yaml_mark_t) boo continue } - if len(text) > 0 && column < parser.indent+1 && column != start_mark.column { + if len(text) > 0 && (close_flow || column-1 < next_indent && column != start_mark.column) { // The comment at the different indentation is a foot of the // preceding data rather than a head of the upcoming one. parser.comments = append(parser.comments, yaml_comment_t{ @@ -2999,10 +3009,9 @@ func yaml_parser_scan_comments(parser *yaml_parser_t, scan_mark yaml_mark_t) boo return false } skip_line(parser) + } else if parser.mark.index >= seen { + text = read(parser, text) } else { - if parser.mark.index >= seen { - text = append(text, parser.buffer[parser.buffer_pos]) - } skip(parser) } } @@ -3010,6 +3019,10 @@ func yaml_parser_scan_comments(parser *yaml_parser_t, scan_mark yaml_mark_t) boo peek = 0 column = 0 line = parser.mark.line + next_indent = parser.indent + if next_indent < 0 { + next_indent = 0 + } } if len(text) > 0 { diff --git a/vendor/gopkg.in/yaml.v3/yaml.go b/vendor/gopkg.in/yaml.v3/yaml.go index b5d35a5..8cec6da 100644 --- a/vendor/gopkg.in/yaml.v3/yaml.go +++ b/vendor/gopkg.in/yaml.v3/yaml.go @@ -89,7 +89,7 @@ func Unmarshal(in []byte, out interface{}) (err error) { return unmarshal(in, out, false) } -// A Decorder reads and decodes YAML values from an input stream. +// A Decoder reads and decodes YAML values from an input stream. type Decoder struct { parser *parser knownFields bool @@ -194,7 +194,7 @@ func unmarshal(in []byte, out interface{}, strict bool) (err error) { // Zero valued structs will be omitted if all their public // fields are zero, unless they implement an IsZero // method (see the IsZeroer interface type), in which -// case the field will be included if that method returns true. +// case the field will be excluded if IsZero returns true. // // flow Marshal using a flow style (useful for structs, // sequences and maps). @@ -252,6 +252,24 @@ func (e *Encoder) Encode(v interface{}) (err error) { return nil } +// Encode encodes value v and stores its representation in n. +// +// See the documentation for Marshal for details about the +// conversion of Go values into YAML. +func (n *Node) Encode(v interface{}) (err error) { + defer handleErr(&err) + e := newEncoder() + defer e.destroy() + e.marshalDoc("", reflect.ValueOf(v)) + e.finish() + p := newParser(e.out) + p.textless = true + defer p.destroy() + doc := p.parse() + *n = *doc.Content[0] + return nil +} + // SetIndent changes the used indentation used when encoding. func (e *Encoder) SetIndent(spaces int) { if spaces < 0 { @@ -328,6 +346,12 @@ const ( // and maps, Node is an intermediate representation that allows detailed // control over the content being decoded or encoded. // +// It's worth noting that although Node offers access into details such as +// line numbers, colums, and comments, the content when re-encoded will not +// have its original textual representation preserved. An effort is made to +// render the data plesantly, and to preserve comments near the data they +// describe, though. +// // Values that make use of the Node type interact with the yaml package in the // same way any other type would do, by encoding and decoding yaml data // directly or indirectly into them. @@ -391,6 +415,13 @@ type Node struct { Column int } +// IsZero returns whether the node has all of its fields unset. +func (n *Node) IsZero() bool { + return n.Kind == 0 && n.Style == 0 && n.Tag == "" && n.Value == "" && n.Anchor == "" && n.Alias == nil && n.Content == nil && + n.HeadComment == "" && n.LineComment == "" && n.FootComment == "" && n.Line == 0 && n.Column == 0 +} + + // LongTag returns the long form of the tag that indicates the data type for // the node. If the Tag field isn't explicitly defined, one will be computed // based on the node properties. @@ -418,6 +449,11 @@ func (n *Node) ShortTag() string { case ScalarNode: tag, _ := resolve("", n.Value) return tag + case 0: + // Special case to make the zero value convenient. + if n.IsZero() { + return nullTag + } } return "" } diff --git a/vendor/gopkg.in/yaml.v3/yamlh.go b/vendor/gopkg.in/yaml.v3/yamlh.go index 2719cfb..7c6d007 100644 --- a/vendor/gopkg.in/yaml.v3/yamlh.go +++ b/vendor/gopkg.in/yaml.v3/yamlh.go @@ -787,6 +787,8 @@ type yaml_emitter_t struct { foot_comment []byte tail_comment []byte + key_line_comment []byte + // Dumper stuff opened bool // If the stream was already opened? diff --git a/vendor/modules.txt b/vendor/modules.txt index d4c2734..23f0e3e 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -11,20 +11,18 @@ github.com/cespare/xxhash/v2 # github.com/davecgh/go-spew v1.1.1 github.com/davecgh/go-spew/spew # github.com/go-playground/locales v0.13.0 -## explicit github.com/go-playground/locales github.com/go-playground/locales/currency -# github.com/go-playground/universal-translator v0.16.0 -## explicit +# github.com/go-playground/universal-translator v0.17.0 github.com/go-playground/universal-translator +# github.com/go-playground/validator/v10 v10.5.0 +## explicit +github.com/go-playground/validator/v10 # github.com/golang/protobuf v1.3.2 github.com/golang/protobuf/proto # github.com/google/go-cmp v0.3.1 ## explicit -# github.com/kr/pretty v0.1.0 -## explicit # github.com/leodido/go-urn v1.2.0 -## explicit github.com/leodido/go-urn # github.com/matttproud/golang_protobuf_extensions v1.0.1 github.com/matttproud/golang_protobuf_extensions/pbutil @@ -45,15 +43,17 @@ github.com/prometheus/common/model github.com/prometheus/procfs github.com/prometheus/procfs/internal/fs github.com/prometheus/procfs/internal/util -# github.com/stretchr/testify v1.6.1 +# github.com/stretchr/testify v1.7.0 ## explicit github.com/stretchr/testify/assert github.com/stretchr/testify/require -# go.uber.org/atomic v1.6.0 +# go.uber.org/atomic v1.8.0 +## explicit go.uber.org/atomic -# go.uber.org/multierr v1.5.0 +# go.uber.org/multierr v1.7.0 +## explicit go.uber.org/multierr -# go.uber.org/zap v1.16.0 +# go.uber.org/zap v1.18.1 ## explicit go.uber.org/zap go.uber.org/zap/buffer @@ -61,14 +61,15 @@ go.uber.org/zap/internal/bufferpool go.uber.org/zap/internal/color go.uber.org/zap/internal/exit go.uber.org/zap/zapcore +# golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9 +golang.org/x/crypto/sha3 # golang.org/x/sys v0.0.0-20191010194322-b09406accb47 +golang.org/x/sys/cpu golang.org/x/sys/windows -# gopkg.in/check.v1 v1.0.0-20180628173108-788fd7840127 -## explicit -# gopkg.in/go-playground/assert.v1 v1.2.1 -## explicit -# gopkg.in/go-playground/validator.v9 v9.30.0 -## explicit -gopkg.in/go-playground/validator.v9 -# gopkg.in/yaml.v3 v3.0.0-20200313102051-9f266ea9e77c +# golang.org/x/text v0.3.2 +golang.org/x/text/internal/language +golang.org/x/text/internal/language/compact +golang.org/x/text/internal/tag +golang.org/x/text/language +# gopkg.in/yaml.v3 v3.0.0-20210107192922-496545a6307b gopkg.in/yaml.v3